Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YDR096W (GIS1)89487937090.0
Scas_681.198645148661e-102
AGR117C7995308461e-100
YER169W (RPH1)7964827702e-89
Kwal_56.234538285487662e-88
KLLA0C17710g8215287171e-81
CAGL0L11880g9803646624e-73
Scas_76.12281302482e-23
CAGL0H00528g7401182189e-18
ABR167C7761212162e-17
Kwal_55.218555211212114e-17
KLLA0D10758g8501772082e-16
Sklu_2303.67951212063e-16
Scas_691.277351511992e-15
YJR119C7281121946e-15
CAGL0G08107g625631866e-14
Scas_649.28730821713e-12
Scas_709.32822561705e-12
Scas_602.9547621543e-10
CAGL0L06072g300611494e-10
CAGL0E04884g1489531544e-10
Sklu_2181.1410541514e-10
AGR172W1057621536e-10
AGR031W140501398e-10
Kwal_47.17241403541491e-09
KLLA0F13046g1379621511e-09
YKL062W (MSN4)630541492e-09
ACL057W520541472e-09
KLLA0C17072g474541472e-09
Sklu_2357.7157501373e-09
CAGL0M13189g541581463e-09
KLLA0F26961g694561463e-09
CAGL0K02145g317621433e-09
Scas_703.231341631455e-09
Scas_721.921152531448e-09
Kwal_26.8351698511411e-08
ABR089C571511402e-08
YDR043C (NRG1)231501342e-08
YJR127C (ZMS1)1380631412e-08
Sklu_2351.6548551392e-08
KLLA0B04477g1332631393e-08
Kwal_27.10925264501343e-08
CAGL0K12078g463501373e-08
Kwal_47.166211178631383e-08
YML081W1251631384e-08
CAGL0M00594g1020631375e-08
Scas_707.31289621335e-08
AER159C1191631375e-08
KLLA0F18524g357501346e-08
CAGL0A01628g424801347e-08
YER130C443621339e-08
Sklu_2443.22213631281e-07
CAGL0F05995g597541321e-07
YMR037C (MSN2)704511321e-07
CAGL0H04213g1321741312e-07
Scas_718.44266501263e-07
YDR216W (ADR1)1323561285e-07
Kwal_14.2278463781266e-07
KLLA0E10989g474551267e-07
YGL035C (MIG1)504661267e-07
Scas_569.2293501238e-07
YOR113W (AZF1)914511268e-07
AFR471C389551231e-06
Scas_717.17525531232e-06
CAGL0L07480g314501202e-06
YBR066C (NRG2)220581182e-06
ACR264W769511222e-06
KLLA0B07909g922491223e-06
CAGL0K09372g396501203e-06
AFR580C838501213e-06
KLLA0F23782g782501214e-06
CAGL0K04631g1013511214e-06
Scas_697.35839511204e-06
Kwal_47.17888786501204e-06
Scas_575.3455551195e-06
YGR067C794561205e-06
YPL038W (MET31)177531135e-06
Scas_712.42*290511167e-06
Scas_683.25879511161e-05
Scas_719.681350631162e-05
YGL209W (MIG2)382511132e-05
AGL207W277501112e-05
KLLA0B00605g239511093e-05
Scas_378.1208601084e-05
YMR070W (MOT3)490581114e-05
Kwal_26.8021507521106e-05
Kwal_47.19045266521076e-05
KLLA0B03454g472541097e-05
Scas_693.31635531099e-05
YPL230W391431089e-05
AGL071C396531071e-04
CAGL0L03916g642501062e-04
Scas_687.33288511023e-04
YDR253C (MET32)19150994e-04
CAGL0M06831g645481035e-04
YDR146C (SWI5)709461025e-04
KLLA0E08679g596451025e-04
CAGL0C02519g318501006e-04
Kwal_56.242061502931019e-04
CAGL0M01870g31570980.001
Kwal_27.1146053149980.001
YER028C39451980.001
KLLA0E18645g43152980.001
YMR182C (RGM1)21144950.001
AGL197W84477980.002
Kwal_14.220625448950.002
ADL198W54777970.002
KLLA0D16456g85447980.002
KLLA0F11682g37450960.002
Scas_568.519952940.002
Kwal_23.540042944960.002
Kwal_56.2392574553970.002
Scas_720.3331653950.002
CAGL0J05060g71341960.003
YJL056C (ZAP1)88041960.003
AEL174W66149950.003
CAGL0E06116g61343950.004
Sklu_2389.276744950.004
CAGL0K03003g64750950.004
Scas_636.14d27546920.005
Scas_717.60d16758890.005
KLLA0F20636g28554910.006
CAGL0E01331g68946930.007
Scas_711.5683241930.007
Scas_627.17d27546900.010
CAGL0B02651g18952880.010
Scas_631.743364900.011
YNL027W (CRZ1)67858910.012
AGL246W22754880.012
CAGL0G10021g39453900.013
KLLA0A04609g42356890.014
KLLA0F01463g78144900.015
KLLA0C16005g33145890.015
Kwal_14.254371151890.020
AEL278W47650880.020
CAGL0M04323g70355880.022
YLR131C (ACE2)77043890.022
CAGL0L12562g22348850.027
Scas_695.257148870.028
AFL136W40943870.029
YPR186C (PZF1)42953870.032
Sklu_2126.544844850.045
CAGL0I02838g65539850.050
Kwal_47.1657788148860.052
Scas_718.6747379840.060
CAGL0E04312g68871850.062
AFL127C1521208850.067
Scas_627.6120758850.068
Sklu_1527.120550820.071
Kwal_47.1833753689840.077
YDL020C (RPN4)53182830.089
Kwal_27.1046730250820.11
Scas_721.5619949800.11
Sklu_2436.951764810.15
Scas_641.2453264800.19
YHR006W (STP2)54164800.19
CAGL0L00583g38839800.19
KLLA0D11902g28963790.20
CAGL0E03762g58444800.20
KLLA0F10109g62364800.24
Kwal_27.1182419962770.29
Scas_718.36d33062780.32
YDR463W (STP1)51964780.35
AFR461C54464780.41
YPR022C113351780.46
CAGL0K01727g49957770.50
Scas_660.1236764760.51
YGL254W (FZF1)29954760.54
Sklu_2289.129150750.61
Scas_604.458535760.69
Scas_713.1146578740.96
YHL027W (RIM101)62545750.98
CAGL0H07557g47652741.0
KLLA0A10373g20660721.1
CAGL0F03179g53388741.2
KLLA0E00726g51745731.3
CAGL0I02816g29124721.4
CAGL0K02343g116273731.5
KLLA0A00803g95288722.0
AFR190C43244712.4
Kwal_55.2063441950702.7
Scas_712.232752702.9
ADL042W28152693.6
CAGL0K06413g35977693.9
Kwal_26.930030424684.4
Kwal_33.1422755157694.5
Sklu_2244.327150684.7
Sklu_2063.625427675.9
ADL040W33050676.9
CAGL0K04697g51559668.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YDR096W
         (879 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YDR096W (GIS1) [946] chr4 (637133..639817) DNA damage-responsive...  1433   0.0  
Scas_681.19                                                           338   e-102
AGR117C [4428] [Homologous to ScYER169W (RPH1) - SH; ScYDR096W (...   330   e-100
YER169W (RPH1) [1597] chr5 (523364..525754) DNA damage-responsiv...   301   2e-89
Kwal_56.23453                                                         299   2e-88
KLLA0C17710g 1569331..1571796 similar to sp|P39956 Saccharomyces...   280   1e-81
CAGL0L11880g 1272624..1275566 some similarities with sp|P39956 S...   259   4e-73
Scas_76.1                                                             100   2e-23
CAGL0H00528g 52511..54733 similar to sp|P47156 Saccharomyces cer...    89   9e-18
ABR167C [760] [Homologous to ScYJR119C - SH] (714425..716755) [2...    88   2e-17
Kwal_55.21855                                                          86   4e-17
KLLA0D10758g 917125..919677 similar to sp|P47156 Saccharomyces c...    85   2e-16
Sklu_2303.6 YJR119C, Contig c2303 8969-11356                           84   3e-16
Scas_691.27                                                            81   2e-15
YJR119C (YJR119C) [3011] chr10 complement(644219..646405) Protei...    79   6e-15
CAGL0G08107g 768772..770649 weakly similar to tr|Q03833 Saccharo...    76   6e-14
Scas_649.28                                                            70   3e-12
Scas_709.32                                                            70   5e-12
Scas_602.9                                                             64   3e-10
CAGL0L06072g complement(679924..680826) some similarities with s...    62   4e-10
CAGL0E04884g complement(469295..473764) weakly similar to sp|P07...    64   4e-10
Sklu_2181.1 YER130C, Contig c2181 4015-5247                            63   4e-10
AGR172W [4483] [Homologous to ScYDR216W (ADR1) - SH] complement(...    64   6e-10
AGR031W [4341] [Homologous to ScYDR043C (NRG1) - SH; ScYBR066C (...    58   8e-10
Kwal_47.17241                                                          62   1e-09
KLLA0F13046g 1201353..1205492 some similarities with sp|P07248 S...    63   1e-09
YKL062W (MSN4) [3197] chr11 (322873..324765) Zinc-finger transcr...    62   2e-09
ACL057W [992] [Homologous to ScYER130C - SH] complement(264934.....    61   2e-09
KLLA0C17072g 1494101..1495525 weakly similar to sp|P39959 Saccha...    61   2e-09
Sklu_2357.7 YDR043C, Contig c2357 9816-10289 reverse complement        57   3e-09
CAGL0M13189g complement(1294293..1295918) weakly similar to sp|P...    61   3e-09
KLLA0F26961g 2486804..2488888 some similarities with sp|P33748 S...    61   3e-09
CAGL0K02145g 190055..191008 some similarities with sp|P39959 Sac...    60   3e-09
Scas_703.23                                                            60   5e-09
Scas_721.92                                                            60   8e-09
Kwal_26.8351                                                           59   1e-08
ABR089C [680] [Homologous to ScYKL062W (MSN4) - SH; ScYMR037C (M...    59   2e-08
YDR043C (NRG1) [896] chr4 complement(542670..543365) Transcripti...    56   2e-08
YJR127C (ZMS1) [3019] chr10 complement(658832..662974) Protein w...    59   2e-08
Sklu_2351.6 YGL035C, Contig c2351 12964-14610 reverse complement       58   2e-08
KLLA0B04477g 400019..404017 similar to sp|Q04545 Saccharomyces c...    58   3e-08
Kwal_27.10925                                                          56   3e-08
CAGL0K12078g complement(1168989..1170380) weakly similar to sp|Q...    57   3e-08
Kwal_47.16621                                                          58   3e-08
YML081W (YML081W) [3888] chr13 (104777..108532) Protein with sim...    58   4e-08
CAGL0M00594g 70659..73721 similar to sp|P46974 Saccharomyces cer...    57   5e-08
Scas_707.31                                                            56   5e-08
AER159C [2662] [Homologous to ScYML081W - SH; ScYJR127C (ZMS1) -...    57   5e-08
KLLA0F18524g complement(1701498..1702571) some similarities with...    56   6e-08
CAGL0A01628g 156635..157909 similar to sp|P27705 Saccharomyces c...    56   7e-08
YER130C (YER130C) [1560] chr5 complement(421111..422442) Protein...    56   9e-08
Sklu_2443.22 , Contig c2443 45390-46027                                54   1e-07
CAGL0F05995g complement(598819..600612) some similarities with s...    55   1e-07
YMR037C (MSN2) [4001] chr13 complement(344402..346516) Zinc-fing...    55   1e-07
CAGL0H04213g 398544..402509 similar to sp|Q04545 Saccharomyces c...    55   2e-07
Scas_718.44                                                            53   3e-07
YDR216W (ADR1) [1053] chr4 (895027..898998) Zinc-finger transcri...    54   5e-07
Kwal_14.2278                                                           53   6e-07
KLLA0E10989g 966805..968229 gi|1709030|sp|P50898|MIG1_KLULA Kluy...    53   7e-07
YGL035C (MIG1) [1940] chr7 complement(431551..433065) Zinc-finge...    53   7e-07
Scas_569.2                                                             52   8e-07
YOR113W (AZF1) [4916] chr15 (534075..536819) Glucose-dependent t...    53   8e-07
AFR471C [3663] [Homologous to ScYGL035C (MIG1) - SH; ScYGL209W (...    52   1e-06
Scas_717.17                                                            52   2e-06
CAGL0L07480g complement(822240..823184) some similarities with s...    51   2e-06
YBR066C (NRG2) [256] chr2 complement(369998..370660) Suppressor ...    50   2e-06
ACR264W [1311] [Homologous to ScYOR113W (AZF1) - SH] complement(...    52   2e-06
KLLA0B07909g 697885..700653 some similarities with sp|P53243 Sac...    52   3e-06
CAGL0K09372g complement(924818..926008) similar to sp|P53035 Sac...    51   3e-06
AFR580C [3772] [Homologous to ScYGR067C - SH] (1478059..1480575)...    51   3e-06
KLLA0F23782g 2219920..2222268 some similarities with sp|P41696 S...    51   4e-06
CAGL0K04631g complement(440721..443762) some similarities with s...    51   4e-06
Scas_697.35                                                            51   4e-06
Kwal_47.17888                                                          51   4e-06
Scas_575.3                                                             50   5e-06
YGR067C (YGR067C) [2029] chr7 complement(622404..624788) Protein...    51   5e-06
YPL038W (MET31) [5401] chr16 (480530..481063) Zinc-finger protei...    48   5e-06
Scas_712.42*                                                           49   7e-06
Scas_683.25                                                            49   1e-05
Scas_719.68                                                            49   2e-05
YGL209W (MIG2) [1787] chr7 (95860..97008) Zinc-finger protein in...    48   2e-05
AGL207W [4105] [Homologous to NOHBY] complement(310750..311583) ...    47   2e-05
KLLA0B00605g complement(46736..47455) some similarities with sp|...    47   3e-05
Scas_378.1                                                             46   4e-05
YMR070W (MOT3) [4029] chr13 (409153..410625) Transcription facto...    47   4e-05
Kwal_26.8021                                                           47   6e-05
Kwal_47.19045                                                          46   6e-05
KLLA0B03454g complement(314015..315433) some similarities with s...    47   7e-05
Scas_693.31                                                            47   9e-05
YPL230W (YPL230W) [5219] chr16 (115312..116487) Putative transcr...    46   9e-05
AGL071C [4240] [Homologous to ScYMR070W (MOT3) - SH] (574723..57...    46   1e-04
CAGL0L03916g complement(448955..450883) weakly similar to sp|P41...    45   2e-04
Scas_687.33                                                            44   3e-04
YDR253C (MET32) [1086] chr4 complement(963982..964557) Zinc-fing...    43   4e-04
CAGL0M06831g 695162..697099 weakly similar to sp|P53968 Saccharo...    44   5e-04
YDR146C (SWI5) [991] chr4 complement(748607..750736) Transcripti...    44   5e-04
KLLA0E08679g 777005..778795 some similarities with sp|P53968 Sac...    44   5e-04
CAGL0C02519g 253051..254007 weakly similar to sp|P39943 Saccharo...    43   6e-04
Kwal_56.24206                                                          44   9e-04
CAGL0M01870g complement(219813..220760) some similarities with t...    42   0.001
Kwal_27.11460                                                          42   0.001
YER028C (MIG3) [1453] chr5 complement(210691..211875) Protein th...    42   0.001
KLLA0E18645g complement(1648263..1649558) some similarities with...    42   0.001
YMR182C (RGM1) [4137] chr13 complement(624531..625166) Transcrip...    41   0.001
AGL197W [4115] [Homologous to ScYDR146C (SWI5) - SH; ScYLR131C (...    42   0.002
Kwal_14.2206                                                           41   0.002
ADL198W [1543] [Homologous to ScYNL027W (CRZ1) - SH] complement(...    42   0.002
KLLA0D16456g complement(1387846..1390410) weakly similar to sp|P...    42   0.002
KLLA0F11682g complement(1068992..1070116) some similarities with...    42   0.002
Scas_568.5                                                             41   0.002
Kwal_23.5400                                                           42   0.002
Kwal_56.23925                                                          42   0.002
Scas_720.33                                                            41   0.002
CAGL0J05060g 478650..480791 similar to sp|P47043 Saccharomyces c...    42   0.003
YJL056C (ZAP1) [2855] chr10 complement(330347..332989) Zinc-resp...    42   0.003
AEL174W [2332] [Homologous to ScYJL056C (ZAP1) - SH] complement(...    41   0.003
CAGL0E06116g complement(604708..606549) some similarities with t...    41   0.004
Sklu_2389.2 YJL056C, Contig c2389 3525-5828                            41   0.004
CAGL0K03003g 276756..278699 weakly similar to sp|P54785 Saccharo...    41   0.004
Scas_636.14d                                                           40   0.005
Scas_717.60d                                                           39   0.005
KLLA0F20636g complement(1914452..1915309) some similarities with...    40   0.006
CAGL0E01331g 124362..126431 weakly similar to sp|P08153 Saccharo...    40   0.007
Scas_711.56                                                            40   0.007
Scas_627.17d                                                           39   0.010
CAGL0B02651g complement(253495..254064) weakly similar to sp|Q12...    39   0.010
Scas_631.7                                                             39   0.011
YNL027W (CRZ1) [4559] chr14 (579578..581614) Calcineurin-depende...    40   0.012
AGL246W [4066] [Homologous to ScYDR253C (MET32) - SH; ScYPL038W ...    39   0.012
CAGL0G10021g complement(959154..960338) similar to sp|P39933 Sac...    39   0.013
KLLA0A04609g complement(411494..412765) some similarities with s...    39   0.014
KLLA0F01463g 140343..142688 some similarities with sp|P47043 Sac...    39   0.015
KLLA0C16005g 1397274..1398269 some similarities with sgd|S000615...    39   0.015
Kwal_14.2543                                                           39   0.020
AEL278W [2227] [Homologous to ScYPR186C (PZF1) - SH] complement(...    39   0.020
CAGL0M04323g complement(474158..476269) similar to sp|P21192 Sac...    39   0.022
YLR131C (ACE2) [3541] chr12 complement(404511..406823) Metalloth...    39   0.022
CAGL0L12562g complement(1350878..1351549) similar to sp|Q12041 S...    37   0.027
Scas_695.2                                                             38   0.028
AFL136W [3059] [Homologous to ScYPL230W - SH; ScYMR182C (RGM1) -...    38   0.029
YPR186C (PZF1) [5600] chr16 complement(909727..911016) RNA polym...    38   0.032
Sklu_2126.5 YHL027W, Contig c2126 7763-9109                            37   0.045
CAGL0I02838g complement(248704..250671) similar to sp|P41696 Sac...    37   0.050
Kwal_47.16577                                                          38   0.052
Scas_718.67                                                            37   0.060
CAGL0E04312g 412563..414629 some similarities with sp|Q00947 Sac...    37   0.062
AFL127C [3068] [Homologous to ScYMR176W (ECM5) - SH] (193474..19...    37   0.067
Scas_627.6                                                             37   0.068
Sklu_1527.1 YPL038W, Contig c1527 389-1006                             36   0.071
Kwal_47.18337                                                          37   0.077
YDL020C (RPN4) [840] chr4 complement(415110..416705) Subunit of ...    37   0.089
Kwal_27.10467                                                          36   0.11 
Scas_721.56                                                            35   0.11 
Sklu_2436.9 YDR463W, Contig c2436 18516-20069                          36   0.15 
Scas_641.24                                                            35   0.19 
YHR006W (STP2) [2292] chr8 (117808..119433) Transcription factor...    35   0.19 
CAGL0L00583g 69547..70713 similar to tr|Q12132 Saccharomyces cer...    35   0.19 
KLLA0D11902g 1015273..1016142 some similarities with sp|Q12041 S...    35   0.20 
CAGL0E03762g complement(351003..352757) weakly similar to sp|P33...    35   0.20 
KLLA0F10109g complement(939195..941066) weakly similar to sp|Q00...    35   0.24 
Kwal_27.11824                                                          34   0.29 
Scas_718.36d                                                           35   0.32 
YDR463W (STP1) [1281] chr4 (1386804..1388363) Transcription fact...    35   0.35 
AFR461C [3653] [Homologous to ScYDR463W (STP1) - SH] (1269565..1...    35   0.41 
YPR022C (YPR022C) [5456] chr16 complement(603906..607307) Predic...    35   0.46 
CAGL0K01727g complement(152569..154068) similar to sp|Q03465 Sac...    34   0.50 
Scas_660.12                                                            34   0.51 
YGL254W (FZF1) [1746] chr7 (22304..23203) Transcription factor i...    34   0.54 
Sklu_2289.1 YGL254W, Contig c2289 150-1025 reverse complement          33   0.61 
Scas_604.4                                                             34   0.69 
Scas_713.11                                                            33   0.96 
YHL027W (RIM101) [2259] chr8 (51109..52986) Transcription factor...    33   0.98 
CAGL0H07557g 738086..739516 some similarities with sp|P32805 Sac...    33   1.0  
KLLA0A10373g complement(907244..907864) some similarities with c...    32   1.1  
CAGL0F03179g 311261..312862 similar to sp|Q04080 Saccharomyces c...    33   1.2  
KLLA0E00726g 80516..82069 gi|5531271|emb|CAB50896.1 Kluyveromyce...    33   1.3  
CAGL0I02816g complement(247817..248692) similar to sp|P41696 Sac...    32   1.4  
CAGL0K02343g 208645..212133 similar to tr|Q12139 Saccharomyces c...    33   1.5  
KLLA0A00803g 76350..79208 weakly similar to sp|P53067 Saccharomy...    32   2.0  
AFR190C [3382] [Homologous to ScYHL027W (RIM101) - SH] (783110.....    32   2.4  
Kwal_55.20634                                                          32   2.7  
Scas_712.2                                                             32   2.9  
ADL042W [1699] [Homologous to ScYPR015C - SH] complement(615818....    31   3.6  
CAGL0K06413g 627811..628890 some similarities with sp|Q00947 Sac...    31   3.9  
Kwal_26.9300                                                           31   4.4  
Kwal_33.14227                                                          31   4.5  
Sklu_2244.3 , Contig c2244 4100-4915 reverse complement                31   4.7  
Sklu_2063.6 YLR201C, Contig c2063 5410-6174                            30   5.9  
ADL040W [1701] [Homologous to ScYPR013C - SH] complement(618855....    30   6.9  
CAGL0K04697g 458366..459913 some similarities with tr|Q07351 Sac...    30   8.5  

>YDR096W (GIS1) [946] chr4 (637133..639817) DNA damage-responsive
           repressor of PHR1, has two tandem C2H2-type zinc finger
           domains [2685 bp, 894 aa]
          Length = 894

 Score = 1433 bits (3709), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 724/879 (82%), Positives = 724/879 (82%)

Query: 1   MEIKPVEVIDGVPVFKPSMMEFANFQYFIDEITKFGIENGIVKVIPPKEWLELLEGSPPA 60
           MEIKPVEVIDGVPVFKPSMMEFANFQYFIDEITKFGIENGIVKVIPPKEWLELLEGSPPA
Sbjct: 1   MEIKPVEVIDGVPVFKPSMMEFANFQYFIDEITKFGIENGIVKVIPPKEWLELLEGSPPA 60

Query: 61  ESLKTIQLDSPIQQQAKRWDKHENGVFSIENEYDNKSYNLTQWKNLAESLDSRISQGDFN 120
           ESLKTIQLDSPIQQQAKRWDKHENGVFSIENEYDNKSYNLTQWKNLAESLDSRISQGDFN
Sbjct: 61  ESLKTIQLDSPIQQQAKRWDKHENGVFSIENEYDNKSYNLTQWKNLAESLDSRISQGDFN 120

Query: 121 DKTLKENCRVDSQQDCYDLAQLQILESDFWKTIAFSKPFYAVDENSSIFPYDLTLWNLNN 180
           DKTLKENCRVDSQQDCYDLAQLQILESDFWKTIAFSKPFYAVDENSSIFPYDLTLWNLNN
Sbjct: 121 DKTLKENCRVDSQQDCYDLAQLQILESDFWKTIAFSKPFYAVDENSSIFPYDLTLWNLNN 180

Query: 181 LPDSINSSNRRLLTGQSKCIFPWHLDEQNKCSINYLHFGAPKQWYSIPSANTDQFLKILS 240
           LPDSINSSNRRLLTGQSKCIFPWHLDEQNKCSINYLHFGAPKQWYSIPSANTDQFLKILS
Sbjct: 181 LPDSINSSNRRLLTGQSKCIFPWHLDEQNKCSINYLHFGAPKQWYSIPSANTDQFLKILS 240

Query: 241 KEPSSNKENCPAFIRHQNIITSPDFLRKNNIKFNRVVQFQHEFIITFPYCMYSGFNYGYN 300
           KEPSSNKENCPAFIRHQNIITSPDFLRKNNIKFNRVVQFQHEFIITFPYCMYSGFNYGYN
Sbjct: 241 KEPSSNKENCPAFIRHQNIITSPDFLRKNNIKFNRVVQFQHEFIITFPYCMYSGFNYGYN 300

Query: 301 FGESIEFILDQQAVVRKQPLKCGCGNKKEERKSGPFSNLSYDSNESEQRGSITDNDNDLF 360
           FGESIEFILDQQAVVRKQPLKCGCGNKKEERKSGPFSNLSYDSNESEQRGSITDNDNDLF
Sbjct: 301 FGESIEFILDQQAVVRKQPLKCGCGNKKEERKSGPFSNLSYDSNESEQRGSITDNDNDLF 360

Query: 361 QKVRSFDELLNHSSQELQNLEDNKNPLFSNINMNRPQSSSLRSTTPNGVNQFLNMNQTTI 420
           QKVRSFDELLNHSSQELQNLEDNKNPLFSNINMNRPQSSSLRSTTPNGVNQFLNMNQTTI
Sbjct: 361 QKVRSFDELLNHSSQELQNLEDNKNPLFSNINMNRPQSSSLRSTTPNGVNQFLNMNQTTI 420

Query: 421 SRISSPLLSRMMDLSNIVEPTLDDPGSKFKRKVLTPQLPQMNIPSNSSNFGTPSLTNTNS 480
           SRISSPLLSRMMDLSNIVEPTLDDPGSKFKRKVLTPQLPQMNIPSNSSNFGTPSLTNTNS
Sbjct: 421 SRISSPLLSRMMDLSNIVEPTLDDPGSKFKRKVLTPQLPQMNIPSNSSNFGTPSLTNTNS 480

Query: 481 LLXXXXXXXXXXXXXXXXXXXHNNVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 540
           LL                   HNNV                                   
Sbjct: 481 LLSNITATSTNPSTTTNGSQNHNNVNANGINTSAAASINNNISSTNNSANNSSSNNNVST 540

Query: 541 XXXXMMHXXXXXXXXXXXXXXXXXMXXXXXXXXXXXXXXXXXXXXXXXXXXMNPNGHTXX 600
               MMH                 M                          MNPNGHT  
Sbjct: 541 VPSSMMHSSTLNGTSGLGGDNDDNMLALSLATLANSATASPRLTLPPLSSPMNPNGHTSY 600

Query: 601 XXXXXXXXXXXXXXXXXXXXXXVXXXXXXXXSAPHNLSIVSPNPTYSPNPLSLYLTNSKN 660
                                 V        SAPHNLSIVSPNPTYSPNPLSLYLTNSKN
Sbjct: 601 NGNMMNNNSGNGSNGSNSYSNGVTTAAATTTSAPHNLSIVSPNPTYSPNPLSLYLTNSKN 660

Query: 661 PLNSGLAPLSPSTSNIPFLKRNNVVTLNISREASKSPISSFVNDYRSPLGVSNPLMYSST 720
           PLNSGLAPLSPSTSNIPFLKRNNVVTLNISREASKSPISSFVNDYRSPLGVSNPLMYSST
Sbjct: 661 PLNSGLAPLSPSTSNIPFLKRNNVVTLNISREASKSPISSFVNDYRSPLGVSNPLMYSST 720

Query: 721 INDYSNGTGIRQNSNNINPLDAGPSFSPLHKKPKIXXXXXXXXXXXXXFDYSFTGNKQES 780
           INDYSNGTGIRQNSNNINPLDAGPSFSPLHKKPKI             FDYSFTGNKQES
Sbjct: 721 INDYSNGTGIRQNSNNINPLDAGPSFSPLHKKPKILNGNDNSNLDSNNFDYSFTGNKQES 780

Query: 781 NPSILXXXXXXXXXYRTSSMNNNGNNYQAHSSKFGENEVIMSDHGKIYICRECNRQFSSG 840
           NPSIL         YRTSSMNNNGNNYQAHSSKFGENEVIMSDHGKIYICRECNRQFSSG
Sbjct: 781 NPSILNNNTNNNDNYRTSSMNNNGNNYQAHSSKFGENEVIMSDHGKIYICRECNRQFSSG 840

Query: 841 HHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHLNKK 879
           HHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHLNKK
Sbjct: 841 HHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHLNKK 879

>Scas_681.19
          Length = 864

 Score =  338 bits (866), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 199/514 (38%), Positives = 292/514 (56%), Gaps = 69/514 (13%)

Query: 2   EIKPVEVIDGVPVFKPSMMEFANFQYFIDEITKFGIENGIVKVIPPKEWLELLEGSPPAE 61
           +IKP  + DG+P+FKP+  EF +F  F++ I KFG+++GIVKVIPP EWL+LL+  P  E
Sbjct: 6   DIKPALIEDGIPIFKPTFQEFKDFYKFMEAINKFGMQSGIVKVIPPTEWLKLLDNPPSVE 65

Query: 62  SLKTIQLDSPIQQQAKRWDKHENGVFSIENEYDNKSYNLTQWKNLAE------------- 108
           +L+ I++ +PI+Q+        +G+F   N   +K+Y++ QWK L++             
Sbjct: 66  ALQGIKIKNPIEQEIS----GTHGLFMSNNIERSKTYHIIQWKELSKDYTLPQDPHSRDK 121

Query: 109 -------------------SLDSRISQGDFNDKTLKENCRVDSQQDCY-----DLAQLQI 144
                              S   R  Q  F+ +  K   +  ++ D       D  +L  
Sbjct: 122 NKDPDTNNGKTIEMPSSTSSATHRKRQHSFSKEDFKNFQKNFNESDEILKQFNDKERLNF 181

Query: 145 LESDFWKTIAFSKPFYAVDENSSIFPYDLTLWNLNNLPDSINSSNRR--------LLTGQ 196
           LE+ +WKT+ F+ P Y  D + SIF  +L +WN++ LP+ ++  ++         L  G 
Sbjct: 182 LENYYWKTLNFTMPMYGADTSGSIFNENLNVWNVSKLPNLLDYLDKEIPGVNDSFLYAGL 241

Query: 197 SKCIFPWHLDEQNKCSINYLHFGAPKQWYSIPSANTDQFLKILSKEPSSNKENCPAFIRH 256
            K  FPWHL++Q+  SIN++HFGAPKQWYSIP  +   F   + ++     + CP F+RH
Sbjct: 242 WKASFPWHLEDQDLYSINFIHFGAPKQWYSIPQEDHQLFYNFMREQFPEEAKKCPEFLRH 301

Query: 257 QNIITSPDFLRKNNIKFNRVVQFQHEFIITFPYCMYSGFNYGYNFGESIEFILDQQAVVR 316
           +  + SP  L +N I+ N++V +Q+EF+ITFPY  ++GFNYGYN  ES+ F L++   + 
Sbjct: 302 KTFMASPKLLSENGIRCNKIVHYQNEFMITFPYGYHAGFNYGYNLAESVNFALEEWLEIG 361

Query: 317 KQPLKCGCGNKKEE---RKSGPFSNLSYDSNESEQRGSITDNDNDLFQKVRSFDELLNHS 373
           ++  KC C N   E   RK    SN     N+   +     N+ DL  +VRSF ELLNHS
Sbjct: 362 ERANKCLCVNDSVEIDVRKLA--SNWYIFKNKPNLK-----NETDL--RVRSFTELLNHS 412

Query: 374 SQELQNLEDNK--NPLFSNINMNRPQSSSLRSTTPNGVNQFLNMNQT---TISRISSPLL 428
           SQELQN++  +   P+ +    N+    SLRST+P   +QF   N+T    ISR+SSP L
Sbjct: 413 SQELQNIQKKQQVQPIRTFTESNK--DVSLRSTSPTP-SQFFTTNETNKPVISRVSSPFL 469

Query: 429 SRMMDLSNIVEPTLDDPGSKFKRKVLTPQLPQMN 462
           SRMMDLSNIVEPTL+DP  KFKRK+  P + Q N
Sbjct: 470 SRMMDLSNIVEPTLEDPTLKFKRKLNAPSVSQNN 503

 Score =  155 bits (391), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 110/267 (41%), Positives = 146/267 (54%), Gaps = 44/267 (16%)

Query: 638 SIVSPNPTYSPNPLSLYLT-NSKNPLN-------------SGLAPLSPS-TSNIPFLKR- 681
           SI++P P+ S +P   Y+T N+ NP+              + + PLSP   SN+ F+KR 
Sbjct: 569 SILAPKPSLSSSP---YVTSNNNNPMTYNSTFSNHNNNIQNNVVPLSPGGRSNLSFIKRI 625

Query: 682 --NNVVTLNISREASKSPISSFVNDYRSPLGVSNPLMYSSTINDYSNGTGIR-------Q 732
              N+VTLNISRE S+SPI + V D+RS    +  L YS+      N   +         
Sbjct: 626 KSPNIVTLNISRETSRSPILTSVPDFRSNNNNTGTLPYSAIPQSSLNQMELNNPLGNDDT 685

Query: 733 NSNNINPLDAGPSFSPLHKKPKIXXXXXXXXXXXXXFDYSFTGNKQESNPSILXXXXXXX 792
           N+N +   +      P  KK ++                   G +Q S   +L       
Sbjct: 686 NNNTVTNSELSILNQPPQKKQRLTNGTRSNQRKME------LGVEQPSGDGVLIG----- 734

Query: 793 XXYRTSSMNNNGNNYQAHSSKFGENEVIMSDHGKIYICRECNRQFSSGHHLTRHKKSVHS 852
                +S +NN NN  A + KF  +E+IMS+ GK+Y+C EC RQF+SGHHLTRHKKSVHS
Sbjct: 735 -----NSSSNNNNNTNAQAPKFTSDEIIMSETGKVYVCLECKRQFTSGHHLTRHKKSVHS 789

Query: 853 GEKPHSCPRCGKRFKRRDHVLQHLNKK 879
           GEKPHSCP+CGK+FKRRDHVLQHLNKK
Sbjct: 790 GEKPHSCPKCGKKFKRRDHVLQHLNKK 816

>AGR117C [4428] [Homologous to ScYER169W (RPH1) - SH; ScYDR096W
           (GIS1) - SH] (964417..966816) [2400 bp, 799 aa]
          Length = 799

 Score =  330 bits (846), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 197/530 (37%), Positives = 280/530 (52%), Gaps = 78/530 (14%)

Query: 1   MEIKPVEVIDGVPVFKPSMMEFANFQYFIDEITKFGIENGIVKVIPPKEWLELLEGSPPA 60
           M   P     GVPVF+PS  EF +F  ++  I ++G+++G+VK+IPP+EW+E L   P  
Sbjct: 1   MSGNPDHFEGGVPVFRPSWEEFQDFYKYMFLIDEYGMKSGVVKIIPPREWVERLGERPGV 60

Query: 61  ESLKTIQLDSPIQQQAKRWDKHENGVFSIENEYDNKSYNLTQWKNLAE------------ 108
           E L+ I + SPIQQ          GVF ++N    KSYN+ QWK+LA+            
Sbjct: 61  EQLRRIHIRSPIQQHVS----GSKGVFVVQNVERQKSYNIIQWKDLAQDYQLPDMRGYGG 116

Query: 109 SLDSRISQG---------------DFND---KTLKENCRVDSQQDCYDLAQLQILESDFW 150
           SL    + G                F+D   +  +E+  V+      D + L+ LE+ +W
Sbjct: 117 SLSRSAAAGGARPRPSNIRTRTQDSFSDEDFREFQEHYNVEGLAQYDDESFLRGLENYYW 176

Query: 151 KTIAFSKPFYAVDENSSIFPYDLTLWNLNNLPDSINSSNRR--------LLTGQSKCIFP 202
           KT+ F++P Y  D   ++FP  L  WN++ LP+ ++    +        L  G  K  F 
Sbjct: 177 KTLNFTEPMYGADTLGTLFPDSLHQWNVSRLPNLLDHLEEKVPGVNQSYLYAGLWKASFA 236

Query: 203 WHLDEQNKCSINYLHFGAPKQWYSIPSANTDQFLKILSKEPSSNKENCPAFIRHQNIITS 262
           WHL++Q+  SINYLHFGAPKQWYSIP  ++ +F K + ++       C  F+RH+  + S
Sbjct: 237 WHLEDQDLYSINYLHFGAPKQWYSIPQEDSHKFFKFMQEQFPEESAQCREFLRHKMFMVS 296

Query: 263 PDFLRKNNIKFNRVVQFQHEFIITFPYCMYSGFNYGYNFGESIEFILDQQAVVRKQPLKC 322
           P  L +N I+ N +V  QHEF++T+PY  +SGFNYGYN  ES+ F L+    + ++  KC
Sbjct: 297 PKVLERNGIRCNSIVHRQHEFMVTYPYGYHSGFNYGYNLAESVNFALESWLPIGEKAKKC 356

Query: 323 GC-----GNKKEERKSGPFSNLSYDSNESEQ----RGSITDNDN----------DLFQKV 363
            C     G   ++ KS  F +L  D   S      R  +    N          D    +
Sbjct: 357 MCVDDSVGIDIQKLKSAYFRSLQEDRAGSADPEPPRKRLKQEPNTSSFVQAPILDTGDSL 416

Query: 364 RSFDELLNHSSQELQNLEDNKNPLFSNINMNRPQSSSLRSTTPNGVNQFLNMNQTTISRI 423
           +SF+EL+NHS+ ELQ +EDN            P   S+RSTTP   NQ+   +  +ISR+
Sbjct: 417 KSFNELINHSAYELQAMEDN------------PNQRSIRSTTP---NQYF--SNPSISRM 459

Query: 424 SSPLLSRMMDLSNIVEPTLDDPGSKFKRKVLTPQLPQMNIPSNSSNFGTP 473
           SSPLLSRMMDLSNIVEPTL+DP  KFKRKV+         P+  S  G P
Sbjct: 460 SSPLLSRMMDLSNIVEPTLEDPTLKFKRKVVAQDTSNAMAPNPVSGVGAP 509

 Score =  153 bits (387), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 102/252 (40%), Positives = 133/252 (52%), Gaps = 37/252 (14%)

Query: 634 PHNLSIVSPNPTYSPNPLSLYLTNSKNPLNSGLAPLSPSTSNIPFLKR---NNVVTLNIS 690
           P   +I++P P+Y  NPLS Y T +             + S +P  KR    N VTLNIS
Sbjct: 563 PTGDAILAPRPSYDQNPLSYYSTQT-------------TKSPMPLFKRINSPNRVTLNIS 609

Query: 691 REASKSPISSFVNDY-RSPLGVSNPLMYSSTINDYSNGTGIRQNSNNINPLDAGPSFSPL 749
           RE+S+SPIS F ++Y + PL   +PL          N   +  N  ++N +       P 
Sbjct: 610 RESSRSPIS-FGSEYGKPPLSKPHPL----------NAGAV--NLTSLNQVSTIERNIPS 656

Query: 750 HKKPKIXXXXXXXXXXXXXFDYSFTGNKQESNPSILXXXXXXXXXYRTSSMNNNGNNYQA 809
           H+                     F G++   + ++L            S +   G   +A
Sbjct: 657 HRDRSAKAYHGDKVNIHGVSSGKFVGHQINDSLALLNDDALT-----NSVLPGAGRPERA 711

Query: 810 HS--SKFGENEVIMSDHGKIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFK 867
            S  SK    E+I+SD GK Y+C+EC RQFSSGHHLTRHKKSVHSGEKPHSCP+CGK+FK
Sbjct: 712 TSPTSKISAEEIIISDKGKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFK 771

Query: 868 RRDHVLQHLNKK 879
           RRDHVLQHLNKK
Sbjct: 772 RRDHVLQHLNKK 783

>YER169W (RPH1) [1597] chr5 (523364..525754) DNA damage-responsive
           repressor of PHR1, contains two C2H2-type zinc finger
           domains [2391 bp, 796 aa]
          Length = 796

 Score =  301 bits (770), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 176/482 (36%), Positives = 255/482 (52%), Gaps = 63/482 (13%)

Query: 3   IKPVEVIDGVPVFKPSMMEFANFQYFIDEITKFGIENGIVKVIPPKEWLELLEGSPPAES 62
           I P E++ GVPVFKP+  +F +F  +   I K+G+++G+VKVIPPKEW + L+    AE+
Sbjct: 5   IAPSEIVGGVPVFKPTYEQFEDFYAYCKAINKYGMKSGVVKVIPPKEWKDKLDLPYSAET 64

Query: 63  LKTIQLDSPIQQQAKRWDKHENGVFSIENEYDNKSYNLTQWKNLAESL-------DSRIS 115
           L+ I++ SPIQQ          G+F ++N   NK+YN+ QWK+L++           R S
Sbjct: 65  LQKIKIKSPIQQHI----SGNKGLFMVQNVEKNKTYNIIQWKDLSKDYVPPEDPKARRNS 120

Query: 116 QGDFNDKTLK---------------ENCRVDSQQDCYDL---AQLQILESDFWKTIAFSK 157
           +     K+ K               E  R +   D  D     +L+ LE  +WKT+ F+ 
Sbjct: 121 RKGSVSKSTKLKLKNFESSFNIDDFEQFRTEYTIDLSDFQNTERLKFLEEYYWKTLNFTT 180

Query: 158 PFYAVDENSSIFPYDLTLWNLNNLPDSINSSNRR--------LLTGQSKCIFPWHLDEQN 209
           P Y  D   SIFP  L +WN+  LP+ ++    +        L  G  K  F WHL++Q+
Sbjct: 181 PMYGADTPGSIFPEGLNVWNVAKLPNILDHMETKVPGVNDSYLYAGLWKASFSWHLEDQD 240

Query: 210 KCSINYLHFGAPKQWYSIPSANTDQFLKILSKEPSSNKENCPAFIRHQNIITSPDFLRKN 269
             SINY+HFGAPKQWYSIP  +  +F K + ++     +NCP F+RH+  + SP  L++N
Sbjct: 241 LYSINYIHFGAPKQWYSIPQEDRFKFYKFMQEQFPEEAKNCPEFLRHKMFLASPKLLQEN 300

Query: 270 NIKFNRVVQFQHEFIITFPYCMYSGFNYGYNFGESIEFILDQQAVVRKQPLKCGCGNKKE 329
            I+ N +V  + EF+IT+PY  ++GFNYGYN  ES+ F L++   + K+  KC C +   
Sbjct: 301 GIRCNEIVHHEGEFMITYPYGYHAGFNYGYNLAESVNFALEEWLPIGKKAGKCHCISDSV 360

Query: 330 ERKSGPFSNLSYDSNESEQRGSITDNDNDLFQKVRSFDELLNHSSQELQNLEDNKNPLFS 389
           E      +  S+  N  E +G                       +  L  L +   PL  
Sbjct: 361 EIDVKKLAK-SWRDNNKESKG-----------------------TPPLNQLPNPAMPLLH 396

Query: 390 NINMNRPQSSSLRSTTPNGVNQFLNMNQTTISRISSPLLSRMMDLSNIVEPTLDDPGSKF 449
              +   +SSSLRST+P+ V  F N    + S +SSPLLSRM D SNIVEPTL+DP  K 
Sbjct: 397 RPTLKEMESSSLRSTSPD-VGHFSNFKSKS-SGVSSPLLSRMKDYSNIVEPTLEDPTLKL 454

Query: 450 KR 451
           KR
Sbjct: 455 KR 456

 Score =  145 bits (367), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 101/250 (40%), Positives = 133/250 (53%), Gaps = 25/250 (10%)

Query: 637 LSIVSPNPTYSPNPLSLYLTNSKNPLNSGLAPLSPSTSNIPFLKR---NNVVTLNISREA 693
           L+   PN     NPL LY++N      S  AP SP   NI  +KR    N+VTLNISRE+
Sbjct: 529 LAFPRPNGPSGLNPL-LYISNKNISGISHSAPHSPVNPNISLIKRVKSPNIVTLNISRES 587

Query: 694 SKSPISSFVNDYRSPLGVSNPLMYSSTINDYSNGTGIRQNSNNINPLDAGPSFSPLHKKP 753
           S+SPI+    + R      +     ST+++ S  T +    ++ N +       P HK  
Sbjct: 588 SRSPIA-LNYEARQQHSQQHSFSTPSTVSNLS--TSVLGPLSDTNDIKTPHPERPNHKTA 644

Query: 754 -KIXXXXXXXXXXXXXFDYSFTGNKQESNPSILXXXXXXXXXYRTSSMNNNGNNYQAHS- 811
            +I                S   + ++ +                +S N++ +  Q  S 
Sbjct: 645 NRILKKESPVETSKSNLILSKVASTRQED--------------SFTSRNDDLDKEQGSSP 690

Query: 812 --SKFGENEVIMSDHGKIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRR 869
             SKF   E+++S   KIYIC+EC R+FSSGHHLTRHKKSVHSGEKPHSCP+CGKRFKRR
Sbjct: 691 LNSKFAPEEIVLSGKNKIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRR 750

Query: 870 DHVLQHLNKK 879
           DHVLQHLNKK
Sbjct: 751 DHVLQHLNKK 760

>Kwal_56.23453
          Length = 828

 Score =  299 bits (766), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 191/548 (34%), Positives = 283/548 (51%), Gaps = 106/548 (19%)

Query: 2   EIKPVEVIDGVPVFKPSMMEFANFQYFIDEITKFGIENGIVKVIPPKEWLELLEGSPPAE 61
           E+ P     GVPVF+P+   F +F  ++  + K+G ++GIVKVIPP+EWL+ LE  P  E
Sbjct: 3   EVAPSSWEGGVPVFRPNYERFKDFYEYMRAVDKYGKKSGIVKVIPPQEWLDQLEMPPGVE 62

Query: 62  SLKTIQLDSPIQQQAKRWDKHENGVFSIENEYDNKSYNLTQWKNLAESLDSRI------- 114
           +L+ I++ +PIQQ          GVF ++N   +KSYN+ QWK++  S D R+       
Sbjct: 63  TLQKIRIRTPIQQHFN----GSKGVFVVQNVEKSKSYNIIQWKDI--SYDYRLPDGGGEA 116

Query: 115 ---SQGDFND-----------KTLKENCRV------------------DSQQDCYDLAQL 142
              S+ D  D           K+ K   R                   D+  D  D ++ 
Sbjct: 117 SGSSEADAGDTLGARKSPSPLKSSKIKLRSPESFSDAEFEKFSAHYNHDNLGDFRDPSRR 176

Query: 143 QILESDFWKTIAFSKPFYAVDENSSIFPYDLTLWNLNNLPDSINSSNRR--------LLT 194
           + LES FWKT+AF+ P Y  D   S+F   L +WN++ LP+ ++  N +        L  
Sbjct: 177 EFLESYFWKTLAFTPPMYGADSLGSLFQDKLDVWNVSKLPNILDHMNTKVPGVNGSYLYA 236

Query: 195 GQSKCIFPWHLDEQNKCSINYLHFGAPKQWYSIPSANTDQFLKILSKEPSSNKENCPAFI 254
           G  K  F WHL++Q+  SINY+HFGAPKQWYSIP  ++D+F K + ++   +   C  F+
Sbjct: 237 GLWKASFSWHLEDQDLYSINYIHFGAPKQWYSIPQEDSDKFYKFMQEQFPEHAAKCDEFL 296

Query: 255 RHQNIITSPDFLRKNNIKFNRVVQFQHEFIITFPYCMYSGFNYGYNFGESIEFILDQQAV 314
           RH+  + SP  L KN I+ N++V +Q EFIIT+PY  ++GFNYGYN  ES+ F L+    
Sbjct: 297 RHKTFLVSPKILEKNGIRCNKIVHYQQEFIITYPYGYHAGFNYGYNLAESVNFALENWLD 356

Query: 315 VRKQPLKCGC-----GNKKEERKSGPFSN--------LSYDSNESEQRGSITDNDNDLFQ 361
           +  +  +C C     G   E+ +    S+        + ++  ES QRGS   +    F+
Sbjct: 357 IGIKAKRCLCIDDAVGIDVEKLRDDWLSSKQKAEKPKVKHEIQES-QRGSNGVSKKAKFE 415

Query: 362 KVRSFDELLNHSSQ--ELQN-----------------------LEDNKNPLFSNIN---- 392
           K  +  +  +  S+  +++N                       L + +NP     N    
Sbjct: 416 KDSASTKQPSEGSKNADVKNDKSDKSNIEVVCPTPGRSLPFNRLTNKENPRMKGFNELLH 475

Query: 393 ---------MNRPQSSSLRSTTPNGVNQFLNMNQTTISRISSPLLSRMMDLSNIVEPTLD 443
                     + PQ S++RSTTPN    +  ++Q +ISRISSPLLSRMMDLSNIVEPTL+
Sbjct: 476 HSSYELQAMEDNPQQSAIRSTTPNPGQYYSGLSQ-SISRISSPLLSRMMDLSNIVEPTLE 534

Query: 444 DPGSKFKR 451
           DP  KFK+
Sbjct: 535 DPTLKFKK 542

 Score =  132 bits (332), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 55/68 (80%), Positives = 62/68 (91%)

Query: 812 SKFGENEVIMSDHGKIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDH 871
           SK    E+I+SD GK+Y+C+EC RQFSSGHHLTRHKKSVHSGEKPHSCP+CGK+FKRRDH
Sbjct: 719 SKINSEEIIVSDKGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDH 778

Query: 872 VLQHLNKK 879
           VLQHLNKK
Sbjct: 779 VLQHLNKK 786

 Score = 57.0 bits (136), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 50/75 (66%), Gaps = 5/75 (6%)

Query: 638 SIVSPNPTYSPNPLSLYLTNSKNPLNSGLAPLSPSTSNIPFLKR---NNVVTLNISREAS 694
           S+++  P Y  NP S Y TN K+ + S   P SP+ SN+PF+KR    N VTLNISRE+S
Sbjct: 599 SMLASGPLYEQNPFSYYSTNFKSTMGSP-QPSSPALSNLPFIKRLKSPNRVTLNISRESS 657

Query: 695 KSPISSFVNDYRSPL 709
           +SPI    ++++SPL
Sbjct: 658 RSPI-LLNSEFKSPL 671

>KLLA0C17710g 1569331..1571796 similar to sp|P39956 Saccharomyces
           cerevisiae YER169w RPH1, start by similarity
          Length = 821

 Score =  280 bits (717), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 177/528 (33%), Positives = 272/528 (51%), Gaps = 86/528 (16%)

Query: 1   MEIKPVEVIDGVPVFKPSMMEFANFQYFIDEITKFGIENGIVKVIPPKEWLELLEGSPPA 60
           M  +P      VPVFKP    F +F  F+ E+ K+G+++GI+K++PP++W++ +   P A
Sbjct: 1   MSYEPDHYEGSVPVFKPDYETFRDFYKFMCEVNKYGMKSGIIKIVPPEQWVDKVAFPPSA 60

Query: 61  ESLKTIQLDSPIQQQAKRWDKHENGVFSIENEYDNKSYNLTQWKNLAESLDSRISQGDFN 120
           E+L+ I++ +PIQQ          GVF ++N    KSYN+ QWK+L  S D ++ +G  +
Sbjct: 61  ETLQKIKIKTPIQQHISG----SKGVFVVQNVEKPKSYNVIQWKHL--SHDYKLPEGRHS 114

Query: 121 DK------------------------------TLKENCRVDSQQDCYDLAQLQILESDFW 150
            K                                +EN   D  +   D  +++ LES +W
Sbjct: 115 AKNEDSSGIEPHQQSNKVRSKCLDSFTLDDFEKFRENFNCDHLEQFDDEQRVEFLESYYW 174

Query: 151 KTIAFSKPFYAVDENSSIFPYDLTLWNLNNLPDSINSSNRR--------LLTGQSKCIFP 202
           KT+ F++P Y  D   S+F   +  WN+++LP  +   + +        L  G  K  F 
Sbjct: 175 KTLNFTEPMYGADSLGSLFEDSVKEWNISSLPSILEYLDEKVPGVNESYLYAGLWKASFA 234

Query: 203 WHLDEQNKCSINYLHFGAPKQWYSIPSANTDQFLKILSKEPSSNKENCPAFIRHQNIITS 262
           WHL++Q+  SINY+HFGAPKQWYSIP  ++++F   + ++     +NC  F+RH+  + S
Sbjct: 235 WHLEDQDLYSINYIHFGAPKQWYSIPQEDSEKFYNFMKEQFPEESKNCSEFLRHKMFLVS 294

Query: 263 PDFLRKNNIKFNRVVQFQHEFIITFPYCMYSGFNYGYNFGESIEFILDQQAVVRKQPLKC 322
           P  L+ N I+ N +V  Q EFI+T+P+  ++GFNYGYN  ES+ F L     +  +  KC
Sbjct: 295 PKLLQSNGIRCNHIVHRQQEFIVTYPFGYHAGFNYGYNLAESVNFALPSWLDIGAKAKKC 354

Query: 323 GC-----GNKKEERKSGPFSNLSYDSNESEQR--GSITDNDNDL-----FQKV------- 363
            C     G   ++ +    SN  +  N   Q+  G    ND  +      ++V       
Sbjct: 355 LCIDDAVGINVQKLR----SNYMHSPNGGAQKETGKEVQNDKSISSSKTLEEVLEERPPL 410

Query: 364 ---------RSFDELLNHSSQELQNLEDNKNPLFSNINMNRPQSSSLRSTTPN------- 407
                    RSFD + +     L+   D  +   +  N+N   +SS+RSTTPN       
Sbjct: 411 KKFKMGDSDRSFDSVKSTPEFLLKTNSDLLDEKANLDNLNNNNNSSIRSTTPNSQKTGLY 470

Query: 408 --GVNQFLNMNQ-TTISRISSPLLSRMMDLSNIVEPTLDDPGSKFKRK 452
             G+ +    N  T+ISR+SSPLLSRMMDLS+IVEPTL+DP  KFK+K
Sbjct: 471 GFGIKKEGAFNSNTSISRVSSPLLSRMMDLSHIVEPTLEDPTLKFKKK 518

 Score =  140 bits (352), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 102/249 (40%), Positives = 128/249 (51%), Gaps = 52/249 (20%)

Query: 638 SIVSPNPTYSPNPLSL-YLTNSKNPLNSGLAPLSPSTSNIPFLKR---NNVVTLNISREA 693
           SI+SP P+Y+ N LS     N+K+PL  G +    S++ +PF+KR    N VTLNISRE+
Sbjct: 603 SILSPRPSYNSNVLSYGQAGNTKSPLG-GFS----SSTQLPFIKRIQSPNRVTLNISRES 657

Query: 694 SKSPISSFVNDYRSP--LGVSNPLMYSSTINDYSNGTGIRQNSNNINPLDAGPSFSPLHK 751
           S+SP+ S    Y +P  + V  P  Y S+     N     + S  +      P  SP   
Sbjct: 658 SRSPV-SLSGMYGNPNAMMVPIPHPYQSSQTSTLNQVSTAERSPAVT-----PPTSPSKN 711

Query: 752 KPKIXXXXXXXXXXXXXFDYSFTGNKQESNPSILXXXXXXXXXYRTSSMNNNGNNYQAHS 811
           KP                         ES  S L                          
Sbjct: 712 KPARKKAPKQPKAKIDP----------ESPTSALA------------------------Q 737

Query: 812 SKFGENEVIMSDHG-KIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRD 870
           SK  + E++  D G K+Y+C+EC RQFSSGHHLTRHKKSVHSGEKPHSCP+CGK+FKRRD
Sbjct: 738 SKINDEEIMFLDDGSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRD 797

Query: 871 HVLQHLNKK 879
           HVLQHLNKK
Sbjct: 798 HVLQHLNKK 806

>CAGL0L11880g 1272624..1275566 some similarities with sp|P39956
           Saccharomyces cerevisiae YER169w, hypothetical start
          Length = 980

 Score =  259 bits (662), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 134/364 (36%), Positives = 201/364 (55%), Gaps = 51/364 (14%)

Query: 6   VEVIDGVPVFKPSMMEFANFQYFIDEITKFGIENGIVKVIPPKEWLELLEGSPPAESLKT 65
           +EV+DGVPVF+P+  EF +F  ++++I   G+ +GIVKVIPP+EWL+     P  + L+ 
Sbjct: 1   MEVVDGVPVFRPAWEEFKDFMGYMEKIRPHGMASGIVKVIPPREWLDRAGREPREDLLRE 60

Query: 66  IQLDSPIQQQAKRWDKHENGVFSIENEYDNKSYNLTQWKNLAESLDSRI----------S 115
           +++ +PIQQ          GV+ I N   NK+YN+ QWK+L  S D R+          S
Sbjct: 61  VRIRNPIQQHVS----GSKGVYMISNVEKNKTYNMIQWKDL--SYDFRVPDDPSSLKNKS 114

Query: 116 QGDFNDKTLK------------ENCRVDSQQDCY---------------DLAQLQILESD 148
           +    D                +NC   +++D                 D  +L+ LES 
Sbjct: 115 EESIQDNERSQQRRRSSSGIKLKNCDSATEEDFQNFMKEYNAENIRDFDDEERLKFLESY 174

Query: 149 FWKTIAFSKPFYAVDENSSIFPYDLTLWNLNNLPDSINSSNRR--------LLTGQSKCI 200
           +WKT+ F+ P Y  D + SIFP DL  WN+  LP+ ++  ++         L  G  K  
Sbjct: 175 YWKTLNFTTPLYGADSSGSIFPSDLEEWNVAKLPNVLSHIDQDIPGVNQAYLYAGLWKAS 234

Query: 201 FPWHLDEQNKCSINYLHFGAPKQWYSIPSANTDQFLKILSKEPSSNKENCPAFIRHQNII 260
           F WHL++Q+  SINY+HFGAPKQWYSIP  + ++F + + ++       C  F+RH+  +
Sbjct: 235 FTWHLEDQDLYSINYIHFGAPKQWYSIPQEDHEKFYEFMKEKFPEEASKCKEFLRHKMFL 294

Query: 261 TSPDFLRKNNIKFNRVVQFQHEFIITFPYCMYSGFNYGYNFGESIEFILDQQAVVRKQPL 320
            SP  L++NNIK N+V  ++HEFIIT+PY  ++GFNYGYN  ES+ F L+    + K+  
Sbjct: 295 VSPKVLKENNIKCNKVTHYEHEFIITYPYGYHAGFNYGYNLAESVNFALEDWLEIGKKAG 354

Query: 321 KCGC 324
           KC C
Sbjct: 355 KCRC 358

 Score =  162 bits (409), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 107/278 (38%), Positives = 139/278 (50%), Gaps = 48/278 (17%)

Query: 635 HNLSIVSPNPT-YSPNPLSLYLTNSKNPLNSGLAPLSPSTSNIPFLKR---NNVVTLNIS 690
             +S+VSP P  Y  N       +  +P+     P+SP  SN+PF+KR    N+VTLNIS
Sbjct: 691 QGMSVVSPKPVPYYGNQFERTFNSMPSPI-----PMSPGGSNMPFIKRLKSPNIVTLNIS 745

Query: 691 REASKSPISSFVNDYRSPLGVSNPLMYSSTINDYSNGTGIRQNSNNINPLD------AGP 744
           RE SKSP+S   N+ RS      PL  ++T+   S      +  +N+NP++      A P
Sbjct: 746 REGSKSPVS-LQNEVRS------PLGLNTTL---SYPIPTEKQLSNLNPVNNSNYQAASP 795

Query: 745 SF---------------------SPLHKKPK--IXXXXXXXXXXXXXFDYSFTGNKQESN 781
           +                      S     P   +                +   NK    
Sbjct: 796 ALMDDKNNINPNQNMNSLLDMGLSAFQNSPSNGLRQISSETYESSPLMSLAAAANKDIEL 855

Query: 782 PSILXXXXXXXXXYRTSSMNNNGNNYQAHSSKFGENEVIMSDHGKIYICRECNRQFSSGH 841
            + +           T    +   + +A   KF + EVI+SD GKIY+C+EC RQFSSGH
Sbjct: 856 TNSMMRPSRSKTKLPTDKARSKSKSVEAQGPKFEKGEVILSDSGKIYVCQECKRQFSSGH 915

Query: 842 HLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHLNKK 879
           HLTRHKKSVHSGEKPHSCP+CGKRFKRRDHVLQHLNKK
Sbjct: 916 HLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKK 953

 Score = 82.4 bits (202), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 56/126 (44%), Positives = 76/126 (60%), Gaps = 17/126 (13%)

Query: 333 SGPFSNLSYDSNESEQRGSITDNDNDLFQKVRSFDELLNHSSQELQNLEDN--KNPLFSN 390
           S P +N+  +SN+++    I  N   + +K+R FDELLN S Q    +E +   +P F+ 
Sbjct: 465 SNPATNIKMESNKTK----IEANVPGVAKKLRGFDELLNRSPQNSPRMETSLKNDPFFA- 519

Query: 391 INMNRPQSSSLRSTTPNGVNQFLNMNQTTISRISSPLLSRMMDLSNIVEPTLDDPGSKFK 450
                 + S LRS +P G N F N    +I R+SSP+LS+M+DLSNIVEPTLDDP  KFK
Sbjct: 520 ------RDSPLRSNSP-GTNLFFNQ---SIQRMSSPILSKMIDLSNIVEPTLDDPTLKFK 569

Query: 451 RKVLTP 456
           RK   P
Sbjct: 570 RKTNLP 575

>Scas_76.1
          Length = 228

 Score =  100 bits (248), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 52/130 (40%), Positives = 75/130 (57%), Gaps = 10/130 (7%)

Query: 118 DFNDKTLKENCRVDSQQDCYDLAQLQILESDFWKTIAFSKPFYAVDENSSIFPYDLTLWN 177
           DF +     NC   SQ    + ++L+ LES +W+T+ F+ P Y  D   S+F   L  WN
Sbjct: 88  DFEEFLPSYNCENLSQ--LTEPSRLEFLESYYWRTLNFTTPMYGADTLGSLFNDKLDTWN 145

Query: 178 LNNLPDSINSSNRRL--------LTGQSKCIFPWHLDEQNKCSINYLHFGAPKQWYSIPS 229
           ++ LP+ ++  +RRL          G  K  F WHL++Q+  SINYLHFGAPKQWYSIP 
Sbjct: 146 VSRLPNLLDHMDRRLPGVNDSYLYAGLWKASFAWHLEDQDLYSINYLHFGAPKQWYSIPQ 205

Query: 230 ANTDQFLKIL 239
            ++ +F K +
Sbjct: 206 QDSHKFYKFM 215

>CAGL0H00528g 52511..54733 similar to sp|P47156 Saccharomyces
           cerevisiae YJR119c, hypothetical start
          Length = 740

 Score = 88.6 bits (218), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 64/118 (54%), Gaps = 2/118 (1%)

Query: 192 LLTGQSKCIFPWHLDEQNKCSINYLHFGAPKQWYSIPSANTDQFLKILSKEPSSNKENCP 251
           +  G     F WHL++Q   S NY H G+PK WYSIP  + D F K+L        E  P
Sbjct: 417 IYVGSKFSTFCWHLEDQYTLSANYQHEGSPKVWYSIPDNSCDNFHKLLHDLTPDLFEKQP 476

Query: 252 AFIRHQNIITSP--DFLRKNNIKFNRVVQFQHEFIITFPYCMYSGFNYGYNFGESIEF 307
             +     + SP     +K N+K+ + VQ  +E+I+TFP C ++GFN GYN  E++ F
Sbjct: 477 DLLHQLVSLISPYDPLFKKYNVKWYKAVQHPNEYIVTFPKCYHAGFNTGYNINEAVNF 534

>ABR167C [760] [Homologous to ScYJR119C - SH] (714425..716755) [2331
           bp, 776 aa]
          Length = 776

 Score = 87.8 bits (216), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 63/121 (52%), Gaps = 2/121 (1%)

Query: 192 LLTGQSKCIFPWHLDEQNKCSINYLHFGAPKQWYSIPSANTDQFLKILSKEPSSNKENCP 251
           L  G +   F WHL++Q   S NY H G PK WYSIP  +   F K++        E  P
Sbjct: 421 LYIGSTFSTFCWHLEDQYTLSANYQHEGDPKVWYSIPEQSATAFNKLMKNIAPDLFEKQP 480

Query: 252 AFIRHQNIITSP--DFLRKNNIKFNRVVQFQHEFIITFPYCMYSGFNYGYNFGESIEFIL 309
             +     + SP  +     NI   + VQ+  E+IIT+P C ++GFN GYNF E++ F L
Sbjct: 481 DLMHQLVTLISPYDEKFEAANIACYKAVQYPGEYIITYPKCYHAGFNTGYNFNEAVNFTL 540

Query: 310 D 310
           D
Sbjct: 541 D 541

>Kwal_55.21855
          Length = 521

 Score = 85.9 bits (211), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 42/121 (34%), Positives = 65/121 (53%), Gaps = 2/121 (1%)

Query: 192 LLTGQSKCIFPWHLDEQNKCSINYLHFGAPKQWYSIPSANTDQFLKILSKEPSSNKENCP 251
           +  G +   F WHL++Q   S N+ H G PK WYSIP ++ D+F  ++ +      +  P
Sbjct: 167 IYIGSTFSTFCWHLEDQYTLSANFQHEGDPKVWYSIPGSSCDKFNTLMRQMAPDLFQKQP 226

Query: 252 AFIRHQNIITSP--DFLRKNNIKFNRVVQFQHEFIITFPYCMYSGFNYGYNFGESIEFIL 309
             +     + +P     +   I   + +Q+  E+IITFP C +SGFN GYNF E++ F L
Sbjct: 227 DLLHQLVTLIAPYDSAFKDAKISCYKAIQYPGEYIITFPKCYHSGFNTGYNFNEAVNFTL 286

Query: 310 D 310
           D
Sbjct: 287 D 287

>KLLA0D10758g 917125..919677 similar to sp|P47156 Saccharomyces
           cerevisiae YJR119c, start by similarity
          Length = 850

 Score = 84.7 bits (208), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 57/177 (32%), Positives = 85/177 (48%), Gaps = 19/177 (10%)

Query: 152 TIAFSKPFYAVDENSSIFPYDLTL----WNLNNLPDSINS----SNRRL--------LTG 195
           T+ +  PF   D+ S  F   L +    WNL NLP +  S     NR++          G
Sbjct: 423 TMGYVPPF-ITDKESDEFKQFLKVSSHPWNLINLPRARGSLLSIINRKISGMTIPWIYVG 481

Query: 196 QSKCIFPWHLDEQNKCSINYLHFGAPKQWYSIPSANTDQFLKILSKEPSSNKENCPAFIR 255
            +   F WHL++Q   S NY H G+ K WYSIP  +T  F +++        E  P  + 
Sbjct: 482 STFSTFCWHLEDQYTLSANYQHIGSQKIWYSIPERSTSAFDEMMKNISPDLFERQPDLLH 541

Query: 256 HQNIITSPDFLR--KNNIKFNRVVQFQHEFIITFPYCMYSGFNYGYNFGESIEFILD 310
               + SP   R  +  I   + +Q   E+I+T+P C ++GFN G+NF E++ F LD
Sbjct: 542 QLITLVSPYSKRFVEAGIDCYKAIQNPGEYIVTYPKCYHAGFNSGFNFNEAVNFTLD 598

 Score = 30.8 bits (68), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 26/39 (66%), Gaps = 2/39 (5%)

Query: 12 VPVFKPSMMEFANFQYFI--DEITKFGIENGIVKVIPPK 48
          +P  +PS  +F +   F+  +E+ K G++ G++K+IPP+
Sbjct: 4  IPTLRPSEEQFLDPIGFLSSNEVKKLGMKYGMIKLIPPE 42

>Sklu_2303.6 YJR119C, Contig c2303 8969-11356
          Length = 795

 Score = 84.0 bits (206), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 64/121 (52%), Gaps = 2/121 (1%)

Query: 192 LLTGQSKCIFPWHLDEQNKCSINYLHFGAPKQWYSIPSANTDQFLKILSKEPSSNKENCP 251
           +  G +   F WHL++Q   S NY H G PK WYSIP  + D+F +++        E  P
Sbjct: 438 IYIGSTFSTFCWHLEDQYTLSANYQHEGDPKVWYSIPEHSCDKFNRLMKDIAPDLFEKQP 497

Query: 252 AFIRHQNIITSP--DFLRKNNIKFNRVVQFQHEFIITFPYCMYSGFNYGYNFGESIEFIL 309
             +     + SP     ++  I   + +Q   E+IITFP C ++GFN GYNF E++ F L
Sbjct: 498 DLLHQLITLISPYDKRFQQAKISCYKALQKPGEYIITFPKCYHAGFNTGYNFNEAVNFTL 557

Query: 310 D 310
           D
Sbjct: 558 D 558

>Scas_691.27
          Length = 735

 Score = 81.3 bits (199), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 56/151 (37%), Positives = 81/151 (53%), Gaps = 28/151 (18%)

Query: 177 NLNNLPDSINS-----SNRRL--------LTGQSKCIFPWHLDEQNKCSINYLHFGAPKQ 223
           NL NLP+++ S     SN+ +          G +   F WH+++Q   S NY H GA K 
Sbjct: 390 NLVNLPNALGSLLPLLSNKTISGMTIPWIYVGSTFSTFCWHMEDQYTLSANYQHEGASKI 449

Query: 224 WYSIPSANTDQFLKIL-SKEPSSNKENCPAFIRHQNII------TSPDFLRKNNIKFNRV 276
           WYSIP+++ + F K+L S  P         FI+ Q++I       SP  L K +I   + 
Sbjct: 450 WYSIPASSCEPFQKLLHSMTPD-------LFIKQQDLIHQLVSLVSPYDLPK-SINCYKA 501

Query: 277 VQFQHEFIITFPYCMYSGFNYGYNFGESIEF 307
           +Q  +E+IITFP C +SGFN GYN  E++ F
Sbjct: 502 IQNPNEYIITFPKCFHSGFNTGYNLNEAVNF 532

>YJR119C (YJR119C) [3011] chr10 complement(644219..646405) Protein
           containing a PHD-finger and jumonji (jmjN) and jumonji
           (jmjC) domains, has low similarity to a region of
           selected mouse cDNA on the Y homolog (human SMCY), which
           is a male-specific protein that elicits transplant
           rejection in female recipients [2187 bp, 728 aa]
          Length = 728

 Score = 79.3 bits (194), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 42/112 (37%), Positives = 61/112 (54%), Gaps = 2/112 (1%)

Query: 201 FPWHLDEQNKCSINYLHFGAPKQWYSIPSANTDQFLKILSKEPSSNKENCPAFIRHQNII 260
           F WH+++Q   S NY H G PK WYSIP +   +F  +L+          P  +     +
Sbjct: 424 FCWHMEDQYTLSANYQHEGDPKVWYSIPESGCTKFNDLLNDMSPDLFIKQPDLLHQLVTL 483

Query: 261 TSPDF--LRKNNIKFNRVVQFQHEFIITFPYCMYSGFNYGYNFGESIEFILD 310
            SP     +K+ I   + VQ  +E+IITFP C ++GFN GYNF E++ F +D
Sbjct: 484 ISPYDPNFKKSGIPVYKAVQKPNEYIITFPKCYHAGFNTGYNFNEAVNFTID 535

>CAGL0G08107g 768772..770649 weakly similar to tr|Q03833
           Saccharomyces cerevisiae YDR096w GIS1 DNA
           damage-responsive repressor of PHR1, hypothetical start
          Length = 625

 Score = 76.3 bits (186), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 43/63 (68%)

Query: 817 NEVIMSDHGKIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHL 876
           +++  SD  K + C  C+  F S +HL RH+ SVHS EKP++CP C K FKR+DHV QHL
Sbjct: 551 SKIRYSDGFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQHL 610

Query: 877 NKK 879
            KK
Sbjct: 611 KKK 613

 Score = 72.8 bits (177), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 41/133 (30%), Positives = 57/133 (42%), Gaps = 6/133 (4%)

Query: 199 CIF----PWHLDEQNKCSINYLHFGAPKQWYSIPSANTDQFLKILSKEPSSNKENCPAFI 254
           C F    PW +D  N+  + +  FG P QWY +   N D  +  L K      E C AF 
Sbjct: 186 CCFGTQIPWRIDTVNQYHLIFNLFGTPIQWYIVEGCNRDSLISYLKKLEPKGSETCNAFY 245

Query: 255 RHQNIITSPDFLRKNNIKFNRVVQFQHEFIITFPYCMYSGFNYGYNFGESIEFILDQQAV 314
            H+     PDFL + NI +  +VQ   +  I+ P   +  F+YGY+         DQ   
Sbjct: 246 IHKKYCFGPDFLERANIPYKTMVQESGKLFISKPGTCFFVFHYGYSIVMEKTIKCDQTIF 305

Query: 315 VRKQ--PLKCGCG 325
             +   P  C CG
Sbjct: 306 TAQHVFPALCTCG 318

>Scas_649.28
          Length = 730

 Score = 70.5 bits (171), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 47/82 (57%), Gaps = 3/82 (3%)

Query: 798 SSMNNNGNNYQAHSSKFGENEVI---MSDHGKIYICRECNRQFSSGHHLTRHKKSVHSGE 854
           +S +NN NN  AH+S+     V    + D  K + C EC + F    HL RH +SVHS E
Sbjct: 640 TSPHNNSNNSTAHTSRRASVSVTPGSLDDKNKPFKCSECIKAFRRSEHLKRHIRSVHSSE 699

Query: 855 KPHSCPRCGKRFKRRDHVLQHL 876
           +P +C  C K+F R D++ QHL
Sbjct: 700 RPFACMFCEKKFSRSDNLSQHL 721

>Scas_709.32
          Length = 822

 Score = 70.1 bits (170), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 34/56 (60%)

Query: 821 MSDHGKIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHL 876
            SD  K + C  C + F    HL RH +SVHS E+P +CP C K+F R D++ QH+
Sbjct: 758 FSDENKTFKCETCGKAFRRSEHLKRHIRSVHSSERPFACPTCDKKFSRSDNLAQHI 813

>Scas_602.9
          Length = 547

 Score = 63.9 bits (154), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 36/62 (58%)

Query: 815 GENEVIMSDHGKIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQ 874
           G    ++ D  K + C  C R+F    HL RH +S+H GEKP++C  C K F R D++ Q
Sbjct: 482 GRKPSLLPDATKQFACDYCERRFKRQEHLKRHVRSLHIGEKPYACHICNKNFSRSDNLTQ 541

Query: 875 HL 876
           H+
Sbjct: 542 HI 543

>CAGL0L06072g complement(679924..680826) some similarities with
           sp|P39959 Saccharomyces cerevisiae YER130c or sp|P33749
           Saccharomyces cerevisiae YKL062w MSN4 transcriptional
           activator, hypothetical start
          Length = 300

 Score = 62.0 bits (149), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 26/61 (42%), Positives = 35/61 (57%)

Query: 815 GENEVIMSDHGKIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQ 874
           G    ++ D  KI+ C  C R+F    HL RH  S+H GE+P+SC  C K F R D++ Q
Sbjct: 205 GRKPSLLFDDAKIFKCDMCERRFKRQEHLKRHVSSLHMGERPYSCDICLKSFSRSDNLNQ 264

Query: 875 H 875
           H
Sbjct: 265 H 265

>CAGL0E04884g complement(469295..473764) weakly similar to sp|P07248
           Saccharomyces cerevisiae YDR216w ADR1 zinc-finger
           transcription factor, hypothetical start
          Length = 1489

 Score = 63.9 bits (154), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 38/53 (71%), Gaps = 1/53 (1%)

Query: 826 KIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHLNK 878
           ++++C+ C R F+   HLTRH++S H+ EKP+ C  C +RF RRD +L+H +K
Sbjct: 28  RLFVCQTCTRAFARQEHLTRHERS-HTKEKPYCCGICDRRFTRRDLLLRHAHK 79

>Sklu_2181.1 YER130C, Contig c2181 4015-5247
          Length = 410

 Score = 62.8 bits (151), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 35/54 (64%)

Query: 823 DHGKIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHL 876
           D  K + C  C+R+F    HL RH +S+H GEKP+ C  CGK+F R D++ QH+
Sbjct: 349 DASKQFGCEFCDRRFKRQEHLKRHVRSLHMGEKPYGCEICGKKFSRSDNLNQHI 402

>AGR172W [4483] [Homologous to ScYDR216W (ADR1) - SH]
           complement(1071491..1074664) [3174 bp, 1057 aa]
          Length = 1057

 Score = 63.5 bits (153), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 27/62 (43%), Positives = 39/62 (62%), Gaps = 1/62 (1%)

Query: 817 NEVIMSDHGKIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHL 876
           N V  S   ++++C  C R F+   HL RHK+S H+ EKP+ C  C +RF RRD +L+H 
Sbjct: 38  NGVTPSGKPRLFVCHTCTRAFARQEHLIRHKRS-HTNEKPYICGICDRRFSRRDLLLRHA 96

Query: 877 NK 878
           +K
Sbjct: 97  HK 98

>AGR031W [4341] [Homologous to ScYDR043C (NRG1) - SH; ScYBR066C
           (NRG2) - SH] complement(769926..770348) [423 bp, 140 aa]
          Length = 140

 Score = 58.2 bits (139), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 23/50 (46%), Positives = 35/50 (70%), Gaps = 3/50 (6%)

Query: 828 YICRECNRQFSSGHHLTRHKKSVHSGEKPHSC--PRCGKRFKRRDHVLQH 875
           ++C+ C + F++  HL RH + +H+GEK H+C  P CG+RF R D+ LQH
Sbjct: 80  HLCQTCGKGFTTSGHLARHNR-IHTGEKNHACHFPGCGQRFSRHDNCLQH 128

>Kwal_47.17241
          Length = 403

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 34/54 (62%)

Query: 823 DHGKIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHL 876
           D  K + C  C+R+F    HL RH +S+H GEKP  C  CGK+F R D++ QH+
Sbjct: 341 DASKQFACDFCDRRFKRQEHLKRHVRSLHMGEKPFDCHICGKKFSRSDNLNQHI 394

>KLLA0F13046g 1201353..1205492 some similarities with sp|P07248
           Saccharomyces cerevisiae YDR216w ADR1 zinc-finger
           transcription factor, hypothetical start
          Length = 1379

 Score = 62.8 bits (151), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 26/62 (41%), Positives = 40/62 (64%), Gaps = 1/62 (1%)

Query: 817 NEVIMSDHGKIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHL 876
           N V  S   ++++C+ C R F+   HLTRH++S H+ EKP+ C  C +RF RRD +++H 
Sbjct: 114 NGVTPSGKPRLFVCKVCTRAFARQEHLTRHERS-HTKEKPYVCGICERRFTRRDLLIRHC 172

Query: 877 NK 878
            K
Sbjct: 173 QK 174

 Score = 32.0 bits (71), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 25/54 (46%), Gaps = 7/54 (12%)

Query: 826 KIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHLNKK 879
           K Y+C  C R+F+    L RH + +H G        CG   +R    ++  +KK
Sbjct: 151 KPYVCGICERRFTRRDLLIRHCQKLHGGN-------CGDYIRRTSRKVRRDSKK 197

>YKL062W (MSN4) [3197] chr11 (322873..324765) Zinc-finger
           transcriptional activator for genes regulated through
           Snf1p, has strong similarity to Msn2p, has two tandem
           C2H2-type zinc fingers [1893 bp, 630 aa]
          Length = 630

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 34/54 (62%)

Query: 823 DHGKIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHL 876
           D  K + C++C + F    HL RH +SVHS E+P +C  C K+F R D++ QHL
Sbjct: 568 DKNKPFKCKDCEKAFRRSEHLKRHIRSVHSTERPFACMFCEKKFSRSDNLSQHL 621

>ACL057W [992] [Homologous to ScYER130C - SH]
           complement(264934..266496) [1563 bp, 520 aa]
          Length = 520

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 34/54 (62%)

Query: 823 DHGKIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHL 876
           D  K + C  C R+F    HL RH +S+H GEKP+ C  CGK+F R D++ QH+
Sbjct: 455 DATKPFGCEYCERRFKRQEHLKRHIRSLHMGEKPYGCDICGKKFSRSDNLNQHI 508

>KLLA0C17072g 1494101..1495525 weakly similar to sp|P39959
           Saccharomyces cerevisiae YER130c, hypothetical start
          Length = 474

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 34/54 (62%)

Query: 823 DHGKIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHL 876
           D  K + C  C+R+F    HL RH +S+H  EKP+ C  CGK+F R D++ QHL
Sbjct: 413 DASKPFGCEYCDRRFKRQEHLKRHIRSLHICEKPYGCHLCGKKFSRSDNLSQHL 466

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 21/35 (60%), Gaps = 2/35 (5%)

Query: 844 TRHKKS--VHSGEKPHSCPRCGKRFKRRDHVLQHL 876
           TR +K   +    KP  C  C +RFKR++H+ +H+
Sbjct: 403 TRGRKPSPILDASKPFGCEYCDRRFKRQEHLKRHI 437

>Sklu_2357.7 YDR043C, Contig c2357 9816-10289 reverse complement
          Length = 157

 Score = 57.4 bits (137), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 24/50 (48%), Positives = 35/50 (70%), Gaps = 3/50 (6%)

Query: 828 YICRECNRQFSSGHHLTRHKKSVHSGEKPHSCP--RCGKRFKRRDHVLQH 875
           Y+C+ C+R F++  HL RH + +H+GEK H CP   CG+RF R D+ +QH
Sbjct: 100 YVCKICSRGFTTSGHLARHNR-IHTGEKNHVCPFEGCGQRFSRHDNCVQH 148

>CAGL0M13189g complement(1294293..1295918) weakly similar to
           sp|P33749 Saccharomyces cerevisiae YKL062w MSN4
           transcriptional activator, hypothetical start
          Length = 541

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 35/58 (60%)

Query: 819 VIMSDHGKIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHL 876
           V + D  K + C +C++ F    HL RH +SVHS E+P  C  C K+F R D++ QHL
Sbjct: 475 VELPDGAKPFQCADCDKAFRRSEHLKRHVRSVHSTERPFPCMFCEKKFSRSDNLSQHL 532

>KLLA0F26961g 2486804..2488888 some similarities with sp|P33748
           Saccharomyces cerevisiae YMR037c MSN2 stress responsive
           regulatory protein, hypothetical start
          Length = 694

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 34/56 (60%)

Query: 821 MSDHGKIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHL 876
           M +  K + C +CN+ F    HL RH +SVHS E+P  C  C K+F R D++ QHL
Sbjct: 614 MDEEEKPFKCDQCNKTFRRSEHLKRHVRSVHSTERPFHCQFCDKKFSRSDNLSQHL 669

>CAGL0K02145g 190055..191008 some similarities with sp|P39959
           Saccharomyces cerevisiae YER130c, hypothetical start
          Length = 317

 Score = 59.7 bits (143), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 37/62 (59%)

Query: 815 GENEVIMSDHGKIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQ 874
           G    ++ D  K + C  C+R+F    HL RH +S+H GEKP+ C  C K+F R D++ Q
Sbjct: 251 GRKPSLVPDLSKQFGCEFCDRRFKRQEHLKRHIRSLHMGEKPYECHICNKKFSRSDNLNQ 310

Query: 875 HL 876
           H+
Sbjct: 311 HI 312

>Scas_703.23
          Length = 1341

 Score = 60.5 bits (145), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 27/63 (42%), Positives = 39/63 (61%), Gaps = 1/63 (1%)

Query: 816 ENEVIMSDHGKIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQH 875
           ++ VI +D  + ++C  C R F    HL RH++S H+ EKP  C  CG+ F RRD VL+H
Sbjct: 60  KSRVIKTDKPRPFLCPTCTRGFVRQEHLKRHQRS-HTNEKPFLCVFCGRCFARRDLVLRH 118

Query: 876 LNK 878
            +K
Sbjct: 119 QHK 121

>Scas_721.92
          Length = 1152

 Score = 60.1 bits (144), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 35/53 (66%), Gaps = 1/53 (1%)

Query: 826 KIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHLNK 878
           ++++C  C+R F+   HL RH +S H+ EKP+ C  C K+F RRD +L+H  K
Sbjct: 76  RLFVCDVCSRAFARQEHLDRHARS-HTNEKPYQCGICTKKFTRRDLLLRHAQK 127

>Kwal_26.8351
          Length = 698

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 32/51 (62%)

Query: 826 KIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHL 876
           K + C+EC + F    HL RH +SVHS E+P  C  C K+F R D++ QHL
Sbjct: 639 KPFKCQECTKAFRRSEHLKRHIRSVHSSERPFHCSYCDKKFSRSDNLSQHL 689

>ABR089C [680] [Homologous to ScYKL062W (MSN4) - SH; ScYMR037C
           (MSN2) - SH] (548266..549981) [1716 bp, 571 aa]
          Length = 571

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 32/51 (62%)

Query: 826 KIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHL 876
           K + C+EC + F    HL RH +SVHS ++P  C  C K+F R D++ QHL
Sbjct: 502 KPFKCQECTKAFRRSEHLKRHIRSVHSSDRPFPCTYCDKKFSRSDNLSQHL 552

 Score = 30.8 bits (68), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 10/23 (43%), Positives = 15/23 (65%)

Query: 854 EKPHSCPRCGKRFKRRDHVLQHL 876
           EKP  C  C K F+R +H+ +H+
Sbjct: 501 EKPFKCQECTKAFRRSEHLKRHI 523

>YDR043C (NRG1) [896] chr4 complement(542670..543365)
           Transcriptional repressor involved in glucose repression
           of STA1 and MUC1, suppressor of snf mutations, has two
           tandem C2H2-type zinc fingers [696 bp, 231 aa]
          Length = 231

 Score = 56.2 bits (134), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 33/50 (66%), Gaps = 3/50 (6%)

Query: 828 YICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPR--CGKRFKRRDHVLQH 875
           YIC+ C R F++  HL RH + +H+GEK H CP   C +RF R D+ LQH
Sbjct: 174 YICKICARGFTTSGHLARHNR-IHTGEKNHCCPYKGCTQRFSRHDNCLQH 222

>YJR127C (ZMS1) [3019] chr10 complement(658832..662974) Protein with
           similarity to Adr1p and Yml081p, has two tandem zinc
           finger domains [4143 bp, 1380 aa]
          Length = 1380

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 38/63 (60%), Gaps = 1/63 (1%)

Query: 816 ENEVIMSDHGKIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQH 875
           ++ +I +D  + ++C  C R F    HL RH+ S H+ EKP+ C  CG+ F RRD VL+H
Sbjct: 139 KSRIIKTDKPRPFLCPTCTRGFVRQEHLKRHQHS-HTREKPYLCIFCGRCFARRDLVLRH 197

Query: 876 LNK 878
             K
Sbjct: 198 QQK 200

>Sklu_2351.6 YGL035C, Contig c2351 12964-14610 reverse complement
          Length = 548

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 35/55 (63%), Gaps = 3/55 (5%)

Query: 823 DHGKIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSC--PRCGKRFKRRDHVLQH 875
           D  + Y+C  C+R F    H TRH ++ H+GEKPH+C  P CGKRF R D + +H
Sbjct: 29  DSPRPYVCPICSRAFHRLEHQTRHIRT-HTGEKPHACEFPGCGKRFSRSDELTRH 82

>KLLA0B04477g 400019..404017 similar to sp|Q04545 Saccharomyces
           cerevisiae YML081w, start by similarity
          Length = 1332

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 39/63 (61%), Gaps = 1/63 (1%)

Query: 816 ENEVIMSDHGKIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQH 875
           ++ +I +D  + ++C  C R F+   HL RH++S H+ EKP  C  CG+ F RRD VL+H
Sbjct: 71  KSRLIKTDRPRPFLCPICTRGFARQEHLRRHERS-HTNEKPFLCAFCGRCFARRDLVLRH 129

Query: 876 LNK 878
             K
Sbjct: 130 QQK 132

>Kwal_27.10925
          Length = 264

 Score = 56.2 bits (134), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 23/50 (46%), Positives = 34/50 (68%), Gaps = 3/50 (6%)

Query: 828 YICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPR--CGKRFKRRDHVLQH 875
           Y+C+ C + F++  HL RH + +H+GEK H CP   CG+RF R D+ +QH
Sbjct: 201 YVCKICVKGFTTSGHLARHNR-IHTGEKNHVCPHEGCGQRFSRHDNCVQH 249

>CAGL0K12078g complement(1168989..1170380) weakly similar to
           sp|Q03125 Saccharomyces cerevisiae YDR043c NRG1,
           hypothetical start
          Length = 463

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 34/50 (68%), Gaps = 3/50 (6%)

Query: 828 YICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPR--CGKRFKRRDHVLQH 875
           Y+C+ C + F++  HL RH + +H+GEK H CP   CG+RF R D+ LQH
Sbjct: 402 YLCKVCGKGFTTSGHLARHNR-IHTGEKRHVCPYEGCGQRFNRHDNCLQH 450

>Kwal_47.16621
          Length = 1178

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 25/63 (39%), Positives = 38/63 (60%), Gaps = 1/63 (1%)

Query: 816 ENEVIMSDHGKIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQH 875
           ++  I +D  + ++C  C R F+   HL RH+++ H+ EKP  C  CG+ F RRD VL+H
Sbjct: 66  KSRTIKTDRPRPFLCSICTRGFARQEHLKRHQRA-HTNEKPFLCAFCGRCFARRDLVLRH 124

Query: 876 LNK 878
             K
Sbjct: 125 QQK 127

>YML081W (YML081W) [3888] chr13 (104777..108532) Protein with
           similarity to Zms1p and Adr1p, has two tandem C2H2-type
           zinc fingers [3756 bp, 1251 aa]
          Length = 1251

 Score = 57.8 bits (138), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 25/63 (39%), Positives = 38/63 (60%), Gaps = 1/63 (1%)

Query: 816 ENEVIMSDHGKIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQH 875
           ++  I +D  + ++C  C R F    HL RH+++ H+ EKP  C  CG+ F RRD VL+H
Sbjct: 49  KSRTIKTDKPRPFLCHICTRGFVRQEHLKRHQRA-HTNEKPFLCVFCGRCFARRDLVLRH 107

Query: 876 LNK 878
            +K
Sbjct: 108 QHK 110

>CAGL0M00594g 70659..73721 similar to sp|P46974 Saccharomyces
           cerevisiae YJR127c ZMS1 or sp|Q04545 Saccharomyces
           cerevisiae YML081w, hypothetical start
          Length = 1020

 Score = 57.4 bits (137), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 38/63 (60%), Gaps = 1/63 (1%)

Query: 816 ENEVIMSDHGKIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQH 875
           ++  + +D  + ++C  C+R F    HL RH+ S H+ EKP  C  CGK F R+D VL+H
Sbjct: 15  KSRAVKTDKPRPFLCPICSRGFVRQEHLKRHQNS-HTHEKPFLCLICGKCFARKDLVLRH 73

Query: 876 LNK 878
           L K
Sbjct: 74  LQK 76

>Scas_707.31
          Length = 289

 Score = 55.8 bits (133), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 33/62 (53%)

Query: 815 GENEVIMSDHGKIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQ 874
           G    I+ D  K Y C  C ++F    HL RH +++H   +P  C  C KRF R D++ Q
Sbjct: 210 GRKPSILPDDSKQYFCHLCKKRFKRHEHLKRHFRTIHLRVRPFECSVCHKRFSRNDNLNQ 269

Query: 875 HL 876
           H+
Sbjct: 270 HV 271

>AER159C [2662] [Homologous to ScYML081W - SH; ScYJR127C (ZMS1) -
           SH] (935544..939119) [3576 bp, 1191 aa]
          Length = 1191

 Score = 57.4 bits (137), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 38/63 (60%), Gaps = 1/63 (1%)

Query: 816 ENEVIMSDHGKIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQH 875
           ++  I +D  + ++C  C R F+   HL RH++S H+ EKP  C  CG+ F RRD VL+H
Sbjct: 68  KSRTIKTDKPRPFLCPVCTRGFARQEHLKRHQRS-HTNEKPFLCAFCGRCFARRDLVLRH 126

Query: 876 LNK 878
             K
Sbjct: 127 QQK 129

>KLLA0F18524g complement(1701498..1702571) some similarities with
           sp|Q03125 Saccharomyces cerevisiae YDR043c NRG1
           transcriptional repressor for glucose repression of STA1
           gene expression, hypothetical start
          Length = 357

 Score = 56.2 bits (134), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 34/50 (68%), Gaps = 3/50 (6%)

Query: 828 YICRECNRQFSSGHHLTRHKKSVHSGEKPHSC--PRCGKRFKRRDHVLQH 875
           YIC+ C+R F++  HL RH + +H+GEK H C  P C +RF R D+ +QH
Sbjct: 284 YICKICSRGFTTSGHLARHNR-IHTGEKRHQCQFPGCNQRFSRHDNYIQH 332

>CAGL0A01628g 156635..157909 similar to sp|P27705 Saccharomyces
           cerevisiae YGL035c MIG1 transcriptional repressor,
           hypothetical start
          Length = 424

 Score = 56.2 bits (134), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 30/80 (37%), Positives = 44/80 (55%), Gaps = 7/80 (8%)

Query: 798 SSMNNNGNNYQAHSSKFGENEVIMSDHGKIYICRECNRQFSSGHHLTRHKKSVHSGEKPH 857
           SS+ N  +   +  SK G+ +    D  + ++C  C R F    H TRH ++ H+GEKPH
Sbjct: 17  SSVTNGSSTPNSGKSKAGKGD----DAPRPHVCPICGRAFHRLEHQTRHMRT-HTGEKPH 71

Query: 858 SC--PRCGKRFKRRDHVLQH 875
           +C  P C KRF R D + +H
Sbjct: 72  ACDFPGCVKRFSRSDELTRH 91

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 10/22 (45%), Positives = 15/22 (68%)

Query: 855 KPHSCPRCGKRFKRRDHVLQHL 876
           +PH CP CG+ F R +H  +H+
Sbjct: 41  RPHVCPICGRAFHRLEHQTRHM 62

>YER130C (YER130C) [1560] chr5 complement(421111..422442) Protein
           with two tandem zinc finger domains [1332 bp, 443 aa]
          Length = 443

 Score = 55.8 bits (133), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 35/62 (56%)

Query: 815 GENEVIMSDHGKIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQ 874
           G    ++ D  K + C  C+R+F    HL RH +S+H  EKP +C  C K F R D++ Q
Sbjct: 376 GRKPSLIPDASKQFGCEFCDRRFKRQEHLKRHVRSLHMCEKPFTCHICNKNFSRSDNLNQ 435

Query: 875 HL 876
           H+
Sbjct: 436 HV 437

>Sklu_2443.22 , Contig c2443 45390-46027
          Length = 213

 Score = 53.9 bits (128), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 38/63 (60%), Gaps = 1/63 (1%)

Query: 816 ENEVIMSDHGKIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQH 875
           ++  I +D  + ++C  C R F+   HL RH++S H+ EKP  C  CG+ F RRD VL+H
Sbjct: 36  KSRTIKTDKPRPFLCPICTRGFARQEHLKRHQRS-HTNEKPFLCAFCGRCFARRDLVLRH 94

Query: 876 LNK 878
             K
Sbjct: 95  QQK 97

>CAGL0F05995g complement(598819..600612) some similarities with
           sp|P33748 Saccharomyces cerevisiae YMR037c MSN2,
           hypothetical start
          Length = 597

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 33/54 (61%)

Query: 823 DHGKIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHL 876
           D  K + C  C++ F    HL RH +SVHS ++P SC  C K+F R D++ QH+
Sbjct: 530 DIDKPFGCHLCSKAFKRSEHLKRHVRSVHSTDRPFSCHLCEKKFSRSDNLSQHI 583

>YMR037C (MSN2) [4001] chr13 complement(344402..346516) Zinc-finger
           transcriptional activator for genes involved in the
           multistress response, has two tandem C2H2-type zinc
           fingers [2115 bp, 704 aa]
          Length = 704

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 31/51 (60%)

Query: 826 KIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHL 876
           K + C  C + F    HL RH +SVHS E+P +C  C K+F R D++ QH+
Sbjct: 645 KPFHCHICPKSFKRSEHLKRHVRSVHSNERPFACHICDKKFSRSDNLSQHI 695

>CAGL0H04213g 398544..402509 similar to sp|Q04545 Saccharomyces
           cerevisiae YML081w, start by similarity
          Length = 1321

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/74 (37%), Positives = 41/74 (55%), Gaps = 4/74 (5%)

Query: 802 NNGNNYQAHSSKFGENEVIMSDHGKIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPR 861
           +NG N+     K   +  I +D  + ++C  C R F    HL RH+++ H+ EKP  C  
Sbjct: 10  DNGANFAPIPKK---SRTIKTDKPRPHLCPICTRGFVRLEHLKRHQRA-HTNEKPFLCVF 65

Query: 862 CGKRFKRRDHVLQH 875
           CG+ F RRD VL+H
Sbjct: 66  CGRCFARRDLVLRH 79

>Scas_718.44
          Length = 266

 Score = 53.1 bits (126), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 35/50 (70%), Gaps = 3/50 (6%)

Query: 828 YICRECNRQFSSGHHLTRHKKSVHSGEKPHSCP--RCGKRFKRRDHVLQH 875
           ++C+ C+  F++  HL+RH + +H+GEK HSCP   C ++F R D+ LQH
Sbjct: 210 HVCKICSTGFTTSGHLSRHNR-IHTGEKNHSCPFEGCNQKFSRHDNCLQH 258

>YDR216W (ADR1) [1053] chr4 (895027..898998) Zinc-finger
           transcription factor involved in regulation of ADH2 and
           peroxisomal genes [3972 bp, 1323 aa]
          Length = 1323

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 34/56 (60%), Gaps = 3/56 (5%)

Query: 825 GKI--YICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHLNK 878
           GK+  ++C  C R F+   HL RH +S H+ EKP+ C  C + F RRD +++H  K
Sbjct: 99  GKLRSFVCEVCTRAFARQEHLKRHYRS-HTNEKPYPCGLCNRCFTRRDLLIRHAQK 153

>Kwal_14.2278
          Length = 463

 Score = 53.1 bits (126), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 43/78 (55%), Gaps = 9/78 (11%)

Query: 800 MNNNGNNYQAHSSKFGENEVIMSDHGKIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSC 859
           M+++ +  +  S+  G+      +  + YIC  C+R F    H TRH ++ H+GEKPH+C
Sbjct: 1   MDDSASKKKRRSANLGQ------ESPRPYICPICSRAFHRLEHQTRHIRT-HTGEKPHAC 53

Query: 860 --PRCGKRFKRRDHVLQH 875
               C KRF R D + +H
Sbjct: 54  DFAGCTKRFSRSDELTRH 71

>KLLA0E10989g 966805..968229 gi|1709030|sp|P50898|MIG1_KLULA
           Kluyveromyces lactis Regulatory protein MIG1, start by
           similarity
          Length = 474

 Score = 53.1 bits (126), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 33/55 (60%), Gaps = 3/55 (5%)

Query: 823 DHGKIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSC--PRCGKRFKRRDHVLQH 875
           D  + Y+C  C R F    H TRH ++ H+GE+PH+C  P C KRF R D + +H
Sbjct: 21  DGPRPYVCPICQRGFHRLEHQTRHIRT-HTGERPHACDFPGCSKRFSRSDELTRH 74

 Score = 30.4 bits (67), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 21/35 (60%), Gaps = 4/35 (11%)

Query: 846 HKKSVHS----GEKPHSCPRCGKRFKRRDHVLQHL 876
           HKKS++     G +P+ CP C + F R +H  +H+
Sbjct: 11  HKKSINDHDKDGPRPYVCPICQRGFHRLEHQTRHI 45

>YGL035C (MIG1) [1940] chr7 complement(431551..433065) Zinc-finger
           transcriptional repressor involved in
           glucose-repression, has two tandem C2H2-type zinc
           fingers, has similarity to mammalian Sp1, Krox/Egr, and
           Wilms tumor proteins [1515 bp, 504 aa]
          Length = 504

 Score = 53.1 bits (126), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 36/66 (54%), Gaps = 3/66 (4%)

Query: 812 SKFGENEVIMSDHGKIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSC--PRCGKRFKRR 869
           SK        S+  + + C  C+R F    H TRH + +H+GEKPH+C  P C KRF R 
Sbjct: 22  SKSKSKVAAKSEAPRPHACPICHRAFHRLEHQTRHMR-IHTGEKPHACDFPGCVKRFSRS 80

Query: 870 DHVLQH 875
           D + +H
Sbjct: 81  DELTRH 86

>Scas_569.2
          Length = 293

 Score = 52.0 bits (123), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 33/50 (66%), Gaps = 3/50 (6%)

Query: 828 YICRECNRQFSSGHHLTRHKKSVHSGEKPHSC--PRCGKRFKRRDHVLQH 875
           YIC+ C++ F++  HL RH + +H+GEK H C  P C  +F R D+ +QH
Sbjct: 228 YICKVCSKGFTTSGHLARHNR-IHTGEKKHHCSYPGCYLKFSRHDNCVQH 276

>YOR113W (AZF1) [4916] chr15 (534075..536819) Glucose-dependent
           transcriptional activator with four tandem C2H2-type
           zinc fingers [2745 bp, 914 aa]
          Length = 914

 Score = 53.1 bits (126), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 35/51 (68%), Gaps = 1/51 (1%)

Query: 826 KIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHL 876
           K ++C  C ++F+ G +L  H++ +H+GEKP+SC  C K+F R+ ++  HL
Sbjct: 619 KPFVCDYCGKRFTQGGNLRTHER-LHTGEKPYSCDICDKKFSRKGNLAAHL 668

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%)

Query: 826 KIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQH 875
           K + C  C+R FS   HL  H +S H G KP  C  CGKRF +  ++  H
Sbjct: 591 KKHECPYCHRLFSQATHLEVHVRS-HIGYKPFVCDYCGKRFTQGGNLRTH 639

>AFR471C [3663] [Homologous to ScYGL035C (MIG1) - SH; ScYGL209W
           (MIG2) - NSH] (1287076..1288245) [1170 bp, 389 aa]
          Length = 389

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 34/55 (61%), Gaps = 3/55 (5%)

Query: 823 DHGKIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSC--PRCGKRFKRRDHVLQH 875
           D  + Y+C  C R F    H TRH ++ H+GEKPH+C    CGKRF R+D + +H
Sbjct: 17  DAPRPYVCPICARAFHRLEHQTRHIRT-HTGEKPHACDFAGCGKRFSRQDELTRH 70

>Scas_717.17
          Length = 525

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 32/53 (60%), Gaps = 1/53 (1%)

Query: 827 IYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHLNKK 879
           +YIC  C++ F     L RH  S HS E+ + CP C  R KRRD++LQH+  K
Sbjct: 387 VYICHICSKNFKRRSWLKRHLLS-HSSERHYFCPWCLSRHKRRDNLLQHMKLK 438

>CAGL0L07480g complement(822240..823184) some similarities with
           sp|P38082 Saccharomyces cerevisiae YBR066c NRG2 or
           sp|Q03125 Saccharomyces cerevisiae YDR043c NRG1,
           hypothetical start
          Length = 314

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 32/50 (64%), Gaps = 3/50 (6%)

Query: 828 YICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPR--CGKRFKRRDHVLQH 875
           +IC+ C   F++  HL+RH K +H+GEK H CP   C + F R D+ LQH
Sbjct: 252 HICQICLTGFTTSGHLSRHAK-IHTGEKSHVCPHEGCNQSFSRHDNCLQH 300

>YBR066C (NRG2) [256] chr2 complement(369998..370660) Suppressor of
           snf mutations, predicted transcription factor with two
           tandem C2H2-type zinc fingers, involved in glucose
           repression of MUC1 transcription [663 bp, 220 aa]
          Length = 220

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 35/58 (60%), Gaps = 7/58 (12%)

Query: 828 YICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPR--CGKRFKRRD----HVLQHLNKK 879
           + C+ C+  F++  HL+RH + +H+GEK H CP   CG+RF R D    H   H NKK
Sbjct: 153 HFCKICSTGFTTSGHLSRHNR-IHTGEKNHICPHEGCGQRFSRHDNCNQHYRTHANKK 209

>ACR264W [1311] [Homologous to ScYOR113W (AZF1) - SH]
           complement(835313..837622) [2310 bp, 769 aa]
          Length = 769

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 34/51 (66%), Gaps = 1/51 (1%)

Query: 826 KIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHL 876
           K + C  C ++F+ G +L  H + +H+GE+P+ C +CGKRF R+ ++  H+
Sbjct: 513 KPFQCEYCGKRFTQGGNLRTHVR-LHTGERPYECDKCGKRFSRKGNLAAHM 562

 Score = 39.3 bits (90), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 30/58 (51%), Gaps = 5/58 (8%)

Query: 826 KIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKR----RDHVLQHLNKK 879
           K + C  C++ F+   HL  H +S H G KP  C  CGKRF +    R HV  H  ++
Sbjct: 485 KQHKCPYCHKCFTQSTHLEVHVRS-HIGYKPFQCEYCGKRFTQGGNLRTHVRLHTGER 541

>KLLA0B07909g 697885..700653 some similarities with sp|P53243
           Saccharomyces cerevisiae YGR067c singleton, hypothetical
           start
          Length = 922

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 22/49 (44%), Positives = 29/49 (59%), Gaps = 1/49 (2%)

Query: 828 YICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHL 876
           YIC  C + FS   H  RH++S H+G KP SC  C   F RRD + +H+
Sbjct: 8   YICSFCAKPFSRSEHKARHERS-HTGSKPFSCSICSHSFVRRDLLQRHI 55

>CAGL0K09372g complement(924818..926008) similar to sp|P53035
           Saccharomyces cerevisiae YGL209w MIG2 C2H2 zinc-finger
           protein, start by similarity
          Length = 396

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 29/50 (58%), Gaps = 3/50 (6%)

Query: 828 YICRECNRQFSSGHHLTRHKKSVHSGEKPHSC--PRCGKRFKRRDHVLQH 875
           + C  C+R F    H  RH ++ H+GEKPH C  P CGK F R D + +H
Sbjct: 17  FKCEHCSRGFHRLEHKKRHMRT-HTGEKPHGCSFPGCGKSFSRSDELKRH 65

>AFR580C [3772] [Homologous to ScYGR067C - SH] (1478059..1480575)
           [2517 bp, 838 aa]
          Length = 838

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 30/50 (60%), Gaps = 1/50 (2%)

Query: 828 YICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHLN 877
           YIC  C + FS   H TRH++S H+G KP SC  C   F RRD + +H+ 
Sbjct: 8   YICSFCAQAFSRSEHKTRHERS-HTGVKPFSCKVCNHSFVRRDLLQRHIR 56

>KLLA0F23782g 2219920..2222268 some similarities with sp|P41696
           Saccharomyces cerevisiae YOR113w AZF1 asparagine-rich
           zinc finger protein, hypothetical start
          Length = 782

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 33/50 (66%), Gaps = 1/50 (2%)

Query: 826 KIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQH 875
           K + C  C ++F+ G +L  H + +H+GEKP+ C RCG++F R+ ++  H
Sbjct: 549 KPFSCEFCGKRFTQGGNLRTHIR-LHTGEKPYECERCGRKFSRKGNLAAH 597

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 31/58 (53%), Gaps = 5/58 (8%)

Query: 826 KIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKR----RDHVLQHLNKK 879
           K + C  C++ F+   HL  H +S H G KP SC  CGKRF +    R H+  H  +K
Sbjct: 521 KQFQCPYCHKYFTQSTHLEVHVRS-HIGYKPFSCEFCGKRFTQGGNLRTHIRLHTGEK 577

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 26/55 (47%), Gaps = 3/55 (5%)

Query: 826 KIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCP--RCGKRFKRRDHVLQHLNK 878
           K Y C  C R+FS   +L  HK + H   KP  C    C K F +  ++  H N+
Sbjct: 577 KPYECERCGRKFSRKGNLAAHKLT-HDNLKPFECKLDDCNKNFTQLGNMKAHQNR 630

>CAGL0K04631g complement(440721..443762) some similarities with
           sp|P53243 Saccharomyces cerevisiae YGR067c, hypothetical
           start
          Length = 1013

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 30/51 (58%), Gaps = 1/51 (1%)

Query: 826 KIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHL 876
           K + C  CN+ FS   H TRH++S H+G KP  C  C   F RRD + +H+
Sbjct: 10  KRHFCSFCNKAFSRSEHKTRHERS-HAGVKPFECQVCSHSFVRRDLLQRHI 59

>Scas_697.35
          Length = 839

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 33/51 (64%), Gaps = 1/51 (1%)

Query: 826 KIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHL 876
           K Y C  C ++F+ G +L  H++ +H+GEKP+ C  C K+F R+ ++  HL
Sbjct: 541 KPYQCGYCGKRFTQGGNLRTHQR-LHTGEKPYECELCDKKFSRKGNLAAHL 590

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 31/60 (51%), Gaps = 1/60 (1%)

Query: 816 ENEVIMSDHGKIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQH 875
           E    + +  K + C  C+R F+   HL  H +S H G KP+ C  CGKRF +  ++  H
Sbjct: 503 EKPKTLHEGSKQHKCPYCHRLFAQSTHLEVHIRS-HLGYKPYQCGYCGKRFTQGGNLRTH 561

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 17/29 (58%)

Query: 848 KSVHSGEKPHSCPRCGKRFKRRDHVLQHL 876
           K++H G K H CP C + F +  H+  H+
Sbjct: 506 KTLHEGSKQHKCPYCHRLFAQSTHLEVHI 534

>Kwal_47.17888
          Length = 786

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 33/50 (66%), Gaps = 1/50 (2%)

Query: 826 KIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQH 875
           K + C  C ++F+ G +L  H + +H+GEKP+ C +CG+RF R+ ++  H
Sbjct: 529 KPFQCEYCGKRFTQGGNLRTHVR-LHTGEKPYECEKCGRRFSRKGNLAAH 577

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 30/59 (50%), Gaps = 5/59 (8%)

Query: 825 GKIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKR----RDHVLQHLNKK 879
            K + C  C++ F+   HL  H +S H G KP  C  CGKRF +    R HV  H  +K
Sbjct: 500 AKQHECPYCHKCFTQSTHLEVHVRS-HIGYKPFQCEYCGKRFTQGGNLRTHVRLHTGEK 557

 Score = 30.0 bits (66), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 27/55 (49%), Gaps = 3/55 (5%)

Query: 826 KIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCP--RCGKRFKRRDHVLQHLNK 878
           K Y C +C R+FS   +L  H+ + H   KP  C    C K F +  ++  H N+
Sbjct: 557 KPYECEKCGRRFSRKGNLAAHRLT-HENLKPFHCKLDGCNKSFTQLGNMKAHQNR 610

>Scas_575.3
          Length = 455

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 32/55 (58%), Gaps = 3/55 (5%)

Query: 823 DHGKIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSC--PRCGKRFKRRDHVLQH 875
           D  + ++C  C R F    H TRH ++ H+GEKPH C  P C K+F R D + +H
Sbjct: 63  DAPRPHVCPICQRAFHRLEHQTRHMRT-HTGEKPHECDFPGCVKKFSRSDELTRH 116

>YGR067C (YGR067C) [2029] chr7 complement(622404..624788) Protein
           with two tandem zinc finger domains [2385 bp, 794 aa]
          Length = 794

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 31/56 (55%), Gaps = 1/56 (1%)

Query: 821 MSDHGKIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHL 876
           M+   K YIC  C + FS   H  RH++S H+G KP  C  C   F RRD + +H+
Sbjct: 1   MAAGQKKYICSFCLKPFSRSEHKIRHERS-HAGVKPFQCQVCKHSFVRRDLLQRHI 55

>YPL038W (MET31) [5401] chr16 (480530..481063) Zinc-finger protein
           involved in transcriptional regulation of methionine
           metabolism, has two tandem C2H2-type zinc fingers [534
           bp, 177 aa]
          Length = 177

 Score = 48.1 bits (113), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 23/53 (43%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 825 GKIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHLN 877
            ++Y C +C  +FS    L RH+K VHS   PH C  CGK F R+D + +H N
Sbjct: 92  AQLYSCAKCQLKFSRSSDLRRHEK-VHSLVLPHICSNCGKGFARKDALKRHSN 143

>Scas_712.42*
          Length = 290

 Score = 49.3 bits (116), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 29/51 (56%), Gaps = 3/51 (5%)

Query: 828 YICRECNRQFSSGHHLTRHKKSVHSGEKPHSC--PRCGKRFKRRDHVLQHL 876
           + C  C R F    H  RH ++ H+GEKPH C  P CGK F R D + +HL
Sbjct: 18  FRCETCARGFHRLEHKKRHMRT-HTGEKPHHCAFPGCGKGFSRSDELKRHL 67

>Scas_683.25
          Length = 879

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 29/51 (56%), Gaps = 1/51 (1%)

Query: 826 KIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHL 876
           K +IC  C + FS   H  RH++S H+G KP+ C  C   F R D  L+H+
Sbjct: 13  KRFICSFCAKGFSRAEHKIRHERS-HTGLKPYKCKVCTHCFVRSDLALRHI 62

>Scas_719.68
          Length = 1350

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 36/63 (57%), Gaps = 5/63 (7%)

Query: 816 ENEVIMSDHGKIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQH 875
           ++  I +D  + ++C  C R      HL RH++S H+ EKP  C  CG+ F RRD VL++
Sbjct: 29  KSRTIKTDKPRPFLCPICTRT----EHLKRHQRS-HTREKPFVCVFCGRCFARRDLVLRY 83

Query: 876 LNK 878
             K
Sbjct: 84  QTK 86

>YGL209W (MIG2) [1787] chr7 (95860..97008) Zinc-finger protein
           involved in glucose repression of SUC2, contains two
           tandem zinc-fingers [1149 bp, 382 aa]
          Length = 382

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 30/51 (58%), Gaps = 3/51 (5%)

Query: 828 YICRECNRQFSSGHHLTRHKKSVHSGEKPHSC--PRCGKRFKRRDHVLQHL 876
           + C  C+R F    H  RH ++ H+GEKPH C  P CGK F R D + +H+
Sbjct: 17  FRCDTCHRGFHRLEHKKRHLRT-HTGEKPHHCAFPGCGKSFSRSDELKRHM 66

>AGL207W [4105] [Homologous to NOHBY] complement(310750..311583)
           [834 bp, 277 aa]
          Length = 277

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 32/50 (64%), Gaps = 3/50 (6%)

Query: 828 YICRECNRQFSSGHHLTRHKKSVHSGEKPHSCP--RCGKRFKRRDHVLQH 875
           Y+C EC + F+    L  H+ ++H+G++P +CP   CGK F  R ++L+H
Sbjct: 183 YVCTECGKGFARASSLRTHR-NIHTGDRPFTCPFKNCGKSFNARSNMLRH 231

>KLLA0B00605g complement(46736..47455) some similarities with
           sp|P39943 Saccharomyces cerevisiae YER028c, hypothetical
           start
          Length = 239

 Score = 46.6 bits (109), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 31/51 (60%), Gaps = 3/51 (5%)

Query: 828 YICRECNRQFSSGHHLTRHKKSVHSGEKPHSC--PRCGKRFKRRDHVLQHL 876
           Y+C  C  +F    H TRH ++ H+GEKP +C  P C KRF R D + +H+
Sbjct: 12  YLCEICGNRFHRLEHKTRHIRT-HTGEKPFACTVPGCPKRFSRNDELKRHI 61

>Scas_378.1
          Length = 208

 Score = 46.2 bits (108), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 34/60 (56%), Gaps = 1/60 (1%)

Query: 820 IMSDHGKIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHLNKK 879
           +  D   +Y C  C + F     L RH  + HS ++ +SCP+C  + KR+D++LQHL  K
Sbjct: 76  VERDTPSVYQCHMCVKSFRRHSWLKRHLLA-HSSQRHYSCPKCVSKHKRKDNLLQHLKLK 134

>YMR070W (MOT3) [4029] chr13 (409153..410625) Transcription factor
           that represses a variety of genes, including ANB1, FUS1,
           and ergosterol biosynthetic genes ERG2, ERG6, and ERG9,
           and activates other genes, including CYC1, LEU2, and
           SUC2, contains two tandem C2H2-type zinc fingers [1473
           bp, 490 aa]
          Length = 490

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 33/58 (56%), Gaps = 1/58 (1%)

Query: 822 SDHGKIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHLNKK 879
           SDH  I+ C+ C + F     L RH  S HS ++   CP C  R KR+D++LQH+  K
Sbjct: 340 SDHKYIHQCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMKLK 396

>Kwal_26.8021
          Length = 507

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 29/52 (55%), Gaps = 1/52 (1%)

Query: 828 YICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHLNKK 879
           Y C  C++ F       RH  S HS  KP+SCP C  R KRRD++ QH+  K
Sbjct: 389 YRCSMCDKSFKRRSWHKRHLLS-HSSFKPYSCPWCQSRHKRRDNLFQHMKTK 439

>Kwal_47.19045
          Length = 266

 Score = 45.8 bits (107), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 30/52 (57%), Gaps = 3/52 (5%)

Query: 828 YICRECNRQFSSGHHLTRHKKSVHSGEKPHSC--PRCGKRFKRRDHVLQHLN 877
           + C  C + F    H  RH ++ H+GEKPHSC  P C KRF R D + +H+ 
Sbjct: 14  FKCDMCGKGFHRLEHKRRHIRT-HTGEKPHSCNFPGCVKRFSRSDELKRHVR 64

>KLLA0B03454g complement(314015..315433) some similarities with
           sp|P39933 Saccharomyces cerevisiae YPR186c TFC2 TFIIIA
           (transcription initiation factor), hypothetical start
          Length = 472

 Score = 46.6 bits (109), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 32/54 (59%), Gaps = 2/54 (3%)

Query: 825 GKIYIC--RECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHL 876
            K+Y C  + CN+ F+    LT H+ +VH G KP  C  CGK F ++ H+ +H+
Sbjct: 103 SKVYFCDYQGCNKSFTRPSLLTEHQLTVHHGIKPFKCDTCGKEFAKKSHLNRHM 156

 Score = 37.0 bits (84), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 824 HG-KIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQH 875
           HG K + C  C ++F+   HL RH  S H+ +KP +C  CGK    R  + +H
Sbjct: 132 HGIKPFKCDTCGKEFAKKSHLNRHMFS-HTDDKPFTCSICGKGVTTRQQLKRH 183

 Score = 30.0 bits (66), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 29/60 (48%), Gaps = 8/60 (13%)

Query: 824 HGKIYIC--RECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKR----RDHVLQHLN 877
           H K + C    CN  F     L  H  SVH  EK  +CP C K F+R    ++H+ +H N
Sbjct: 187 HTKSFHCSYEGCNESFYKHPQLRSHILSVH--EKKLTCPHCNKTFQRPYRLKNHIDKHHN 244

>Scas_693.31
          Length = 635

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 33/53 (62%), Gaps = 5/53 (9%)

Query: 828 YICR--ECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHLNK 878
           Y C    C++ F   H L RHKK VHS EK ++CP CGK+F R D ++ H ++
Sbjct: 519 YACDFPNCDKAFVRNHDLVRHKK-VHS-EKSYACP-CGKKFNREDALIVHRSR 568

>YPL230W (YPL230W) [5219] chr16 (115312..116487) Putative
           transcription factor that contains two tandem C2H2-type
           zinc fingers [1176 bp, 391 aa]
          Length = 391

 Score = 46.2 bits (108), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 20/43 (46%), Positives = 25/43 (58%), Gaps = 1/43 (2%)

Query: 833 CNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQH 875
           C   F+   HL RH +  H+GEKP  CP C K F R D++ QH
Sbjct: 49  CTMSFTRAEHLARHIRK-HTGEKPFQCPACLKFFSRVDNLKQH 90

>AGL071C [4240] [Homologous to ScYMR070W (MOT3) - SH]
           (574723..575913) [1191 bp, 396 aa]
          Length = 396

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 30/53 (56%), Gaps = 1/53 (1%)

Query: 827 IYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHLNKK 879
           I+ C  C + F     L RH  S HS  KP+SCP C  R KR+D++ QHL  K
Sbjct: 184 IHKCHFCEKAFKRKSWLKRHLLS-HSTMKPYSCPWCHSRHKRKDNLSQHLKLK 235

>CAGL0L03916g complement(448955..450883) weakly similar to sp|P41696
           Saccharomyces cerevisiae YOR113w AZF1 asparagine-rich
           zinc finger protein, hypothetical start
          Length = 642

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 30/50 (60%), Gaps = 1/50 (2%)

Query: 826 KIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQH 875
           K + C  C ++F+   +L  H++ +H+GE+P  C +C K F RR ++  H
Sbjct: 506 KPFECEFCGKRFTQAGNLRTHRR-LHTGERPFKCDKCDKTFARRGNLTAH 554

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 26/48 (54%), Gaps = 1/48 (2%)

Query: 828 YICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQH 875
           Y C  C++ FS   HL  H K+ H G KP  C  CGKRF +  ++  H
Sbjct: 480 YQCAYCSKMFSQSTHLDVHIKA-HMGYKPFECEFCGKRFTQAGNLRTH 526

>Scas_687.33
          Length = 288

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 29/51 (56%), Gaps = 3/51 (5%)

Query: 828 YICRECNRQFSSGHHLTRHKKSVHSGEKPHSC--PRCGKRFKRRDHVLQHL 876
           + C  C+R F    H  RH ++ H+GEKPH C    CGK F R D + +H+
Sbjct: 17  FRCPICSRGFHRLEHKKRHVRT-HTGEKPHPCTFAHCGKSFSRGDELKRHI 66

>YDR253C (MET32) [1086] chr4 complement(963982..964557) Zinc-finger
           protein involved in transcriptional regulation of
           methionine metabolism, has two tandem C2H2-type zinc
           fingers [576 bp, 191 aa]
          Length = 191

 Score = 42.7 bits (99), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 31/50 (62%), Gaps = 1/50 (2%)

Query: 826 KIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQH 875
           K + C +C+ +FS    L RH+K+ H    P+ CP+CGK F R+D + +H
Sbjct: 96  KRFKCAKCSLEFSRSSDLRRHEKT-HFAILPNICPQCGKGFARKDALKRH 144

>CAGL0M06831g 695162..697099 weakly similar to sp|P53968
           Saccharomyces cerevisiae YNL027w CRZ1, hypothetical
           start
          Length = 645

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 828 YICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQH 875
           Y+C  C + FS  ++L  H ++ H+ EKP+ C  CGK F R+    +H
Sbjct: 521 YVCEVCGKVFSRPYNLKSHLRT-HTDEKPYQCSICGKAFARQHDKKRH 567

 Score = 38.9 bits (89), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 29/60 (48%), Gaps = 10/60 (16%)

Query: 826 KIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCP---------RCGKRFKRRDHVLQHL 876
           K Y C  C + F+  H   RH + +H+G+K + C           CGK+F R D + +H 
Sbjct: 547 KPYQCSICGKAFARQHDKKRH-EDLHTGKKRYVCGGKLKDGTFWGCGKKFARSDALGRHF 605

>YDR146C (SWI5) [991] chr4 complement(748607..750736) Transcription
           factor that controls cell cycle-specific transcription
           of HO, has three tandem C2H2-type zinc fingers [2130 bp,
           709 aa]
          Length = 709

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 29/46 (63%), Gaps = 3/46 (6%)

Query: 833 CNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHLNK 878
           C++ F   H L RHKKS    EK ++CP CGK+F R D ++ H ++
Sbjct: 587 CDKAFVRNHDLIRHKKSHQ--EKAYACP-CGKKFNREDALVVHRSR 629

>KLLA0E08679g 777005..778795 some similarities with sp|P53968
           Saccharomyces cerevisiae YNL027w CRZ1 calcineurin
           responsive zinc-finger, hypothetical start
          Length = 596

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 28/45 (62%), Gaps = 1/45 (2%)

Query: 824 HGKIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKR 868
           H  +Y C  C+++F+  ++L  H +S H+ E+P+ C  CGK F R
Sbjct: 465 HPAVYACDICDKKFTRPYNLKSHLRS-HTDERPYVCSVCGKAFAR 508

 Score = 39.3 bits (90), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 29/58 (50%), Gaps = 10/58 (17%)

Query: 828 YICRECNRQFSSGHHLTRHKKSVHSGEKPHSCP---------RCGKRFKRRDHVLQHL 876
           Y+C  C + F+  H   RH + +H+G++ + C           CGK+F R D + +H 
Sbjct: 497 YVCSVCGKAFARMHDKNRH-EDLHTGKRRYVCGGILKNGNSWGCGKKFARSDALGRHF 553

>CAGL0C02519g 253051..254007 weakly similar to sp|P39943
           Saccharomyces cerevisiae YER028c, hypothetical start
          Length = 318

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 28/50 (56%), Gaps = 3/50 (6%)

Query: 828 YICRECNRQFSSGHHLTRHKKSVHSGEKPHSC--PRCGKRFKRRDHVLQH 875
           + C  C+R F    H  RH ++ H+GEKPH C  P C K F R D + +H
Sbjct: 20  FRCEICSRGFHRLEHKKRHFRT-HTGEKPHKCKFPSCPKSFSRADELKRH 68

>Kwal_56.24206
          Length = 1502

 Score = 43.5 bits (101), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 44/93 (47%), Gaps = 12/93 (12%)

Query: 159 FYAVDENSSIFPYDLTLWNLNNLPDSINSSNR------------RLLTGQSKCIFPWHLD 206
           F  + ++    P  L+ WNLNN+  S NS  R            +L  G    +  W ++
Sbjct: 492 FPIISKSGDSLPGALSPWNLNNVATSENSMLRYLDADFGNHLDTKLDIGMLFSVKGWSIE 551

Query: 207 EQNKCSINYLHFGAPKQWYSIPSANTDQFLKIL 239
           +    SI+Y H G+ K WY IP  + ++F +++
Sbjct: 552 DNFLASIHYHHVGSSKLWYVIPPQDMEKFERLI 584

>CAGL0M01870g complement(219813..220760) some similarities with
           tr|Q12145 Saccharomyces cerevisiae YPR013c or tr|Q12531
           Saccharomyces cerevisiae YPR015c, hypothetical start
          Length = 315

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 38/70 (54%), Gaps = 4/70 (5%)

Query: 809 AHSSKF-GENEVIMSDHGKIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCP--RCGKR 865
           A   KF  + E+  +     +IC+ C ++F     L+ H  ++H+GEKP+ CP   C K 
Sbjct: 153 AFDEKFSAQAEINKTSEDTKFICKVCLKKFKRPSSLSTHM-NIHTGEKPYPCPFDNCTKS 211

Query: 866 FKRRDHVLQH 875
           F  + ++L+H
Sbjct: 212 FNAKSNMLRH 221

>Kwal_27.11460
          Length = 531

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 30/49 (61%), Gaps = 1/49 (2%)

Query: 827 IYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQH 875
           +Y C  C+++F+  ++L  H ++ H+ E+P SC  CGK F R+    +H
Sbjct: 412 VYACELCDKKFTRPYNLKSHLRT-HTDERPFSCAICGKAFARQHDRKRH 459

 Score = 37.0 bits (84), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 29/58 (50%), Gaps = 10/58 (17%)

Query: 828 YICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPR---------CGKRFKRRDHVLQHL 876
           + C  C + F+  H   RH+  +H+G+K ++C           CGK+F R D + +H 
Sbjct: 441 FSCAICGKAFARQHDRKRHE-DLHTGQKRYTCHGKLKDGTEWGCGKKFARSDALGRHF 497

>YER028C (MIG3) [1453] chr5 complement(210691..211875) Protein that
           contains two tandem C2H2-type zinc finger domains, has
           strong similarity to Mig2p, a Tup1p-dependent and
           glucose-dependent transcriptional repressor [1185 bp,
           394 aa]
          Length = 394

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 28/51 (54%), Gaps = 3/51 (5%)

Query: 828 YICRECNRQFSSGHHLTRHKKSVHSGEKPHSCP--RCGKRFKRRDHVLQHL 876
           + C  C+R F    H  RH ++ H+GEKPH C    C K F R D + +HL
Sbjct: 17  FRCEICSRGFHRLEHKKRHGRT-HTGEKPHKCTVQGCPKSFSRSDELKRHL 66

>KLLA0E18645g complement(1648263..1649558) some similarities with
           sp|P54785 Saccharomyces cerevisiae YMR070w HMS1
           high-copy suppressor of MOT1-SPT3 synthetic lethality
           singleton, hypothetical start
          Length = 431

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 27/52 (51%), Gaps = 1/52 (1%)

Query: 828 YICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHLNKK 879
           Y C  C +QF     L RH  S HS  K   CP C    KR+D++LQHL  K
Sbjct: 306 YQCHLCEKQFRRKSWLKRHLLS-HSNVKKFHCPWCSSTHKRKDNLLQHLKLK 356

>YMR182C (RGM1) [4137] chr13 complement(624531..625166)
           Transcriptional repressor, has strong similarity to
           mammalian EGR (early growth response) factor, contains
           two tandem C2H2-type zinc fingers [636 bp, 211 aa]
          Length = 211

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 26/44 (59%), Gaps = 1/44 (2%)

Query: 832 ECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQH 875
           +CN  F+   HL RH +  H+GEKP  C  C K F R D++ QH
Sbjct: 26  DCNMSFNRTEHLARHIRK-HTGEKPFQCNICLKFFSRIDNLRQH 68

>AGL197W [4115] [Homologous to ScYDR146C (SWI5) - SH; ScYLR131C
           (ACE2) - SH] complement(325717..328251) [2535 bp, 844
           aa]
          Length = 844

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 35/77 (45%), Gaps = 9/77 (11%)

Query: 802 NNGNNYQAHSSKFGENEVIMSDHGKIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPR 861
           N   N ++H     E+     DH        C + F   H L RHKK+    EK  +CP 
Sbjct: 686 NRRYNIRSHIQTHLEDRPFRCDH------EGCTKAFVRNHDLIRHKKT--HAEKTFTCP- 736

Query: 862 CGKRFKRRDHVLQHLNK 878
           CGK+F R D +L H  +
Sbjct: 737 CGKKFSREDALLTHRTR 753

>Kwal_14.2206
          Length = 254

 Score = 41.2 bits (95), Expect = 0.002,   Method: Composition-based stats.
 Identities = 18/48 (37%), Positives = 30/48 (62%), Gaps = 3/48 (6%)

Query: 830 CRECNRQFSSGHHLTRHKKSVHSGEKPHSC--PRCGKRFKRRDHVLQH 875
           CR C + FS    L+ H   +H+G +P++C  P CGKRF  + ++++H
Sbjct: 196 CRICGKTFSRPSGLSTHAL-IHTGHQPYACDAPNCGKRFNVKSNLMRH 242

>ADL198W [1543] [Homologous to ScYNL027W (CRZ1) - SH]
           complement(349070..350713) [1644 bp, 547 aa]
          Length = 547

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 38/77 (49%), Gaps = 12/77 (15%)

Query: 810 HSSKFGENEVIMSDHG-----------KIYICRECNRQFSSGHHLTRHKKSVHSGEKPHS 858
           HS+   E E  ++  G            IY C  C+++F+  ++L  H ++ H+ E+P S
Sbjct: 397 HSAPLDEGETALNLSGNTRRKSLQKNPAIYSCNLCDKKFTRPYNLKSHLRT-HTDERPFS 455

Query: 859 CPRCGKRFKRRDHVLQH 875
           C  CGK F R+    +H
Sbjct: 456 CSVCGKAFARQHDRKRH 472

>KLLA0D16456g complement(1387846..1390410) weakly similar to
           sp|P21192 Saccharomyces cerevisiae YLR131c ACE2
           metallothionein expression activator, hypothetical start
          Length = 854

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 27/47 (57%), Gaps = 2/47 (4%)

Query: 833 CNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHLNKK 879
           C + F   H L RHKKS    EK +SC  CGK+F   D +++H  +K
Sbjct: 730 CQKAFVRNHDLLRHKKS--HLEKGYSCAGCGKKFHSEDSLVKHQERK 774

>KLLA0F11682g complement(1068992..1070116) some similarities with
           sgd|S0006219 Saccharomyces cerevisiae YPR015c,
           hypothetical start
          Length = 374

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 31/50 (62%), Gaps = 3/50 (6%)

Query: 828 YICRECNRQFSSGHHLTRHKKSVHSGEKPHSC--PRCGKRFKRRDHVLQH 875
           Y C EC + F+    L+ H  ++H+G+KP+ C  P C K+F  + ++L+H
Sbjct: 304 YRCAECGKAFARPSSLSTHM-NIHTGDKPYKCLYPNCYKQFNAKSNMLRH 352

>Scas_568.5
          Length = 199

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 28/52 (53%), Gaps = 1/52 (1%)

Query: 826 KIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHLN 877
           K Y C +C   F     L RH+K+ H    PH C +CGK F R+D + +H N
Sbjct: 116 KRYPCSKCELIFLRSSDLRRHEKA-HLLVLPHICSQCGKGFARKDALKRHFN 166

>Kwal_23.5400
          Length = 429

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 27/44 (61%)

Query: 833 CNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHL 876
           C++ FS    LT H++ VH G KP  C  C ++F R+ H+ +H+
Sbjct: 57  CSKAFSRPSQLTEHQEVVHQGIKPFQCTVCARQFSRKTHLERHM 100

 Score = 38.9 bits (89), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 33/64 (51%), Gaps = 1/64 (1%)

Query: 812 SKFGENEVIMSDHGKIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDH 871
           S+  E++ ++    K + C  C RQFS   HL RH  S HS +KP  C  CGK    +  
Sbjct: 65  SQLTEHQEVVHQGIKPFQCTVCARQFSRKTHLERHMFS-HSEDKPFKCSYCGKGVTTKQQ 123

Query: 872 VLQH 875
           + +H
Sbjct: 124 LRRH 127

>Kwal_56.23925
          Length = 745

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 30/53 (56%), Gaps = 5/53 (9%)

Query: 828 YIC--RECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHLNK 878
           Y C    C++ F   H L RHKK+    EK + CP CGK+F R D +L H ++
Sbjct: 615 YFCDFEGCHKAFVRNHDLIRHKKT--HAEKCYVCP-CGKKFVREDALLVHRSR 664

>Scas_720.33
          Length = 316

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 30/53 (56%), Gaps = 4/53 (7%)

Query: 826 KIYIC---RECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQH 875
           K + C   ++C+  F+   HL RH +  H+GEKP  C  C + F R D++ QH
Sbjct: 13  KTFACQGYKDCHMTFTREEHLARHIRK-HTGEKPFQCYICFRFFSRMDNLKQH 64

>CAGL0J05060g 478650..480791 similar to sp|P47043 Saccharomyces
           cerevisiae YJL056c ZAP1 metalloregulatory protein,
           hypothetical start
          Length = 713

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 27/41 (65%), Gaps = 1/41 (2%)

Query: 826 KIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRF 866
           K Y C +C + FS+   L +HK+ VHSGEKP+ C  C KRF
Sbjct: 595 KPYQCPQCQKCFSTEDTLNQHKR-VHSGEKPYECHICHKRF 634

 Score = 39.3 bits (90), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 27/50 (54%), Gaps = 3/50 (6%)

Query: 828 YICR--ECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQH 875
           Y C    CN+ FS    L RH K VHS  KP+ CP+C K F   D + QH
Sbjct: 567 YTCEWEGCNKTFSQRQKLVRHLK-VHSKYKPYQCPQCQKCFSTEDTLNQH 615

 Score = 33.9 bits (76), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 30/51 (58%), Gaps = 1/51 (1%)

Query: 826 KIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHL 876
           K Y C  C+++F+  + L  H ++ H+GEKP  C  CG+ F    ++ +H+
Sbjct: 623 KPYECHICHKRFAISNSLKIHIRT-HTGEKPLKCKVCGRCFNESSNLSKHM 672

>YJL056C (ZAP1) [2855] chr10 complement(330347..332989)
           Zinc-responsive transcriptional activator, regulates
           genes involved in zinc uptake, has eight C2H2-type zinc
           fingers [2643 bp, 880 aa]
          Length = 880

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/41 (48%), Positives = 26/41 (63%), Gaps = 1/41 (2%)

Query: 826 KIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRF 866
           K Y C+ C R FSS   L +H ++ HSGEKP+ C  C K+F
Sbjct: 766 KPYKCKTCKRCFSSEETLVQHTRT-HSGEKPYKCHICNKKF 805

 Score = 40.0 bits (92), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 30/51 (58%), Gaps = 1/51 (1%)

Query: 826 KIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHL 876
           K Y C  CN++F+    L  H ++ H+GEKP  C  CGKRF    ++ +H+
Sbjct: 794 KPYKCHICNKKFAISSSLKIHIRT-HTGEKPLQCKICGKRFNESSNLSKHI 843

 Score = 33.9 bits (76), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 30/61 (49%), Gaps = 4/61 (6%)

Query: 818 EVIMSDHGKI-YIC--RECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQ 874
           E +    GK  Y C   +C+R F     L RH K VHS  KP+ C  C + F   + ++Q
Sbjct: 727 EAVHLTRGKSEYQCLWHDCHRTFPQRQKLIRHLK-VHSKYKPYKCKTCKRCFSSEETLVQ 785

Query: 875 H 875
           H
Sbjct: 786 H 786

>AEL174W [2332] [Homologous to ScYJL056C (ZAP1) - SH]
           complement(310950..312935) [1986 bp, 661 aa]
          Length = 661

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%), Gaps = 1/49 (2%)

Query: 828 YICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHL 876
           + C  C +QFS+   L  H ++ H+GEKP SC  CGKRF    ++ +H+
Sbjct: 572 FHCHYCRKQFSTSSSLRVHIRT-HTGEKPLSCTVCGKRFNESSNLSKHM 619

 Score = 31.6 bits (70), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 28/54 (51%), Gaps = 5/54 (9%)

Query: 830 CRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKR----RDHVLQHLNKK 879
           C  C + FS+   L +H ++ HSGE+P  C  C K+F      R H+  H  +K
Sbjct: 546 CPHCPKTFSTDDILAQHIRT-HSGERPFHCHYCRKQFSTSSSLRVHIRTHTGEK 598

>CAGL0E06116g complement(604708..606549) some similarities with
           tr|Q12132 Saccharomyces cerevisiae YPL230w USV1,
           hypothetical start
          Length = 613

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/43 (46%), Positives = 24/43 (55%), Gaps = 1/43 (2%)

Query: 833 CNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQH 875
           C   FS   HL RH +  H+GEKP  C  C K F R D++ QH
Sbjct: 33  CEMSFSRAEHLARHIRR-HTGEKPFKCDICLKYFSRIDNLKQH 74

>Sklu_2389.2 YJL056C, Contig c2389 3525-5828
          Length = 767

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 26/44 (59%), Gaps = 1/44 (2%)

Query: 833 CNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHL 876
           C++ F+    L RH K VHSG KP  CP C K+F   D + QH+
Sbjct: 635 CSKSFTQRQKLLRHLK-VHSGYKPFKCPHCTKKFSTEDILQQHI 677

 Score = 39.7 bits (91), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 37/73 (50%), Gaps = 7/73 (9%)

Query: 810 HSSKFGENEVIMSDHGKI------YICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCG 863
           H +K    E I+  H +       + C  C +QF++   L  H ++ H+GEKP  C  CG
Sbjct: 662 HCTKKFSTEDILQQHIRTHSGERPFKCTYCTKQFATSSSLRIHIRT-HTGEKPLKCKICG 720

Query: 864 KRFKRRDHVLQHL 876
           KRF    ++ +H+
Sbjct: 721 KRFNESSNLSKHM 733

>CAGL0K03003g 276756..278699 weakly similar to sp|P54785
           Saccharomyces cerevisiae YMR070w MOT3, hypothetical
           start
          Length = 647

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%)

Query: 830 CRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHLNKK 879
           C  C + F     L RH  S HS ++   CP C  R KRRD++LQH+  K
Sbjct: 536 CHLCPKLFKRKSWLKRHLLS-HSQQRHFLCPWCNSRHKRRDNLLQHMKLK 584

>Scas_636.14d
          Length = 275

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 26/46 (56%), Gaps = 1/46 (2%)

Query: 830 CRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQH 875
           C  C + + +     +H K VH  E+ H C  C + FKR+DH+++H
Sbjct: 217 CPHCQKTYRTEAQQKKHLKDVHV-ERKHMCLFCSRWFKRKDHMIKH 261

>Scas_717.60d
          Length = 167

 Score = 38.9 bits (89), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 31/58 (53%), Gaps = 2/58 (3%)

Query: 818 EVIMSDHGKIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQH 875
           E++ S+  +++ C+EC++ F +   L +H K  HS         CGK FKR+D    H
Sbjct: 91  EILTSN--ELFNCKECSKAFVTSQKLKKHTKDAHSKRMFPCEYNCGKAFKRKDQRKSH 146

>KLLA0F20636g complement(1914452..1915309) some similarities with
           sgd|S0006217 Saccharomyces cerevisiae YPR013c,
           hypothetical start
          Length = 285

 Score = 39.7 bits (91), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 31/54 (57%), Gaps = 3/54 (5%)

Query: 825 GKIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCP--RCGKRFKRRDHVLQHL 876
           GK  IC +C +QF+    L  H   VHSG+KP  C    C K+F  + ++++HL
Sbjct: 229 GKADICAQCGKQFTRPSALRTHML-VHSGDKPFECTWEGCNKKFNVKSNLIRHL 281

>CAGL0E01331g 124362..126431 weakly similar to sp|P08153
           Saccharomyces cerevisiae YDR146c transcription factor,
           hypothetical start
          Length = 689

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 27/46 (58%), Gaps = 3/46 (6%)

Query: 833 CNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHLNK 878
           C++ F   H L RHKK+    EK ++CP CGK F R D +  H ++
Sbjct: 593 CDKAFVRNHDLVRHKKTHQ--EKSYACP-CGKMFNREDALAVHRSR 635

>Scas_711.56
          Length = 832

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 26/41 (63%), Gaps = 1/41 (2%)

Query: 826 KIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRF 866
           K + C  C + FS+   L +H+++ HSGEKP  C  CGKRF
Sbjct: 724 KPFQCSICKKHFSNEETLKQHERT-HSGEKPFKCDICGKRF 763

 Score = 35.4 bits (80), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 23/43 (53%), Gaps = 1/43 (2%)

Query: 833 CNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQH 875
           C++ FS    L RH + VHSG KP  C  C K F   + + QH
Sbjct: 703 CHKIFSQRQRLVRHMR-VHSGYKPFQCSICKKHFSNEETLKQH 744

 Score = 34.3 bits (77), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 28/51 (54%), Gaps = 1/51 (1%)

Query: 826 KIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHL 876
           K + C  C ++F+    L  H ++ H+GEKP  C  CGK F    ++ +H+
Sbjct: 752 KPFKCDICGKRFAISSSLKIHIRT-HTGEKPLHCKICGKAFNESSNLSKHM 801

>Scas_627.17d
          Length = 275

 Score = 39.3 bits (90), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 26/46 (56%), Gaps = 1/46 (2%)

Query: 830 CRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQH 875
           C  C + + +     +H K VH  E+ H C  C + FKR+DH+++H
Sbjct: 217 CPHCQKTYLTEAQQKKHLKDVHV-ERKHMCLFCSRWFKRKDHMIKH 261

>CAGL0B02651g complement(253495..254064) weakly similar to sp|Q12041
           Saccharomyces cerevisiae YDR253c MET32 transcriptional
           regulator of sulfur amino acid metabolism, hypothetical
           start
          Length = 189

 Score = 38.5 bits (88), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 29/52 (55%)

Query: 826 KIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHLN 877
           KIY C  C   +     L +H+++ H  ++ + C  CGK+F R+D + +H +
Sbjct: 118 KIYPCNICGISYDKLTDLRKHERASHEPKQENVCMNCGKKFARKDALKRHFD 169

>Scas_631.7
          Length = 433

 Score = 39.3 bits (90), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 32/64 (50%), Gaps = 1/64 (1%)

Query: 812 SKFGENEVIMSDHGKIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDH 871
           S   E+++      K + C +C++QFS   HL RH  S HS  KP  C  CGK    R  
Sbjct: 72  SLLSEHQLTFHQGIKPFKCEQCDKQFSRKTHLERHLIS-HSDSKPFCCLHCGKGVTTRQQ 130

Query: 872 VLQH 875
           + +H
Sbjct: 131 LKRH 134

 Score = 37.4 bits (85), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 26/44 (59%)

Query: 833 CNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHL 876
           C + F+    L+ H+ + H G KP  C +C K+F R+ H+ +HL
Sbjct: 64  CTKAFTRPSLLSEHQLTFHQGIKPFKCEQCDKQFSRKTHLERHL 107

>YNL027W (CRZ1) [4559] chr14 (579578..581614) Calcineurin-dependent
           transcription factor, regulates gene expression
           downstream of calcineurin in response to multiple
           environmental signals, has two C2H2-type zinc finger
           domains [2037 bp, 678 aa]
          Length = 678

 Score = 39.7 bits (91), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 10/58 (17%)

Query: 828 YICRECNRQFSSGHHLTRHKKSVHSGEKPHSCP---------RCGKRFKRRDHVLQHL 876
           +IC  C + F+  H   RH + +H+G+K + C           CGK+F R D + +H 
Sbjct: 597 FICSICGKAFARQHDRKRH-EDLHTGKKRYVCGGKLKDGKPWGCGKKFARSDALGRHF 653

 Score = 37.4 bits (85), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 27/48 (56%), Gaps = 1/48 (2%)

Query: 828 YICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQH 875
           + C  C ++F+  ++L  H ++ H+ E+P  C  CGK F R+    +H
Sbjct: 569 FACDVCGKKFTRPYNLKSHLRT-HTNERPFICSICGKAFARQHDRKRH 615

>AGL246W [4066] [Homologous to ScYDR253C (MET32) - SH; ScYPL038W
           (MET31) - SH] complement(240857..241540) [684 bp, 227
           aa]
          Length = 227

 Score = 38.5 bits (88), Expect = 0.012,   Method: Composition-based stats.
 Identities = 20/54 (37%), Positives = 28/54 (51%), Gaps = 1/54 (1%)

Query: 823 DHGKIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHL 876
           + GK + C +C   F     L RH+K VH    P+ C  CGK F R+D + +H 
Sbjct: 142 NDGKRFHCTKCELVFRRSGDLRRHEK-VHLPILPNICSLCGKGFARKDALKRHF 194

>CAGL0G10021g complement(959154..960338) similar to sp|P39933
           Saccharomyces cerevisiae YPR186c TFC2, hypothetical
           start
          Length = 394

 Score = 39.3 bits (90), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 30/53 (56%), Gaps = 2/53 (3%)

Query: 826 KIYICR--ECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHL 876
           K Y+C    C++ F+    LT H+ +VH G KP  C +C   F ++ H+ +HL
Sbjct: 34  KTYLCEYDNCDKAFTRPSLLTEHQNTVHLGRKPWKCNQCESSFTKKIHLERHL 86

 Score = 31.6 bits (70), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 25/50 (50%), Gaps = 1/50 (2%)

Query: 826 KIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQH 875
           K + C +C   F+   HL RH  + H+ E+P  C  CGK    R  + +H
Sbjct: 65  KPWKCNQCESSFTKKIHLERHLYT-HTDERPFYCSFCGKGLITRQQLKRH 113

>KLLA0A04609g complement(411494..412765) some similarities with
           sgd|S0006217 Saccharomyces cerevisiae YPR013c,
           hypothetical start
          Length = 423

 Score = 38.9 bits (89), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 34/56 (60%), Gaps = 8/56 (14%)

Query: 826 KIYIC-RECNRQFSSGHHLTRHKKSVHSGEKPHSCPR--CGKRFKRRDHVLQHLNK 878
           + +IC R C+R  +   HL     S+H+G+KP+ CP+  C KRF  + ++L+H  +
Sbjct: 342 QCHICGRICSRPSTLQTHL-----SIHTGDKPYKCPKRNCHKRFNVKSNMLRHYKR 392

>KLLA0F01463g 140343..142688 some similarities with sp|P47043
           Saccharomyces cerevisiae YJL056c ZAP1 metalloregulatory
           protein involved in zinc-responsive transcriptional
           regulation, hypothetical start
          Length = 781

 Score = 39.3 bits (90), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 21/44 (47%), Positives = 24/44 (54%), Gaps = 1/44 (2%)

Query: 833 CNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHL 876
           CN+ F     L RH K VHS  KP  C  CGK F  +D + QHL
Sbjct: 669 CNKVFVQKQKLIRHLK-VHSKYKPFRCAECGKCFNTQDILTQHL 711

 Score = 38.5 bits (88), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 38/74 (51%), Gaps = 7/74 (9%)

Query: 809 AHSSKFGENEVIMSDHGKI------YICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRC 862
           A   K    + I++ H ++      + C  C + +S+   L  H ++ H+GEKP SCP C
Sbjct: 695 AECGKCFNTQDILTQHLRVHSGERPFKCHLCPKSYSTSSSLRIHIRT-HTGEKPLSCPIC 753

Query: 863 GKRFKRRDHVLQHL 876
            KRF    ++ +H+
Sbjct: 754 NKRFNESSNLAKHI 767

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 31/58 (53%), Gaps = 5/58 (8%)

Query: 826 KIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKR----RDHVLQHLNKK 879
           K + C EC + F++   LT+H + VHSGE+P  C  C K +      R H+  H  +K
Sbjct: 690 KPFRCAECGKCFNTQDILTQHLR-VHSGERPFKCHLCPKSYSTSSSLRIHIRTHTGEK 746

>KLLA0C16005g 1397274..1398269 some similarities with sgd|S0006151
           Saccharomyces cerevisiae YPL230w USV1, hypothetical
           start
          Length = 331

 Score = 38.9 bits (89), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 27/45 (60%), Gaps = 1/45 (2%)

Query: 832 ECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHL 876
           +C  +F+   HL RH +  H+GE+P  C  C + F R D++ QH+
Sbjct: 27  DCRMEFTRQEHLARHIRK-HTGEQPFQCHLCLRFFSRLDNLKQHV 70

>Kwal_14.2543
          Length = 711

 Score = 38.9 bits (89), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 29/51 (56%), Gaps = 1/51 (1%)

Query: 826 KIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHL 876
           K Y C  C + F++   L  H ++ H+GEKP  C  CGKRF    ++ +H+
Sbjct: 632 KPYKCSHCGKGFATSSSLRIHIRT-HTGEKPLECKVCGKRFNESSNLSKHM 681

 Score = 37.0 bits (84), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 29/54 (53%), Gaps = 5/54 (9%)

Query: 830 CRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKR----RDHVLQHLNKK 879
           C  C + FS+   L +H ++ HSGEKP+ C  CGK F      R H+  H  +K
Sbjct: 608 CVHCLKTFSTQDILQQHMRT-HSGEKPYKCSHCGKGFATSSSLRIHIRTHTGEK 660

 Score = 30.0 bits (66), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 25/51 (49%), Gaps = 3/51 (5%)

Query: 828 YIC--RECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHL 876
           Y+C    C R  +    L RH + VH+  KP  C  C K F  +D + QH+
Sbjct: 576 YVCGWENCGRVITQRQKLLRHLR-VHTRYKPCKCVHCLKTFSTQDILQQHM 625

>AEL278W [2227] [Homologous to ScYPR186C (PZF1) - SH]
           complement(117043..118473) [1431 bp, 476 aa]
          Length = 476

 Score = 38.5 bits (88), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 26/50 (52%), Gaps = 1/50 (2%)

Query: 826 KIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQH 875
           + Y C +C R F+   HL RH  S HS  KP SC  CGK    R  + +H
Sbjct: 148 RAYQCEQCGRGFTKKSHLERHLFS-HSETKPFSCTVCGKGVTTRQQLRRH 196

 Score = 36.6 bits (83), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 14/44 (31%), Positives = 27/44 (61%)

Query: 833 CNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHL 876
           C + F+    LT H+++ H G + + C +CG+ F ++ H+ +HL
Sbjct: 126 CYKAFTRPSLLTEHQQTAHQGIRAYQCEQCGRGFTKKSHLERHL 169

>CAGL0M04323g complement(474158..476269) similar to sp|P21192
           Saccharomyces cerevisiae YLR131c ACE2 or sp|P08153
           Saccharomyces cerevisiae YDR146c SWI5, hypothetical
           start
          Length = 703

 Score = 38.5 bits (88), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 29/55 (52%), Gaps = 6/55 (10%)

Query: 826 KIYIC--RECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHLNK 878
           K Y C    C + F   H L RHKK   + +K  SCP CGK+F     +++H N+
Sbjct: 551 KPYKCDFEGCTKAFVRNHDLARHKK---THDKHFSCP-CGKKFSSEQSMMKHKNR 601

>YLR131C (ACE2) [3541] chr12 complement(404511..406823)
           Metallothionein expression activator with similarity to
           Swi5p, has three tandem C2H2-type zinc fingers [2313 bp,
           770 aa]
          Length = 770

 Score = 38.9 bits (89), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 20/43 (46%), Positives = 26/43 (60%), Gaps = 3/43 (6%)

Query: 833 CNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQH 875
           C + F   H L RHK S H+ +K + CP CGKRF R D ++ H
Sbjct: 640 CTKAFVRNHDLIRHKIS-HNAKK-YICP-CGKRFNREDALMVH 679

>CAGL0L12562g complement(1350878..1351549) similar to sp|Q12041
           Saccharomyces cerevisiae YDR253c MET32 or tr|Q03081
           Saccharomyces cerevisiae YPL038w MET31, hypothetical
           start
          Length = 223

 Score = 37.4 bits (85), Expect = 0.027,   Method: Composition-based stats.
 Identities = 16/48 (33%), Positives = 29/48 (60%), Gaps = 1/48 (2%)

Query: 828 YICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQH 875
           + C +C+ +F+    L RH+++ H    P+ C +CGK F R+D + +H
Sbjct: 142 HYCSQCSLKFNRSSDLRRHERA-HLLVLPYICTQCGKGFARKDALKRH 188

>Scas_695.2
          Length = 571

 Score = 38.1 bits (87), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 26/48 (54%), Gaps = 1/48 (2%)

Query: 828 YICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQH 875
           Y C  C++ F+  ++L  H ++ H+ E P  C  CGK F R+    +H
Sbjct: 452 YACELCDKTFTRPYNLKSHLRT-HTNEXPFVCNICGKAFARQHDRKRH 498

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 28/58 (48%), Gaps = 10/58 (17%)

Query: 828 YICRECNRQFSSGHHLTRHKKSVHSGEKPHSCP---------RCGKRFKRRDHVLQHL 876
           ++C  C + F+  H   RH + +H+G+K + C           C K+F R D + +H 
Sbjct: 480 FVCNICGKAFARQHDRKRH-EDLHTGKKRYVCGGVLKNGTPWGCHKKFARSDALGRHF 536

>AFL136W [3059] [Homologous to ScYPL230W - SH; ScYMR182C (RGM1) -
           SH] complement(178780..180009) [1230 bp, 409 aa]
          Length = 409

 Score = 38.1 bits (87), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 25/43 (58%), Gaps = 1/43 (2%)

Query: 833 CNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQH 875
           C+R F+   HL RH +   +GEKP  C  C + F R D++ QH
Sbjct: 28  CDRSFTRAEHLARHIRK-QTGEKPSQCEVCNRFFSRIDNLKQH 69

>YPR186C (PZF1) [5600] chr16 complement(909727..911016) RNA
           polymerase III transcription initiation factor TFIIIA,
           has nine C2H2-type zinc fingers [1290 bp, 429 aa]
          Length = 429

 Score = 38.1 bits (87), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 826 KIYICR--ECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHL 876
           K Y C    C++ F+    LT H+ SVH G +   C +C K F ++ H+ +HL
Sbjct: 47  KTYFCDYDGCDKAFTRPSILTEHQLSVHQGLRAFQCDKCAKSFVKKSHLERHL 99

 Score = 32.0 bits (71), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 30/64 (46%), Gaps = 1/64 (1%)

Query: 812 SKFGENEVIMSDHGKIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDH 871
           S   E+++ +    + + C +C + F    HL RH  + HS  KP  C  CGK    R  
Sbjct: 64  SILTEHQLSVHQGLRAFQCDKCAKSFVKKSHLERHLYT-HSDTKPFQCSYCGKGVTTRQQ 122

Query: 872 VLQH 875
           + +H
Sbjct: 123 LKRH 126

>Sklu_2126.5 YHL027W, Contig c2126 7763-9109
          Length = 448

 Score = 37.4 bits (85), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 24/44 (54%), Gaps = 1/44 (2%)

Query: 833 CNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHL 876
           CN +     H+T H + VH   KP  C  CGK+FKR   + +HL
Sbjct: 95  CNTKTVKRDHITSHLR-VHVPLKPFGCSTCGKKFKRPQDLKKHL 137

>CAGL0I02838g complement(248704..250671) similar to sp|P41696
           Saccharomyces cerevisiae YOR113w AZF1 asparagine-rich
           zinc finger protein, hypothetical start
          Length = 655

 Score = 37.4 bits (85), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 24/39 (61%), Gaps = 1/39 (2%)

Query: 826 KIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGK 864
           K + C+ C+R F+   HL  H +S H G+KP+ C  CGK
Sbjct: 612 KQFECQYCHRCFAQVTHLDVHIRS-HLGKKPYQCEYCGK 649

>Kwal_47.16577
          Length = 881

 Score = 37.7 bits (86), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 27/48 (56%), Gaps = 4/48 (8%)

Query: 833 CNRQFSSGHHLTRHKKSVHSGEKPHSC--PRCGKRFKRRDHVLQHLNK 878
           C++ FS   HL RHK + HS EK + C  P CG+ F R D   +H  +
Sbjct: 20  CSKSFSRSDHLGRHKAN-HSSEK-YKCEWPACGREFSRLDVKKKHFGR 65

>Scas_718.67
          Length = 473

 Score = 37.0 bits (84), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 33/79 (41%), Gaps = 18/79 (22%)

Query: 819 VIMSDHGKIYICR--------ECNRQFSSGHHLTRHKKSVHSGEKP-HSCPRC------- 862
           +  S   + Y CR         C  QFS  + LTRH+ ++H+ +K    C  C       
Sbjct: 370 ITESSTDETYTCRIINLTTNEPCCAQFSRSYDLTRHQNTIHASKKTVFRCSECIKSLGNE 429

Query: 863 --GKRFKRRDHVLQHLNKK 879
              K F R D + +H+  K
Sbjct: 430 GYDKTFSRLDALTRHIKSK 448

>CAGL0E04312g 412563..414629 some similarities with sp|Q00947
           Saccharomyces cerevisiae YDR463w STP1 or sp|P38704
           Saccharomyces cerevisiae YHR006w SPT2, hypothetical
           start
          Length = 688

 Score = 37.4 bits (85), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 32/71 (45%), Gaps = 13/71 (18%)

Query: 821 MSDHGKIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCP----------RC--GKRFKR 868
           + D  K ++C  C+ +F    +LTRH K  H+ EK + CP          RC     F R
Sbjct: 191 LDDDEKEFVCHYCDAKFRIRGYLTRHIKK-HAIEKAYHCPFYNGQEVPSKRCHNSGGFSR 249

Query: 869 RDHVLQHLNKK 879
           RD    H+  +
Sbjct: 250 RDTYKTHMKAR 260

>AFL127C [3068] [Homologous to ScYMR176W (ECM5) - SH]
           (193474..198039) [4566 bp, 1521 aa]
          Length = 1521

 Score = 37.4 bits (85), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 44/208 (21%), Positives = 70/208 (33%), Gaps = 62/208 (29%)

Query: 159 FYAVDENSSIFPYDLTLWNLNNLPDSINS------------SNRRLLTGQSKCIFPWHLD 206
           F  +  NS      L  WN+NN+P + NS            +  ++  G +     W L 
Sbjct: 527 FRTISRNSDNTAELLDPWNINNVPLAANSLLSYLDIDYGCLTRPKMHVGMTFSTRGWSLG 586

Query: 207 EQNKCSINYLHFGAPKQWYSIPSANTDQFLKILSK-------EPSSNKENCPAF------ 253
           +Q   +I Y H G    WY I   + + F K++ +        P+   +  P F      
Sbjct: 587 DQYLPTIEYNHLGCSLLWYFIAPESQEAFEKLVEEINLGKRDHPTDELDVDPEFKKSEFY 646

Query: 254 -----------------IRHQN--------------------IITSPDFLRKNNIKFNRV 276
                            +R +N                    I   P+ L+K  IKF   
Sbjct: 647 NSYLETNMRNRLNDTHKLRSKNGSHMFGQAARGPKSYLLPNDIQIHPEELQKRGIKFYNA 706

Query: 277 VQFQHEFIITFPYCMYSGFNYGYNFGES 304
           +Q    FII +P    +    G++  ES
Sbjct: 707 IQEAKTFIIKYPRAYNTSIAAGFHVSES 734

>Scas_627.6
          Length = 1207

 Score = 37.4 bits (85), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 31/58 (53%), Gaps = 11/58 (18%)

Query: 828 YICR--ECNRQFSSGHHLTRHKKSVHSGEKPHSCP--------RCGKRFKRRDHVLQH 875
           YIC   +CN+ F+   HL+RHK + H  ++   CP         C K F R+D +++H
Sbjct: 42  YICPHPDCNKSFTRQEHLSRHKLN-HWPKEIFVCPFIFPNTNITCNKTFVRKDLLIRH 98

>Sklu_1527.1 YPL038W, Contig c1527 389-1006
          Length = 205

 Score = 36.2 bits (82), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 26/50 (52%), Gaps = 1/50 (2%)

Query: 826 KIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQH 875
           K Y C +C   F     L RH+++ H    P+ C  CGK F R+D + +H
Sbjct: 123 KKYQCDKCELVFRRSSDLRRHERA-HLPILPNICSLCGKGFARKDALKRH 171

>Kwal_47.18337
          Length = 536

 Score = 37.0 bits (84), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 40/89 (44%), Gaps = 13/89 (14%)

Query: 803 NGNNYQAHSSKFGENEVIMSDHGKIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCP-- 860
           N N+ +++ SK  + E       K ++C  CN +F    +LTRH K  H+ EK + CP  
Sbjct: 132 NFNSPESNGSKTEDEEKDAHKGQKRFVCHYCNAEFYIRGYLTRHIKK-HAVEKAYYCPFF 190

Query: 861 --------RCGKR--FKRRDHVLQHLNKK 879
                   RC     F RRD    HL  +
Sbjct: 191 NADAPKDARCHTTGGFSRRDTYKTHLRSR 219

>YDL020C (RPN4) [840] chr4 complement(415110..416705) Subunit of the
           regulatory particle of the proteasome, also binds DNA to
           act as a positive regulator of expression of many
           proteasome subunit genes, functions in RNA polymerase II
           transcription elongation [1596 bp, 531 aa]
          Length = 531

 Score = 36.6 bits (83), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 35/82 (42%), Gaps = 11/82 (13%)

Query: 809 AH-SSKFGENEVIMSDHGKIYICRECNRQFSSGHHLTRHKKSVHSGEK-PHSCPRC---- 862
           AH SS  G NE+       +     C  QFS  + LTRH+ ++H+  K    C  C    
Sbjct: 425 AHTSSSDGNNEIFTCQIMNLITNEPCGAQFSRSYDLTRHQNTIHAKRKIVFRCSECIKIL 484

Query: 863 -----GKRFKRRDHVLQHLNKK 879
                 K F R D + +H+  K
Sbjct: 485 GSEGYQKTFSRLDALTRHIKSK 506

>Kwal_27.10467
          Length = 302

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 28/50 (56%), Gaps = 3/50 (6%)

Query: 828 YICRECNRQFSSGHHLTRHKKSVHSGEKPHSCP--RCGKRFKRRDHVLQH 875
           Y C +C + F+    L  H  + H+G+KP+ CP   C K+F  R ++ +H
Sbjct: 198 YTCTKCGKVFNRPSSLATHNNT-HTGDKPYCCPFDNCDKQFNARSNMTRH 246

>Scas_721.56
          Length = 199

 Score = 35.4 bits (80), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 26/49 (53%), Gaps = 1/49 (2%)

Query: 828 YICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHL 876
           + C +C   F     L RH+K+ H    P+ C +CGK F R+D + ++ 
Sbjct: 115 FQCNKCELYFIRSSDLRRHEKT-HLSILPNICSQCGKGFARKDALKRYF 162

>Sklu_2436.9 YDR463W, Contig c2436 18516-20069
          Length = 517

 Score = 35.8 bits (81), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 29/64 (45%), Gaps = 13/64 (20%)

Query: 828 YICRECNRQFSSGHHLTRHKKSVHSGEKPHSCP----------RCGKR--FKRRDHVLQH 875
           Y+C  C+ +F    +LTRH K  H+ EK + CP          RC     F RRD    H
Sbjct: 162 YVCHYCDAEFRIRGYLTRHIKK-HAVEKAYHCPFFNSKLPPESRCHTTGGFSRRDTYKTH 220

Query: 876 LNKK 879
           L  +
Sbjct: 221 LKSR 224

>Scas_641.24
          Length = 532

 Score = 35.4 bits (80), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 29/64 (45%), Gaps = 13/64 (20%)

Query: 828 YICRECNRQFSSGHHLTRHKKSVHSGEKPHSCP----------RCGKR--FKRRDHVLQH 875
           +IC  C+ +F    +LTRH K  H+ EK + CP          RC     F RRD    H
Sbjct: 183 FICHYCDAKFRIRGYLTRHIKK-HAVEKAYHCPFFNSDILSESRCHNTGGFSRRDTYKTH 241

Query: 876 LNKK 879
           L  +
Sbjct: 242 LKAR 245

>YHR006W (STP2) [2292] chr8 (117808..119433) Transcription factor
           involved in regulating transcription of amino acid
           permease genes, functions redundantly with Stp1p, which
           is involved in tRNA splicing and branched-chain amino
           acid uptake [1626 bp, 541 aa]
          Length = 541

 Score = 35.4 bits (80), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 28/64 (43%), Gaps = 13/64 (20%)

Query: 828 YICRECNRQFSSGHHLTRHKKSVHSGEKPHSCP----------RC--GKRFKRRDHVLQH 875
           YIC  C+ +F    +LTRH K  H+  K + CP          RC     F RRD    H
Sbjct: 204 YICHYCDARFRIRGYLTRHIKK-HAKRKAYHCPFFDNSISQELRCHTSGGFSRRDTYKTH 262

Query: 876 LNKK 879
           L  +
Sbjct: 263 LKSR 266

>CAGL0L00583g 69547..70713 similar to tr|Q12132 Saccharomyces
           cerevisiae YPL230w USV1, hypothetical start
          Length = 388

 Score = 35.4 bits (80), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 22/39 (56%), Gaps = 1/39 (2%)

Query: 837 FSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQH 875
           F+   H  RH +  H+GEKP  C  C K F R D++ QH
Sbjct: 3   FTRAEHHARHIRK-HTGEKPFQCDICMKFFSRIDNLKQH 40

>KLLA0D11902g 1015273..1016142 some similarities with sp|Q12041
           Saccharomyces cerevisiae YDR253c MET32 transcriptional
           regulator of sulfur amino acid metabolism, hypothetical
           start
          Length = 289

 Score = 35.0 bits (79), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 31/63 (49%), Gaps = 3/63 (4%)

Query: 815 GENEVIMSDHGKIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQ 874
           G N   + D  K + C +C+  F     L RH++  H    P+ C  CGK F R+D + +
Sbjct: 193 GSNNADLDD--KRFPCEKCHMVFRRSSDLRRHERQ-HLPILPNICTLCGKGFARKDALKR 249

Query: 875 HLN 877
           H +
Sbjct: 250 HFD 252

>CAGL0E03762g complement(351003..352757) weakly similar to sp|P33400
           Saccharomyces cerevisiae YHL027w RIM101 meiotic
           regulatory protein, hypothetical start
          Length = 584

 Score = 35.4 bits (80), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 23/44 (52%), Gaps = 1/44 (2%)

Query: 833 CNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHL 876
           C  +     H+T H + VH   KP +C  C KRFKR   + +HL
Sbjct: 196 CTSKTEKRDHMTSHLR-VHVPLKPFACSTCSKRFKRPQDLKKHL 238

>KLLA0F10109g complement(939195..941066) weakly similar to sp|Q00947
           Saccharomyces cerevisiae YDR463w STP1 pre-tRNA splicing
           protein, transcription factor, start by similarity
          Length = 623

 Score = 35.4 bits (80), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 29/64 (45%), Gaps = 13/64 (20%)

Query: 828 YICRECNRQFSSGHHLTRHKKSVHSGEKPHSCP----------RCGKR--FKRRDHVLQH 875
           ++C  C+ +F    +LTRH K  H+ EK + CP          RC     F RRD    H
Sbjct: 242 FVCHYCDAEFKMRGYLTRHIKK-HAIEKAYHCPFWDASLPSEKRCHSTGGFSRRDSYKTH 300

Query: 876 LNKK 879
           L  +
Sbjct: 301 LRSR 304

>Kwal_27.11824
          Length = 199

 Score = 34.3 bits (77), Expect = 0.29,   Method: Composition-based stats.
 Identities = 20/62 (32%), Positives = 31/62 (50%), Gaps = 2/62 (3%)

Query: 817 NEVIMSDHG-KIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQH 875
           N  +  D G K + C +C   F     L RH+++ H    P+ C  CGK F R+D + +H
Sbjct: 107 NASVEDDAGAKKFPCAKCELVFRRSSDLRRHERA-HLPILPNICSLCGKGFARKDALKRH 165

Query: 876 LN 877
            +
Sbjct: 166 FD 167

>Scas_718.36d
          Length = 330

 Score = 34.7 bits (78), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 28/62 (45%), Gaps = 3/62 (4%)

Query: 816 ENEVIMSDHGKIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCP--RCGKRFKRRDHVL 873
           E E    D    Y C  C + F     L  H  ++ SG +P+ CP   C K F  + ++L
Sbjct: 227 EVETSAFDEKLGYFCDVCGKGFRRPSSLRTHS-NIRSGNRPYKCPYSNCTKSFNAKSNML 285

Query: 874 QH 875
           +H
Sbjct: 286 RH 287

>YDR463W (STP1) [1281] chr4 (1386804..1388363) Transcription factor
           involved in regulating transcription of amino acid
           permease genes and involved in pre-tRNA splicing of
           specific tRNA species, has three C2H2-type zinc fingers
           [1560 bp, 519 aa]
          Length = 519

 Score = 34.7 bits (78), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 28/64 (43%), Gaps = 13/64 (20%)

Query: 828 YICRECNRQFSSGHHLTRHKKSVHSGEKPHSCP----------RC--GKRFKRRDHVLQH 875
           +IC  C+  F    +LTRH K  H+ EK + CP          RC     F RRD    H
Sbjct: 160 FICHYCDATFRIRGYLTRHIKK-HAIEKAYHCPFFNSATPPDLRCHNSGGFSRRDTYKTH 218

Query: 876 LNKK 879
           L  +
Sbjct: 219 LKAR 222

>AFR461C [3653] [Homologous to ScYDR463W (STP1) - SH]
           (1269565..1271199) [1635 bp, 544 aa]
          Length = 544

 Score = 34.7 bits (78), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 29/64 (45%), Gaps = 13/64 (20%)

Query: 828 YICRECNRQFSSGHHLTRHKKSVHSGEKPHSCP----------RCGKR--FKRRDHVLQH 875
           ++C  C+ +F    +LTRH K  H+ EK + CP          RC     F RRD    H
Sbjct: 152 FVCHYCDAEFRIRGYLTRHIKK-HAVEKAYHCPFFNSHVPPETRCHTTGGFSRRDTYKTH 210

Query: 876 LNKK 879
           L  +
Sbjct: 211 LRSR 214

>YPR022C (YPR022C) [5456] chr16 complement(603906..607307) Predicted
           transcription factor with two tandem C2H2-type zinc
           fingers, contains Q/N-rich regions which may mediate
           prion-like aggregation [3402 bp, 1133 aa]
          Length = 1133

 Score = 34.7 bits (78), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 27/51 (52%), Gaps = 7/51 (13%)

Query: 832 ECNRQFSSGHHLTRHKKS-------VHSGEKPHSCPRCGKRFKRRDHVLQH 875
           ECN+ FS   HL+RHK +       V S   P +   C K F R+D +++H
Sbjct: 37  ECNKTFSRQEHLSRHKLNHWPKEIYVCSYVLPTTNAPCNKTFVRKDLLIRH 87

>CAGL0K01727g complement(152569..154068) similar to sp|Q03465
           Saccharomyces cerevisiae YDL020c, start by similarity
          Length = 499

 Score = 34.3 bits (77), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 27/57 (47%), Gaps = 10/57 (17%)

Query: 833 CNRQFSSGHHLTRHKKSVHSGEKP-HSCPRC---------GKRFKRRDHVLQHLNKK 879
           C  QFS  + LTRH+ ++H+ ++    C  C          K F R D + +H+  K
Sbjct: 418 CGAQFSRTYDLTRHQNTIHAKKRSIFRCSECIRALGDEGFQKTFSRLDALTRHIKAK 474

>Scas_660.12
          Length = 367

 Score = 33.9 bits (76), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 28/64 (43%), Gaps = 13/64 (20%)

Query: 828 YICRECNRQFSSGHHLTRHKKSVHSGEKPHSCP----------RC--GKRFKRRDHVLQH 875
           Y+C  C  +F    +LTRH K  H+ EK + CP          RC     F RRD    H
Sbjct: 96  YVCHYCQAKFRIKGYLTRHIKK-HAVEKAYHCPFFSTESPPELRCHNSGGFSRRDTYKTH 154

Query: 876 LNKK 879
           L  +
Sbjct: 155 LKAR 158

>YGL254W (FZF1) [1746] chr7 (22304..23203) Transcription factor
           involved in sulfite metabolism, has five C2H2-type zinc
           fingers [900 bp, 299 aa]
          Length = 299

 Score = 33.9 bits (76), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 28/54 (51%), Gaps = 3/54 (5%)

Query: 826 KIYICRE--CNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHLN 877
           K Y C E  C ++F    HL  HK + HS  KP +C  C KRF     + +HLN
Sbjct: 40  KPYHCDEPGCGKKFIRPCHLRVHKWT-HSQIKPKACTLCQKRFVTNQQLRRHLN 92

>Sklu_2289.1 YGL254W, Contig c2289 150-1025 reverse complement
          Length = 291

 Score = 33.5 bits (75), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 3/50 (6%)

Query: 828 YICRE--CNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQH 875
           ++C E  C + F    HL  HK S HS  KP +CP C K F     + +H
Sbjct: 38  FVCEEPGCGKGFLRASHLKVHKWS-HSQVKPLACPVCSKGFTTNQQLSRH 86

>Scas_604.4
          Length = 585

 Score = 33.9 bits (76), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 22/35 (62%), Gaps = 1/35 (2%)

Query: 842 HLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHL 876
           H+T H + VH   KP +C +C K+FKR   + +HL
Sbjct: 233 HITSHLR-VHVPLKPFACKKCTKKFKRPQDLKKHL 266

>Scas_713.11
          Length = 465

 Score = 33.1 bits (74), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 36/78 (46%), Gaps = 11/78 (14%)

Query: 812 SKFGENEVIMSDHGKIYICRECNRQFSSGHHLTRHKKSVHSGEK-PHSCPRC-------- 862
           SKF EN++       +     C+ QFS  + L RH+ ++H+ +K    C +C        
Sbjct: 363 SKF-ENDIYTCMMLDLITDAPCSAQFSRSYDLVRHQNTIHAKQKIVFHCLQCIKLFGERG 421

Query: 863 -GKRFKRRDHVLQHLNKK 879
             K F R D + +HL  K
Sbjct: 422 FSKTFSRLDALSRHLKSK 439

>YHL027W (RIM101) [2259] chr8 (51109..52986) Transcription factor
           involved in induction of IME1, IME2, DIT1, and DIT2
           transcription, has three C2H2-type zinc fingers [1878
           bp, 625 aa]
          Length = 625

 Score = 33.5 bits (75), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 23/45 (51%), Gaps = 1/45 (2%)

Query: 832 ECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHL 876
           +C  +     H+T H + VH   KP  C  C K+FKR   + +HL
Sbjct: 188 DCTTKTEKRDHITSHLR-VHVPLKPFGCSTCSKKFKRPQDLKKHL 231

>CAGL0H07557g 738086..739516 some similarities with sp|P32805
           Saccharomyces cerevisiae YGL254w FZF1, hypothetical
           start
          Length = 476

 Score = 33.1 bits (74), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 26/52 (50%), Gaps = 3/52 (5%)

Query: 828 YICRE--CNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHLN 877
           Y+C E  C ++F    HL  HK + H+  KP  C  C +RF     + +H N
Sbjct: 87  YVCDEPNCGKRFLRPCHLRVHKWT-HAQVKPLKCSYCERRFITNQQLKRHTN 137

>KLLA0A10373g complement(907244..907864) some similarities with
           ca|CA1157|CaPZF1 Candida albicans TFIIIA (transcription
           initiation factor) (by homology), hypothetical start
          Length = 206

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 30/60 (50%), Gaps = 5/60 (8%)

Query: 821 MSDHGKIYIC--RECNRQFSSGHHLTRHKKSVHSGEKPHSCPR--CGKRFKRRDHVLQHL 876
           M    K Y+C    C +++S    L +H +S H+ EKP  CP   C K F R  H+  H+
Sbjct: 1   MEKRPKRYVCPIESCGKKYSRPCLLRQHVRS-HTNEKPFHCPEPGCDKAFLRPSHLRVHM 59

>CAGL0F03179g 311261..312862 similar to sp|Q04080 Saccharomyces
           cerevisiae YDR434w, hypothetical start
          Length = 533

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 45/88 (51%), Gaps = 10/88 (11%)

Query: 632 SAPHNLSIVSPNPTYSPNPLSLYLTNSK-----NPLNSGLAPLSPSTSNIPF-LKRNNVV 685
           S+  NL+IV P+P +SPN L+    + +     +P NS + P     +   + LK+++V 
Sbjct: 275 SSSVNLAIVYPDPEFSPNGLNYIQGHERADDVLHPWNSFIVPQWGVVAINKYPLKKHSV- 333

Query: 686 TLNISREASKSPISSFVNDYRSPLGVSN 713
              IS+E  K  +  F ND    LG+ +
Sbjct: 334 ---ISKEYLKPIVYQFANDMAKLLGLVD 358

>KLLA0E00726g 80516..82069 gi|5531271|emb|CAB50896.1 Kluyveromyces
           lactis RIM101 homologue, start by similarity
          Length = 517

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 24/45 (53%), Gaps = 1/45 (2%)

Query: 832 ECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHL 876
           +C  +     H+T H + VH   KP +C  C K+FKR   + +HL
Sbjct: 153 DCQTKTVKRDHITSHLR-VHVQLKPFACSTCNKKFKRPQDLKKHL 196

>CAGL0I02816g complement(247817..248692) similar to sp|P41696
           Saccharomyces cerevisiae YOR113w AZF1 asparagine-rich
           zinc finger protein, hypothetical start
          Length = 291

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 11/24 (45%), Positives = 16/24 (66%)

Query: 852 SGEKPHSCPRCGKRFKRRDHVLQH 875
           +GEKP+ C  C KRF R+ ++  H
Sbjct: 6   TGEKPYECDICKKRFSRKGNLAAH 29

 Score = 30.0 bits (66), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 26/55 (47%), Gaps = 3/55 (5%)

Query: 826 KIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCP--RCGKRFKRRDHVLQHLNK 878
           K Y C  C ++FS   +L  HK + H   +P  C    C K F +  ++  H NK
Sbjct: 9   KPYECDICKKRFSRKGNLAAHKMT-HGKIRPFICKLDNCNKSFSQLGNMKSHQNK 62

>CAGL0K02343g 208645..212133 similar to tr|Q12139 Saccharomyces
           cerevisiae YPR022c, hypothetical start
          Length = 1162

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 32/73 (43%), Gaps = 13/73 (17%)

Query: 819 VIMSDHGKIYICRE--CNRQFSSGHHLTRHKKSVHSGE-------KPHSCPRCGKRFKRR 869
           V+  D    Y C    C++ FS   HL+RHK +    E        P S   CGK F RR
Sbjct: 36  VVGEDGQYRYKCPHPTCDKSFSRQEHLSRHKLNHWPKEIFKCHYVSPLSGQPCGKTFVRR 95

Query: 870 D----HVLQHLNK 878
           D    H  +H NK
Sbjct: 96  DLLNRHEKRHENK 108

>KLLA0A00803g 76350..79208 weakly similar to sp|P53067 Saccharomyces
           cerevisiae YGL241w KAP114 Member of the karyopherin-beta
           family, nuclear import, start by similarity
          Length = 952

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 22/88 (25%), Positives = 38/88 (43%), Gaps = 14/88 (15%)

Query: 246 NKENCPAFIRHQNIITSPDFLRKNNIKFNRVVQFQHEFIITFPYCMYSG----------- 294
           + + CP F++ + I+T P F   N      + Q   +F++    C  S            
Sbjct: 442 DDDACPTFVKSRTILTIPKFFENNMETLPEIKQLVQQFLVKTVNCTISAEDDFLLASLVI 501

Query: 295 -FNYGYNFGESIEFILD-QQAVVRKQPL 320
            F Y  +F E +  ILD Q +++ +Q L
Sbjct: 502 SFTYYTSFAE-LGSILDYQTSMILQQSL 528

>AFR190C [3382] [Homologous to ScYHL027W (RIM101) - SH]
           (783110..784408) [1299 bp, 432 aa]
          Length = 432

 Score = 32.0 bits (71), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 1/44 (2%)

Query: 833 CNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHL 876
           C  +     H+T H + VH   KP SC  C ++FKR   + +HL
Sbjct: 113 CTTKTVKRDHITSHLR-VHVPLKPFSCSTCSRKFKRPQDLKKHL 155

>Kwal_55.20634
          Length = 419

 Score = 31.6 bits (70), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 25/50 (50%), Gaps = 3/50 (6%)

Query: 830 CR--ECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHLN 877
           CR  +C  +     H+T H + VH   KP +C  C K FKR   + +HL 
Sbjct: 94  CRWGKCTAKTVKRDHITSHLR-VHVPLKPFACSTCTKTFKRPQDLKKHLK 142

>Scas_712.2
          Length = 327

 Score = 31.6 bits (70), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 25/52 (48%), Gaps = 3/52 (5%)

Query: 828 YIC--RECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHLN 877
           YIC    C ++F    HL  HK + HS  KP  C  C K F     + +HLN
Sbjct: 43  YICDVEGCGKRFMRPCHLKVHKWT-HSKVKPLKCAFCEKGFITNQQLKRHLN 93

>ADL042W [1699] [Homologous to ScYPR015C - SH]
           complement(615818..616663) [846 bp, 281 aa]
          Length = 281

 Score = 31.2 bits (69), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 28/52 (53%), Gaps = 3/52 (5%)

Query: 829 ICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPR--CGKRFKRRDHVLQHLNK 878
           +C  C + F     L  H   VH+ +KP++C    C KRF  + ++L+H+ K
Sbjct: 226 VCEICGKDFKRPSALRTHM-VVHNNDKPYNCEHRGCQKRFNVKSNMLRHMRK 276

>CAGL0K06413g 627811..628890 some similarities with sp|Q00947
           Saccharomyces cerevisiae YDR463w STP1, hypothetical
           start
          Length = 359

 Score = 31.2 bits (69), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 35/77 (45%), Gaps = 14/77 (18%)

Query: 816 ENEVIMSDHGKI-YICRECNRQFSSGHHLTRHKKSVHSGEKPHSCP----------RC-- 862
           E EV  + H +  ++C  C+ +F    +LTRH K  H+ +K + CP          RC  
Sbjct: 28  EEEVSKTRHEQEEFVCHYCDARFKIRGYLTRHIKK-HALQKAYYCPYYNEKAPPDLRCHN 86

Query: 863 GKRFKRRDHVLQHLNKK 879
              F RRD    H+  +
Sbjct: 87  NGGFSRRDTYKAHMKTR 103

>Kwal_26.9300
          Length = 304

 Score = 30.8 bits (68), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 11/24 (45%), Positives = 16/24 (66%)

Query: 855 KPHSCPRCGKRFKRRDHVLQHLNK 878
           KPH CP CG+ F R + +L+H  +
Sbjct: 171 KPHKCPVCGRGFTRHNDLLRHRKR 194

>Kwal_33.14227
          Length = 551

 Score = 31.2 bits (69), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 29/57 (50%), Gaps = 10/57 (17%)

Query: 833 CNRQFSSGHHLTRHKKSVH-SGEKPHSCPRC---------GKRFKRRDHVLQHLNKK 879
           C+++FS  + L RH+K++H S +K   C  C          K F R D + +H+  K
Sbjct: 471 CSKKFSRPYDLIRHQKTIHASKKKVFRCVFCIQQQGAEGYQKTFSRGDALSRHIKVK 527

>Sklu_2244.3 , Contig c2244 4100-4915 reverse complement
          Length = 271

 Score = 30.8 bits (68), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 3/50 (6%)

Query: 828 YICRECNRQFSSGHHLTRHKKSVHSGEKPHSC--PRCGKRFKRRDHVLQH 875
           Y C +C ++F     L  H   +H G  P  C  P C K+F  + ++L+H
Sbjct: 216 YCCPKCKKEFKRPSGLRTHM-VIHYGRNPFFCKWPNCSKKFNVKSNLLRH 264

>Sklu_2063.6 YLR201C, Contig c2063 5410-6174
          Length = 254

 Score = 30.4 bits (67), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 18/27 (66%)

Query: 102 QWKNLAESLDSRISQGDFNDKTLKENC 128
           QWK LA +LD ++ +  FN++ L  +C
Sbjct: 38  QWKILANALDEQVPKYGFNERALTSSC 64

>ADL040W [1701] [Homologous to ScYPR013C - SH]
           complement(618855..619847) [993 bp, 330 aa]
          Length = 330

 Score = 30.4 bits (67), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 26/50 (52%), Gaps = 3/50 (6%)

Query: 830 CRECNRQFSSGHHLTRHKKSVHSGEKPHSC--PRCGKRFKRRDHVLQHLN 877
           C  C R+ +    L  H   +H+GE P  C  P C KRF  R ++ +H+N
Sbjct: 260 CLVCGRRCTRPSTLKTHML-IHTGELPFQCSWPGCSKRFNVRSNMNRHVN 308

>CAGL0K04697g 458366..459913 some similarities with tr|Q07351
           Saccharomyces cerevisiae YDL048c STP4 or tr|Q05937
           Saccharomyces cerevisiae YLR375w STP3, hypothetical
           start
          Length = 515

 Score = 30.0 bits (66), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 15/59 (25%), Positives = 31/59 (52%), Gaps = 1/59 (1%)

Query: 818 EVIMSDHGKIYICRECNRQFSSGHHLTRHKKS-VHSGEKPHSCPRCGKRFKRRDHVLQH 875
           + +++D+ K    R+C        +L+ HK + + S ++PH C  C   F R + +++H
Sbjct: 311 KALLADYSKTKKKRQCPICHKYFANLSTHKSTHLTSQDRPHKCIICQSGFARNNDLIRH 369

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.314    0.131    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 27,515,858
Number of extensions: 1303127
Number of successful extensions: 4841
Number of sequences better than 10.0: 273
Number of HSP's gapped: 4749
Number of HSP's successfully gapped: 346
Length of query: 879
Length of database: 16,596,109
Length adjustment: 110
Effective length of query: 769
Effective length of database: 12,788,129
Effective search space: 9834071201
Effective search space used: 9834071201
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 66 (30.0 bits)