Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YDR093W (DNF2)1612158381620.0
YER166W (DNF1)1571157057430.0
Scas_576.81591150556190.0
CAGL0L11814g1576150756060.0
Scas_636.161554150755340.0
CAGL0G08085g1578151053400.0
KLLA0C17644g1576157151700.0
AGR120C1547155549670.0
KLLA0A04015g1343105716720.0
Kwal_26.70701315106016680.0
CAGL0G06270g1328106016670.0
YAL026C (DRS2)1355109416620.0
ADR350W1311105816010.0
YIL048W (NEO1)115110238574e-95
ADL079C11669558497e-94
CAGL0L00715g11448958406e-93
Scas_704.3811618838222e-90
Kwal_23.5789113310248202e-90
Sklu_2193.111438858203e-90
Kwal_56.234672802897271e-86
KLLA0C08393g11489297804e-85
Kwal_23.355615975627531e-80
KLLA0E01650g15505447503e-80
CAGL0H04477g16265567451e-79
YMR162C (DNF3)16565427148e-76
AFL191W15755677065e-75
Scas_669.316385856833e-72
Scas_505.410253965273e-54
Scas_89.12712903512e-36
Scas_665.3014393261592e-10
CAGL0M11308g14523241531e-09
Kwal_26.920714693261477e-09
KLLA0B08217g14393281441e-08
Kwal_47.1754712406411371e-07
YOR291W14723291361e-07
AFL011W12426421315e-07
AFR567W14493221315e-07
CAGL0I04312g9512231243e-06
YGL006W (PMC1)11731851201e-05
KLLA0A08910g12801821154e-05
KLLA0E14630g10826441092e-04
CAGL0A00517g11222261056e-04
AEL301W9572111020.001
CAGL0L01419g12143241010.001
KLLA0E22352g1206312970.005
AFR354C1210320930.013
KLLA0F20658g1082184930.013
KLLA0A03157g938217920.019
Kwal_23.31601100428910.027
Scas_707.48*741215890.039
YDR039C (ENA2)1091440880.057
YDR040C (ENA1)1091440870.067
YDR038C (ENA5)1091440860.093
Scas_297.180065850.10
YEL031W (SPF1)1215307850.11
YGL167C (PMR1)950225850.13
Scas_583.14*875314830.20
Scas_710.4190454830.21
AGL097C1096181830.23
CAGL0A00495g90254820.26
Scas_688.191354820.28
YPL036W (PMA2)94754810.35
YJL103C618128810.36
YGL008C (PMA1)91854800.41
CAGL0K12034g1087179790.55
Kwal_14.1498939211790.60
AGL085C90954780.80
Scas_704.24*769135761.2
Kwal_47.1752289954761.2
KLLA0A09031g89954761.3
CAGL0J01870g946209742.1
CAGL0I05786g68041706.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YDR093W
         (1583 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YDR093W (DNF2) [945] chr4 (631276..636114) Member of the haloaci...  3148   0.0  
YER166W (DNF1) [1594] chr5 (512739..517454) Member of the haloac...  2216   0.0  
Scas_576.8                                                           2169   0.0  
CAGL0L11814g 1262124..1266854 highly similar to sp|P32660 Saccha...  2164   0.0  
Scas_636.16                                                          2136   0.0  
CAGL0G08085g 763185..767921 highly similar to sp|Q12675 Saccharo...  2061   0.0  
KLLA0C17644g 1557138..1561868 similar to sp|P32660 Saccharomyces...  1996   0.0  
AGR120C [4431] [Homologous to ScYER166W (DNF1) - SH; ScYDR093W (...  1917   0.0  
KLLA0A04015g complement(355624..359655) similar to sp|P39524 Sac...   648   0.0  
Kwal_26.7070                                                          647   0.0  
CAGL0G06270g 598357..602343 highly similar to sp|P39524 Saccharo...   646   0.0  
YAL026C (DRS2) [42] chr1 complement(95633..99700) Membrane-spann...   644   0.0  
ADR350W [2091] [Homologous to ScYAL026C (DRS2) - SH] complement(...   621   0.0  
YIL048W (NEO1) [2619] chr9 (261436..264891) Member of the Drs2p-...   334   4e-95
ADL079C [1662] [Homologous to ScYIL048W (NEO1) - SH] (544854..54...   331   7e-94
CAGL0L00715g 86810..90244 highly similar to sp|P40527 Saccharomy...   328   6e-93
Scas_704.38                                                           321   2e-90
Kwal_23.5789                                                          320   2e-90
Sklu_2193.1 YIL048W, Contig c2193 334-3765 reverse complement         320   3e-90
Kwal_56.23467                                                         284   1e-86
KLLA0C08393g 734655..738101 highly similar to sp|P40527 Saccharo...   305   4e-85
Kwal_23.3556                                                          294   1e-80
KLLA0E01650g complement(155975..160627) similar to sp|Q12674 Sac...   293   3e-80
CAGL0H04477g 421857..426737 similar to sp|Q12674 Saccharomyces c...   291   1e-79
YMR162C (DNF3) [4117] chr13 complement(578950..583920) Member of...   279   8e-76
AFL191W [3004] [Homologous to ScYMR162C (DNF3) - SH] complement(...   276   5e-75
Scas_669.3                                                            267   3e-72
Scas_505.4                                                            207   3e-54
Scas_89.1                                                             139   2e-36
Scas_665.30                                                            66   2e-10
CAGL0M11308g 1110211..1114569 similar to sp|Q12697 Saccharomyces...    64   1e-09
Kwal_26.9207                                                           61   7e-09
KLLA0B08217g complement(724364..728683) similar to sp|Q12697 Sac...    60   1e-08
Kwal_47.17547                                                          57   1e-07
YOR291W (YOR291W) [5075] chr15 (861172..865590) Member of the ca...    57   1e-07
AFL011W [3182] [Homologous to ScYGL006W (PMC1) - SH] complement(...    55   5e-07
AFR567W [3759] [Homologous to ScYOR291W - SH] complement(1455295...    55   5e-07
CAGL0I04312g complement(382354..385209) highly similar to sp|P13...    52   3e-06
YGL006W (PMC1) [1966] chr7 (485923..489444) Vacuolar Ca2+-transp...    51   1e-05
KLLA0A08910g complement(779526..783368) similar to sp|P38929 Sac...    49   4e-05
KLLA0E14630g complement(1297636..1300884) similar to sp|Q01896 S...    47   2e-04
CAGL0A00517g 58830..62198 similar to sp|P38929 Saccharomyces cer...    45   6e-04
AEL301W [2204] [Homologous to ScYGL167C (PMR1) - SH] complement(...    44   0.001
CAGL0L01419g 156123..159767 highly similar to sp|P39986 Saccharo...    44   0.001
KLLA0E22352g 1984522..1988142 highly similar to sp|P39986 Saccha...    42   0.005
AFR354C [3546] [Homologous to ScYEL031W (SPF1) - SH] (1078275..1...    40   0.013
KLLA0F20658g 1919851..1923099 similar to sp|Q12691 Saccharomyces...    40   0.013
KLLA0A03157g complement(281313..284129) gi|3288523|emb|CAA04476....    40   0.019
Kwal_23.3160                                                           40   0.027
Scas_707.48*                                                           39   0.039
YDR039C (ENA2) [892] chr4 complement(531302..534577) Member of t...    39   0.057
YDR040C (ENA1) [893] chr4 complement(535187..538462) P-type ATPa...    38   0.067
YDR038C (ENA5) [891] chr4 complement(527417..530692) Member of t...    38   0.093
Scas_297.1                                                             37   0.10 
YEL031W (SPF1) [1394] chr5 (90258..93905) Putative Ca2+-transpor...    37   0.11 
YGL167C (PMR1) [1823] chr7 complement(187620..190472) Ca2+-trans...    37   0.13 
Scas_583.14*                                                           37   0.20 
Scas_710.41                                                            37   0.21 
AGL097C [4215] [Homologous to ScYDR039C (ENA2 ) - NSH] (520915.....    37   0.23 
CAGL0A00495g complement(55014..57722) highly similar to sp|P0503...    36   0.26 
Scas_688.1                                                             36   0.28 
YPL036W (PMA2) [5403] chr16 (482839..485682) H[+]-transporting P...    36   0.35 
YJL103C (YJL103C) [2812] chr10 complement(228942..230798) Protei...    36   0.36 
YGL008C (PMA1) [1965] chr7 complement(479913..482669) H+-transpo...    35   0.41 
CAGL0K12034g complement(1161299..1164562) highly similar to sp|P...    35   0.55 
Kwal_14.1498                                                           35   0.60 
AGL085C [4226] [Homologous to ScYGL008C (PMA1) - SH; ScYPL036W (...    35   0.80 
Scas_704.24*                                                           34   1.2  
Kwal_47.17522                                                          34   1.2  
KLLA0A09031g 787768..790467 gi|1346734|sp|P49380|PMA1_KLULA Kluy...    34   1.3  
CAGL0J01870g 181666..184506 highly similar to sp|P13586 Saccharo...    33   2.1  
CAGL0I05786g complement(547982..550024) some similarities with s...    32   6.9  

>YDR093W (DNF2) [945] chr4 (631276..636114) Member of the haloacid
            dehalogenase or epoxide hydrolase family, has low
            similarity to familial intrahepatic cholestasis 1 (human
            ATP8B1), which is an aminophospholipid ATPase transporter
            associated with familial intrahepatic cholestasis [4839
            bp, 1612 aa]
          Length = 1612

 Score = 3148 bits (8162), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1522/1583 (96%), Positives = 1522/1583 (96%)

Query: 1    MSSPSKPTSPFVDDIEHEXXXXXXXXXXXXPFDDSFQFEKPSSAHGNIEVAKTGGSVLKR 60
            MSSPSKPTSPFVDDIEHE            PFDDSFQFEKPSSAHGNIEVAKTGGSVLKR
Sbjct: 1    MSSPSKPTSPFVDDIEHESGSASNGLSSMSPFDDSFQFEKPSSAHGNIEVAKTGGSVLKR 60

Query: 61   QSKPMKDISTPDLSKVTFXXXXXXXXXXXXXXXXELNGKKTEIHEHENEVDDDLHSFQAT 120
            QSKPMKDISTPDLSKVTF                ELNGKKTEIHEHENEVDDDLHSFQAT
Sbjct: 61   QSKPMKDISTPDLSKVTFDGIDDYSNDNDINDDDELNGKKTEIHEHENEVDDDLHSFQAT 120

Query: 121  PMPNTGGFEDVELDNNEGSNNDSQADHKLKRVRFGTRRNKSGRIDINRSKTLKWAKKNFH 180
            PMPNTGGFEDVELDNNEGSNNDSQADHKLKRVRFGTRRNKSGRIDINRSKTLKWAKKNFH
Sbjct: 121  PMPNTGGFEDVELDNNEGSNNDSQADHKLKRVRFGTRRNKSGRIDINRSKTLKWAKKNFH 180

Query: 181  NAIDEFSTKEDSLENSALQNRSDELRTVYYNLPLPEDMLDEDGLPLAVYPRNKIRTTKYT 240
            NAIDEFSTKEDSLENSALQNRSDELRTVYYNLPLPEDMLDEDGLPLAVYPRNKIRTTKYT
Sbjct: 181  NAIDEFSTKEDSLENSALQNRSDELRTVYYNLPLPEDMLDEDGLPLAVYPRNKIRTTKYT 240

Query: 241  PLTFFPKNILFQFHNFANIYFLILLILGAFQIFGVTNPGFASVPLIVIVIITAIKDGIED 300
            PLTFFPKNILFQFHNFANIYFLILLILGAFQIFGVTNPGFASVPLIVIVIITAIKDGIED
Sbjct: 241  PLTFFPKNILFQFHNFANIYFLILLILGAFQIFGVTNPGFASVPLIVIVIITAIKDGIED 300

Query: 301  SRRTVLDLEVNNTRTHILSGVKNENVAVDNVSLWRRFKKANTRALIKIFEYFSENLTAAG 360
            SRRTVLDLEVNNTRTHILSGVKNENVAVDNVSLWRRFKKANTRALIKIFEYFSENLTAAG
Sbjct: 301  SRRTVLDLEVNNTRTHILSGVKNENVAVDNVSLWRRFKKANTRALIKIFEYFSENLTAAG 360

Query: 361  XXXXXXXXXXXXXXXXNSRSFGPRGSLDSIGSYRMSADFGRPSLDYENLNQTMSQANRYN 420
                            NSRSFGPRGSLDSIGSYRMSADFGRPSLDYENLNQTMSQANRYN
Sbjct: 361  REKKLQKKREELRRKRNSRSFGPRGSLDSIGSYRMSADFGRPSLDYENLNQTMSQANRYN 420

Query: 421  DGENLVDRTLQPNPECRFAKDYWKNVKVGDIVRVHNNDEIPADMILLSTSDVDGACYVET 480
            DGENLVDRTLQPNPECRFAKDYWKNVKVGDIVRVHNNDEIPADMILLSTSDVDGACYVET
Sbjct: 421  DGENLVDRTLQPNPECRFAKDYWKNVKVGDIVRVHNNDEIPADMILLSTSDVDGACYVET 480

Query: 481  KNLDGETNLKVRQSLKCSKIIKSSRDITRTKFWVESEGPHANLYSYQGNFKWQDTQNGNI 540
            KNLDGETNLKVRQSLKCSKIIKSSRDITRTKFWVESEGPHANLYSYQGNFKWQDTQNGNI
Sbjct: 481  KNLDGETNLKVRQSLKCSKIIKSSRDITRTKFWVESEGPHANLYSYQGNFKWQDTQNGNI 540

Query: 541  RNEPVNINNLLLRGCTLRNTKWAMGMVIFTGDDTKIMINAGVTPTKKSRISRELNFSVIL 600
            RNEPVNINNLLLRGCTLRNTKWAMGMVIFTGDDTKIMINAGVTPTKKSRISRELNFSVIL
Sbjct: 541  RNEPVNINNLLLRGCTLRNTKWAMGMVIFTGDDTKIMINAGVTPTKKSRISRELNFSVIL 600

Query: 601  NFVLLFILCFTAGIVNGVYYKQKPRSRDYFEFGTIGGSASTNGFVSFWVAVILYQSLVPI 660
            NFVLLFILCFTAGIVNGVYYKQKPRSRDYFEFGTIGGSASTNGFVSFWVAVILYQSLVPI
Sbjct: 601  NFVLLFILCFTAGIVNGVYYKQKPRSRDYFEFGTIGGSASTNGFVSFWVAVILYQSLVPI 660

Query: 661  SLYISVEIIKTAQAIFIYTDVLLYNAKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQN 720
            SLYISVEIIKTAQAIFIYTDVLLYNAKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQN
Sbjct: 661  SLYISVEIIKTAQAIFIYTDVLLYNAKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQN 720

Query: 721  VMEFKKCTINGVSYGRAYTEALAGLRKRQGVDVESEGRREKEEIAKDRETMIDELRSMSD 780
            VMEFKKCTINGVSYGRAYTEALAGLRKRQGVDVESEGRREKEEIAKDRETMIDELRSMSD
Sbjct: 721  VMEFKKCTINGVSYGRAYTEALAGLRKRQGVDVESEGRREKEEIAKDRETMIDELRSMSD 780

Query: 781  NTQFCPEDLTFVSKEIVEDLKGSSGDHQQKCCEHFLLALALCHSVLVEPNKDDPKKLDIK 840
            NTQFCPEDLTFVSKEIVEDLKGSSGDHQQKCCEHFLLALALCHSVLVEPNKDDPKKLDIK
Sbjct: 781  NTQFCPEDLTFVSKEIVEDLKGSSGDHQQKCCEHFLLALALCHSVLVEPNKDDPKKLDIK 840

Query: 841  AQSPDESALVSTARQLGYSFVGSSKSGLIVEIQGVQKEFQVLNVLEFNSSRKRMSCIIKI 900
            AQSPDESALVSTARQLGYSFVGSSKSGLIVEIQGVQKEFQVLNVLEFNSSRKRMSCIIKI
Sbjct: 841  AQSPDESALVSTARQLGYSFVGSSKSGLIVEIQGVQKEFQVLNVLEFNSSRKRMSCIIKI 900

Query: 901  PGSTPKDEPKALLICKGADSVIYSRLDRTQNDATLLEKTALHLEEYATEGLRTLCLAQRE 960
            PGSTPKDEPKALLICKGADSVIYSRLDRTQNDATLLEKTALHLEEYATEGLRTLCLAQRE
Sbjct: 901  PGSTPKDEPKALLICKGADSVIYSRLDRTQNDATLLEKTALHLEEYATEGLRTLCLAQRE 960

Query: 961  LTWSEYERWVKTYDVAAASVTNREEELDKVTDVIERELILLGGTAIEDRLQDGVPDSIAL 1020
            LTWSEYERWVKTYDVAAASVTNREEELDKVTDVIERELILLGGTAIEDRLQDGVPDSIAL
Sbjct: 961  LTWSEYERWVKTYDVAAASVTNREEELDKVTDVIERELILLGGTAIEDRLQDGVPDSIAL 1020

Query: 1021 LAEAGIKLWVLTGDKVETAINIGFSCNVLNNDMELLVVKASGEDVEEFGSDPIQVVNNLV 1080
            LAEAGIKLWVLTGDKVETAINIGFSCNVLNNDMELLVVKASGEDVEEFGSDPIQVVNNLV
Sbjct: 1021 LAEAGIKLWVLTGDKVETAINIGFSCNVLNNDMELLVVKASGEDVEEFGSDPIQVVNNLV 1080

Query: 1081 TKYLREKFGMSGSEEELKEAKREHGLPQGNFAVIIDGDALKVALNGEEMRRKFLLLCKNC 1140
            TKYLREKFGMSGSEEELKEAKREHGLPQGNFAVIIDGDALKVALNGEEMRRKFLLLCKNC
Sbjct: 1081 TKYLREKFGMSGSEEELKEAKREHGLPQGNFAVIIDGDALKVALNGEEMRRKFLLLCKNC 1140

Query: 1141 KAVLCCRVSPXXXXXXXXXXXXTLDVMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVM 1200
            KAVLCCRVSP            TLDVMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVM
Sbjct: 1141 KAVLCCRVSPAQKAAVVKLVKKTLDVMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVM 1200

Query: 1201 CSDYAIGQFRYVTRLVLVHGKWCYKRLAEMIPQFFYKNVIFTLSLFWYGIYNNFDGSYLF 1260
            CSDYAIGQFRYVTRLVLVHGKWCYKRLAEMIPQFFYKNVIFTLSLFWYGIYNNFDGSYLF
Sbjct: 1201 CSDYAIGQFRYVTRLVLVHGKWCYKRLAEMIPQFFYKNVIFTLSLFWYGIYNNFDGSYLF 1260

Query: 1261 EYTYLTFYNLAFTSVPVILLAVLDQDVSDTVSMLVPQLYRVGILRKEWNQTKFLWYMLDG 1320
            EYTYLTFYNLAFTSVPVILLAVLDQDVSDTVSMLVPQLYRVGILRKEWNQTKFLWYMLDG
Sbjct: 1261 EYTYLTFYNLAFTSVPVILLAVLDQDVSDTVSMLVPQLYRVGILRKEWNQTKFLWYMLDG 1320

Query: 1321 VYQSVICFFFPYLAYHKNMVVTENGLGLDHRYFVGVFVTAIAVTSCNFYVFMEQYRWDWF 1380
            VYQSVICFFFPYLAYHKNMVVTENGLGLDHRYFVGVFVTAIAVTSCNFYVFMEQYRWDWF
Sbjct: 1321 VYQSVICFFFPYLAYHKNMVVTENGLGLDHRYFVGVFVTAIAVTSCNFYVFMEQYRWDWF 1380

Query: 1381 CGLFICLSLAVFYGWTGIWTXXXXXNEFYKGAARVFAQPAYWAVLFVGVLFCLLPRFTID 1440
            CGLFICLSLAVFYGWTGIWT     NEFYKGAARVFAQPAYWAVLFVGVLFCLLPRFTID
Sbjct: 1381 CGLFICLSLAVFYGWTGIWTSSSSSNEFYKGAARVFAQPAYWAVLFVGVLFCLLPRFTID 1440

Query: 1441 CIRKIFYPKDIEIVREMWLRGDFDLYPQGYDPTDPSRPRINEIRPLTDFKEPISLDTHFD 1500
            CIRKIFYPKDIEIVREMWLRGDFDLYPQGYDPTDPSRPRINEIRPLTDFKEPISLDTHFD
Sbjct: 1441 CIRKIFYPKDIEIVREMWLRGDFDLYPQGYDPTDPSRPRINEIRPLTDFKEPISLDTHFD 1500

Query: 1501 GVSHSQETIVTEEIPMSILNGEQGSRKGYRVSTTLERRDQLSPVTTTNNLPRRSMASARG 1560
            GVSHSQETIVTEEIPMSILNGEQGSRKGYRVSTTLERRDQLSPVTTTNNLPRRSMASARG
Sbjct: 1501 GVSHSQETIVTEEIPMSILNGEQGSRKGYRVSTTLERRDQLSPVTTTNNLPRRSMASARG 1560

Query: 1561 NKLRTSLDRTREEMLANHQLDTR 1583
            NKLRTSLDRTREEMLANHQLDTR
Sbjct: 1561 NKLRTSLDRTREEMLANHQLDTR 1583

>YER166W (DNF1) [1594] chr5 (512739..517454) Member of the haloacid
            dehalogenase or epoxide hydrolase family, has low
            similarity to S. cerevisiae Drs2p, which is a
            membrane-spanning Ca-ATPase (P-type) required for
            ribosome assembly and involved in late Golgi function
            [4716 bp, 1571 aa]
          Length = 1571

 Score = 2216 bits (5743), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1068/1570 (68%), Positives = 1267/1570 (80%), Gaps = 58/1570 (3%)

Query: 31   PFDDSFQFEKPSSAHGNIEVAKT---GGSVLKRQSKPMKDISTPDLSKVTFXXXXXXXXX 87
            PF+D+FQFE  SS + +  +A T    G+   + S+P          +V+F         
Sbjct: 15   PFEDTFQFEDNSS-NEDTHIAPTHFDDGATSNKYSRP----------QVSF--------- 54

Query: 88   XXXXXXXELNGKKTEIHEHENEVDD---DLHSFQATPMPN--TGGFEDVELDNNEGSNND 142
                   E    K E  E     DD   D HSFQ TP  N  +G F+DVELDN+ G  + 
Sbjct: 55   -----NDETPKNKREDAEEFTFNDDTEYDNHSFQPTPKLNNGSGTFDDVELDNDSGEPHT 109

Query: 143  SQADHKLKRVRFGTRRNKSGRIDINRSKTLKWAKKNFHNAIDEFSTKEDSLENSALQNRS 202
            +     +KR R GT+RNK G   + RSKTLKWA+KN  N  ++F+  +D ++  A+ NR+
Sbjct: 110  NY--DGMKRFRMGTKRNKKGNPIMGRSKTLKWARKNIPNPFEDFT--KDDIDPGAI-NRA 164

Query: 203  DELRTVYYNLPLPEDMLDEDGLPLAVYPRNKIRTTKYTPLTFFPKNILFQFHNFANIYFL 262
             ELRTVYYN+PLP+DM+DE+G P+  YPRNKIRTTKYTPLTF PKNILFQFHNFAN+YFL
Sbjct: 165  QELRTVYYNMPLPKDMIDEEGNPIMQYPRNKIRTTKYTPLTFLPKNILFQFHNFANVYFL 224

Query: 263  ILLILGAFQIFGVTNPGFASVPLIVIVIITAIKDGIEDSRRTVLDLEVNNTRTHILSGVK 322
            +L+ILGAFQIFGVTNPG ++VPL+VIVIITAIKD IEDSRRTVLDLEVNNT+THIL GV+
Sbjct: 225  VLIILGAFQIFGVTNPGLSAVPLVVIVIITAIKDAIEDSRRTVLDLEVNNTKTHILEGVE 284

Query: 323  NENVAVDNVSLWRRFKKANTRALIKIFEYFSENLTAAGXXXXXXXXXXXXXXXXNSRSFG 382
            NENV+ DN+SLWRRFKKAN+R L K  +Y  E+LT  G                   + G
Sbjct: 285  NENVSTDNISLWRRFKKANSRLLFKFIQYCKEHLTEEGKKKRMQRKRHELRVQKTVGTSG 344

Query: 383  PRGSLDSIGSYRMSADFGRPSLDYENLNQTMSQANRYNDGENLVDRTLQPNPECRFAKDY 442
            PR SLDSI SYR+SAD+GRPSLDY+NL Q   +A       N+VDR+L P  +C+FAK+Y
Sbjct: 345  PRSSLDSIDSYRVSADYGRPSLDYDNLEQGAGEA-------NIVDRSLPPRTDCKFAKNY 397

Query: 443  WKNVKVGDIVRVHNNDEIPADMILLSTSDVDGACYVETKNLDGETNLKVRQSLKCSKIIK 502
            WK VKVGDIVR+HNNDEIPAD+ILLSTSD DGACYVETKNLDGETNLKVRQSLKC+  I+
Sbjct: 398  WKGVKVGDIVRIHNNDEIPADIILLSTSDTDGACYVETKNLDGETNLKVRQSLKCTNTIR 457

Query: 503  SSRDITRTKFWVESEGPHANLYSYQGNFKWQDTQNGNIRNEPVNINNLLLRGCTLRNTKW 562
            +S+DI RTKFW+ESEGPH+NLY+YQGN KW++  +G IRNEP+ INN+LLRGCTLRNTKW
Sbjct: 458  TSKDIARTKFWIESEGPHSNLYTYQGNMKWRNLADGEIRNEPITINNVLLRGCTLRNTKW 517

Query: 563  AMGMVIFTGDDTKIMINAGVTPTKKSRISRELNFSVILNFVLLFILCFTAGIVNGVYYKQ 622
            AMG+V+FTG DTKIM+N+G+TPTKKSRISRELNFSV++NFVLLFILCF +GI NGVYY +
Sbjct: 518  AMGVVMFTGGDTKIMLNSGITPTKKSRISRELNFSVVINFVLLFILCFVSGIANGVYYDK 577

Query: 623  KPRSRDYFEFGTIGGSASTNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAIFIYTDVL 682
            K RSR  +EFGTI GSA+TNGFVSFWVAVILYQSLVPISLYISVEIIKTAQA FIY DVL
Sbjct: 578  KGRSRFSYEFGTIAGSAATNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAAFIYGDVL 637

Query: 683  LYNAKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEAL 742
            LYNAKLDYPCTPKSWNISDDLGQ+EYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEAL
Sbjct: 638  LYNAKLDYPCTPKSWNISDDLGQVEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEAL 697

Query: 743  AGLRKRQGVDVESEGRREKEEIAKDRETMIDELRSMSDNTQFCPEDLTFVSKEIVEDLKG 802
            AGLRKRQG+DVE+EGRREK EIAKDR+TMIDELR++S N+QF PE++TFVSKE V DLKG
Sbjct: 698  AGLRKRQGIDVETEGRREKAEIAKDRDTMIDELRALSGNSQFYPEEVTFVSKEFVRDLKG 757

Query: 803  SSGDHQQKCCEHFLLALALCHSVLVEPNKDDPKKLDIKAQSPDESALVSTARQLGYSFVG 862
            +SG+ QQ+CCEHF+LALALCHSVLVE N D+PKKLD+KAQSPDE+ALV+TAR +G+SFVG
Sbjct: 758  ASGEVQQRCCEHFMLALALCHSVLVEANPDNPKKLDLKAQSPDEAALVATARDVGFSFVG 817

Query: 863  SSKSGLIVEIQGVQKEFQVLNVLEFNSSRKRMSCIIKIPGSTPKDEPKALLICKGADSVI 922
             +K GLI+E+QG+QKEF++LN+LEFNSSRKRMSCI+KIPG  P DEP+ALLICKGADS+I
Sbjct: 818  KTKKGLIIEMQGIQKEFEILNILEFNSSRKRMSCIVKIPGLNPGDEPRALLICKGADSII 877

Query: 923  YSRLDRT--QNDATLLEKTALHLEEYATEGLRTLCLAQRELTWSEYERWVKTYDVAAASV 980
            YSRL R    N   +LEKTALHLE+YATEGLRTLC+AQREL+WSEYE+W + YD+AAAS+
Sbjct: 878  YSRLSRQSGSNSEAILEKTALHLEQYATEGLRTLCIAQRELSWSEYEKWNEKYDIAAASL 937

Query: 981  TNREEELDKVTDVIERELILLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAI 1040
             NRE+EL+ V D IERELILLGGTAIEDRLQDGVPD I LLAEAGIKLWVLTGDKVETAI
Sbjct: 938  ANREDELEVVADSIERELILLGGTAIEDRLQDGVPDCIELLAEAGIKLWVLTGDKVETAI 997

Query: 1041 NIGFSCNVLNNDMELLVVKASGEDVEEFGSDPIQVVNNLVTKYLREKFGMSGSEEELKEA 1100
            NIGFSCN+LNN+MELLV+K +G+DV+EFGS+P ++V+ L++KYL+E F ++GSEEE+ EA
Sbjct: 998  NIGFSCNLLNNEMELLVIKTTGDDVKEFGSEPSEIVDALLSKYLKEYFNLTGSEEEIFEA 1057

Query: 1101 KREHGLPQGNFAVIIDGDALKVALNGEEMRRKFLLLCKNCKAVLCCRVSPXXXXXXXXXX 1160
            K++H  P+GN+A++IDGDALK+AL GE++RRKFLLLCKNC+AVLCCRVSP          
Sbjct: 1058 KKDHEFPKGNYAIVIDGDALKLALYGEDIRRKFLLLCKNCRAVLCCRVSPSQKAAVVKLV 1117

Query: 1161 XXTLDVMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFRYVTRLVLVHG 1220
              +LDVMTLAIGDGSNDVAMIQSADVG+GIAGEEGRQAVMCSDYAIGQFRY+ RLVLVHG
Sbjct: 1118 KDSLDVMTLAIGDGSNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQFRYLARLVLVHG 1177

Query: 1221 KWCYKRLAEMIPQFFYKNVIFTLSLFWYGIYNNFDGSYLFEYTYLTFYNLAFTSVPVILL 1280
            +W YKRLAEMIP+FFYKN+IF L+LFWYGIYN+FDGSYL+EYTY+ FYNLAFTS+PVI L
Sbjct: 1178 RWSYKRLAEMIPEFFYKNMIFALALFWYGIYNDFDGSYLYEYTYMMFYNLAFTSLPVIFL 1237

Query: 1281 AVLDQDVSDTVSMLVPQLYRVGILRKEWNQTKFLWYMLDGVYQSVICFFFPYLAYHKNMV 1340
             +LDQDV+DT+S++VPQLYRVGILRKEWNQ KFLWYMLDG+YQS+ICFFFPYL YHKNM+
Sbjct: 1238 GILDQDVNDTISLVVPQLYRVGILRKEWNQRKFLWYMLDGLYQSIICFFFPYLVYHKNMI 1297

Query: 1341 VTENGLGLDHRYFVGVFVTAIAVTSCNFYVFMEQYRWDWFCGLFICLSLAVFYGWTGIWT 1400
            VT NGLGLDHRYFVGV+VT IAV SCN YV + QYRWDWF GLFI LS  V + WTGIW+
Sbjct: 1298 VTSNGLGLDHRYFVGVYVTTIAVISCNTYVLLHQYRWDWFSGLFIALSCLVVFAWTGIWS 1357

Query: 1401 XXXXXNEFYKGAARVFAQPAYWAVLFVGVLFCLLPRFTIDCIRKIFYPKDIEIVREMWLR 1460
                  EF+K AAR++  P++WAV FV VLFCLLPRFT D  +K FYP D+EIVREMW  
Sbjct: 1358 SAIASREFFKAAARIYGAPSFWAVFFVAVLFCLLPRFTYDSFQKFFYPTDVEIVREMWQH 1417

Query: 1461 GDFDLYPQGYDPTDPSRPRINEIRPLTD-FKEPISLDTHFDGVSHSQETIVTEEIPMSIL 1519
            G FD YP GYDPTDP+RP++ +     +   E I+L  +  G ++S++++VTEEIPM+ +
Sbjct: 1418 GHFDHYPPGYDPTDPNRPKVTKAGQHGEKIIEGIALSDNLGGSNYSRDSVVTEEIPMTFM 1477

Query: 1520 NGEQGSRKGYRVSTTLERRDQLSPVTTTNNL--PRRSMASARG----NKLRTSLDRTREE 1573
            +GE GS  GY+   T       SP  T + L  P+   A   G      +R+SLDRTRE+
Sbjct: 1478 HGEDGSPSGYQKQETW----MTSPKETQDLLQSPQFQQAQTFGRGPSTNVRSSLDRTREQ 1533

Query: 1574 MLANHQLDTR 1583
            M+A +QLD R
Sbjct: 1534 MIATNQLDNR 1543

>Scas_576.8
          Length = 1591

 Score = 2169 bits (5619), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1037/1505 (68%), Positives = 1235/1505 (82%), Gaps = 27/1505 (1%)

Query: 97   NGKKTEIHEHENEVDDDLHSFQATPMPNT--GGFEDVELDNNEGSNNDSQ----ADHKLK 150
            + K+ E      +VD+D+HSF+ TP   T  G F+D+ L+N++   + S     +++ +K
Sbjct: 63   DSKEKESLSFHEDVDNDIHSFEPTPRIGTSNGAFDDISLENDDHDPSSSHHHSTSENIMK 122

Query: 151  RVRFGTRRNKSGRIDINRSKTLKWAKKNFHNAIDEFSTKEDSLENSALQNRSDELRTVYY 210
            R+R GT+RNK G+  + R+KTLKWA+K F N  +E + ++D  +++ L NR+ ELRTVYY
Sbjct: 123  RLRMGTQRNKKGKPTVGRAKTLKWAQKTFVNPFEESNNRDDIFDDAGLTNRASELRTVYY 182

Query: 211  NLPLPEDMLDEDGLPLAVYPRNKIRTTKYTPLTFFPKNILFQFHNFANIYFLILLILGAF 270
            N+PLP++M+DEDG P+  YPRNKIRTTKY+PL FFPKNI+FQF NFAN+YFL+L+ILGAF
Sbjct: 183  NMPLPKEMVDEDGKPITDYPRNKIRTTKYSPLNFFPKNIMFQFQNFANVYFLVLIILGAF 242

Query: 271  QIFGVTNPGFASVPLIVIVIITAIKDGIEDSRRTVLDLEVNNTRTHILSGVKNENVAVDN 330
            QIFGVTNPG A+VPLIVIVIITAIKD IEDSRRT+LD+EVNNTRTHIL GV N NV+VDN
Sbjct: 243  QIFGVTNPGLAAVPLIVIVIITAIKDAIEDSRRTLLDMEVNNTRTHILEGVDNGNVSVDN 302

Query: 331  VSLWRRFKKANTRALIKIFEYFSENLTAAGXXXXXXXXXXXXXXXXNSRSFG---PRGSL 387
            VSLWRRFKKANTR L+K  EY   + T  G                 + + G    R SL
Sbjct: 303  VSLWRRFKKANTRLLMKFIEYCKSHFTEEGRQKRRQHKRHILRSQTAAINGGIDMARNSL 362

Query: 388  DSIGSYRMSADFGRPSLDYENLNQTMSQANRYNDGENLVDRTLQPNPECRFAKDYWKNVK 447
            DSIGSYRMS D+GRPSL+Y+    T+ Q+    D  N++DR+L P  +C+F+KDYWKNVK
Sbjct: 363  DSIGSYRMSGDYGRPSLEYD----TVGQSALKTDNANIMDRSLPPRSDCKFSKDYWKNVK 418

Query: 448  VGDIVRVHNNDEIPADMILLSTSDVDGACYVETKNLDGETNLKVRQSLKCSKIIKSSRDI 507
            VGDIVR+HNNDEIPAD+ILLSTSD DG CY+ETKNLDGETNLKVR+SLKCS  I++SRDI
Sbjct: 419  VGDIVRIHNNDEIPADIILLSTSDSDGGCYLETKNLDGETNLKVRESLKCSHSIRNSRDI 478

Query: 508  TRTKFWVESEGPHANLYSYQGNFKWQDTQNGNIRNEPVNINNLLLRGCTLRNTKWAMGMV 567
             RTKFWVESEGPHANLYSYQGN KW D+++G+++NEPV INNLLLRGCTLRNTKWAMGMV
Sbjct: 479  ARTKFWVESEGPHANLYSYQGNVKWVDSKDGDLKNEPVTINNLLLRGCTLRNTKWAMGMV 538

Query: 568  IFTGDDTKIMINAGVTPTKKSRISRELNFSVILNFVLLFILCFTAGIVNGVYYKQKPRSR 627
            +FTGDDTKIM+N+G TPTKKSRISRELN SV LNF+ LFI+CF + I+NGV Y + PRSR
Sbjct: 539  VFTGDDTKIMLNSGATPTKKSRISRELNLSVSLNFLFLFIICFISAIINGVDYDKHPRSR 598

Query: 628  DYFEFGTIGGSASTNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAIFIYTDVLLYNAK 687
            D+FEFGT+ GSASTNGFVSFWVAVILYQSLVPISLYISVEIIKTAQA FIY DVLLYNAK
Sbjct: 599  DFFEFGTVAGSASTNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAAFIYGDVLLYNAK 658

Query: 688  LDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRK 747
            LDYPCTPKSWNISDD+GQIEYIFSDKTGTLTQNVMEFKKCTING+SYGRAYTEALAGLRK
Sbjct: 659  LDYPCTPKSWNISDDMGQIEYIFSDKTGTLTQNVMEFKKCTINGISYGRAYTEALAGLRK 718

Query: 748  RQGVDVESEGRREKEEIAKDRETMIDELRSMSDNTQFCPEDLTFVSKEIVEDLKGSSGDH 807
            RQG+DVE EGRREKEEIAKDR+TMI+ LR++S N+QF P+D+TF+SKE V DLKG+SGD 
Sbjct: 719  RQGIDVEEEGRREKEEIAKDRDTMINTLRNLSHNSQFYPDDITFISKEFVNDLKGASGDM 778

Query: 808  QQKCCEHFLLALALCHSVLVEPNKDDPKKLDIKAQSPDESALVSTARQLGYSFVGSSKSG 867
            QQKCCEHF+LALALCHSVLVEPNK D KKLD+KAQSPDE+ALV TAR +G+SF+G +K+G
Sbjct: 779  QQKCCEHFMLALALCHSVLVEPNKHDSKKLDVKAQSPDEAALVCTARDVGFSFIGKTKTG 838

Query: 868  LIVEIQGVQKEFQVLNVLEFNSSRKRMSCIIKIPGSTPKDEPKALLICKGADSVIYSRLD 927
            LI+E+QGVQKEFQ+LN LEFNS+RKRMSCI+KIPG+ P DEP+ALLICKGADS+IYSRL 
Sbjct: 839  LIIEVQGVQKEFQILNTLEFNSTRKRMSCIVKIPGANPDDEPRALLICKGADSIIYSRLG 898

Query: 928  RTQ--NDATLLEKTALHLEEYATEGLRTLCLAQRELTWSEYERWVKTYDVAAASVTNREE 985
                 N   LLEKTALHLE+YATEGLRTLC+AQREL+W EY  W K YD+AAASVTNREE
Sbjct: 899  TKNGANSENLLEKTALHLEQYATEGLRTLCIAQRELSWPEYLEWNKRYDIAAASVTNREE 958

Query: 986  ELDKVTDVIERELILLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFS 1045
            +L+ V+D IEREL LLGGTAIEDRLQDGVP+SI++LA+AGIKLWVLTGDKVETAINIGFS
Sbjct: 959  QLEAVSDEIERELTLLGGTAIEDRLQDGVPESISILAQAGIKLWVLTGDKVETAINIGFS 1018

Query: 1046 CNVLNNDMELLVVKASGEDVEEFGSDPIQVVNNLVTKYLREKFGMSGSEEELKEAKREHG 1105
            CN+LNNDMELLVVK +G+DV+EFG+DP ++  +L+TKYLREKFG++GSE EL +AK+ H 
Sbjct: 1019 CNLLNNDMELLVVKTNGDDVQEFGNDPAEIAESLITKYLREKFGLTGSEMELADAKKNHD 1078

Query: 1106 LPQGNFAVIIDGDALKVALNGEEMRRKFLLLCKNCKAVLCCRVSPXXXXXXXXXXXXTLD 1165
             P+G+FAV+IDG+ALK+ALNGE +RRKFLLLCKNCKAVLCCRVSP            +LD
Sbjct: 1079 FPRGDFAVVIDGEALKLALNGESIRRKFLLLCKNCKAVLCCRVSPAQKAAVVKLVMTSLD 1138

Query: 1166 VMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFRYVTRLVLVHGKWCYK 1225
            VMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFRY+TRLVLVHG+W Y+
Sbjct: 1139 VMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFRYLTRLVLVHGRWSYR 1198

Query: 1226 RLAEMIPQFFYKNVIFTLSLFWYGIYNNFDGSYLFEYTYLTFYNLAFTSVPVILLAVLDQ 1285
            RLAEMIP FFYKNVIFTL+LFWYGIYNNFDGSYLFEYT+L FYNLAFTS+PVI + ++DQ
Sbjct: 1199 RLAEMIPAFFYKNVIFTLALFWYGIYNNFDGSYLFEYTFLMFYNLAFTSLPVIFMGIMDQ 1258

Query: 1286 DVSDTVSMLVPQLYRVGILRKEWNQTKFLWYMLDGVYQSVICFFFPYLAYHKNMVVTENG 1345
            DVSDTVS+++PQLYR GILR +WNQTKFLWYMLDG+YQS ICFFFPY  YHKN +V+ NG
Sbjct: 1259 DVSDTVSLVMPQLYRSGILRLDWNQTKFLWYMLDGLYQSCICFFFPYCLYHKNQIVSNNG 1318

Query: 1346 LGLDHRYFVGVFVTAIAVTSCNFYVFMEQYRWDWFCGLFICLSLAVFYGWTGIWTXXXXX 1405
            LGLDHR++VGV VT++AV SCN Y+ + QYRWDWF  LFI LS  + + WTG+W+     
Sbjct: 1319 LGLDHRFYVGVMVTSLAVVSCNIYMLLHQYRWDWFSCLFIGLSCIILFFWTGVWSSSLTS 1378

Query: 1406 NEFYKGAARVFAQPAYWAVLFVGVLFCLLPRFTIDCIRKIFYPKDIEIVREMWLRGDFDL 1465
             EF+K A+R++  P++W V FVG+++CLLPRFT+DC RK FYP D+EIVREMW RGDF  
Sbjct: 1379 KEFFKAASRIYGAPSFWGVFFVGIVYCLLPRFTLDCFRKFFYPTDVEIVREMWQRGDFSH 1438

Query: 1466 YPQGYDPTDPSRPRINEIRPLTD-FKEPISLDTHFDGVSHSQETIVTEEIPMSILNGEQG 1524
            YP GYDPTDP+RP++ +     +   E I L   F   + S E++ TEEIPM+IL+ + G
Sbjct: 1439 YPPGYDPTDPNRPKVAKSGKFGERIVEGIHLSQSFGENNFSHESVATEEIPMNILHTDAG 1498

Query: 1525 S--RKGYR---VSTTLERRDQL-SPVTTTNNLPRRSMASARGNKLRTSLDRTREEMLANH 1578
               R+  +    S+  E +D L SP      L +      + N  R+SL+RTRE+MLA +
Sbjct: 1499 QTIRRDTQDQWASSPKETQDLLFSP-----RLNQEQEQRQKSNLGRSSLERTREDMLATN 1553

Query: 1579 QLDTR 1583
            QLD R
Sbjct: 1554 QLDNR 1558

>CAGL0L11814g 1262124..1266854 highly similar to sp|P32660
            Saccharomyces cerevisiae YER166w or sp|Q12675
            Saccharomyces cerevisiae YDR093w, start by similarity
          Length = 1576

 Score = 2164 bits (5606), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1040/1507 (69%), Positives = 1237/1507 (82%), Gaps = 30/1507 (1%)

Query: 97   NGKKTEIHEHENEVDDDLHSFQATPMPNTGG-----FEDVELDNNEGSNNDSQADHKLKR 151
            +G K E  E     D D+      P P+ GG     F+DV LDN++  +NDS    ++KR
Sbjct: 49   DGHKMEEKETTLADDTDIEISSIQPTPHLGGAKTGMFDDVALDNDD--HNDSS--REMKR 104

Query: 152  VRFGTRR---NKSGRIDINRSKTLKWAKKNFHNAIDEFSTKEDSLENSALQNRSDELRTV 208
            +R GTRR   +KS   +++R+KTLKWAKKN  N  D+FS  E+  EN    NR+D+LRTV
Sbjct: 105  LRMGTRRVKGHKSQFGNMSRNKTLKWAKKNIKNPFDDFSRDEEE-ENDRSTNRADQLRTV 163

Query: 209  YYNLPLPEDMLDEDGLPLAVYPRNKIRTTKYTPLTFFPKNILFQFHNFANIYFLILLILG 268
            Y+NLPLPE+MLDE+G P+  YPRNKIRTTKYTPL+FFPKN+LFQF NFAN+YFL+L+ILG
Sbjct: 164  YHNLPLPEEMLDEEGNPIMEYPRNKIRTTKYTPLSFFPKNLLFQFQNFANVYFLVLIILG 223

Query: 269  AFQIFGVTNPGFASVPLIVIVIITAIKDGIEDSRRTVLDLEVNNTRTHILSGVKNENVAV 328
            AFQIFGVTNPG ++VPLIVIVIITAIKDGIEDSRRT+LDLEVNNTRTHIL GV NENV+V
Sbjct: 224  AFQIFGVTNPGLSAVPLIVIVIITAIKDGIEDSRRTILDLEVNNTRTHILEGVVNENVSV 283

Query: 329  DNVSLWRRFKKANTRALIKIFEYFSENLTAAGXXXXXXXXXXXXXXXXNSRSFGPRGSLD 388
            DNVSLWRRFKKAN+R L++  ++  E +T  G                 +   GPR SLD
Sbjct: 284  DNVSLWRRFKKANSRLLMQFIQWCKERMTEDGKRRRLQRQRRKLRKSTRN-GHGPRNSLD 342

Query: 389  SIGSYRMSADF-GRPSLDYENLNQTMSQANRYNDGENLVDRTLQPNPECRFAKDYWKNVK 447
            S+ SYR SAD+  RPSLDY+N+   + +    ++  +++DRTL P  + RFA+DYWK+VK
Sbjct: 343  SMDSYRPSADYYNRPSLDYDNMGHIVGE----DEDVDIIDRTLPPRTDTRFARDYWKSVK 398

Query: 448  VGDIVRVHNNDEIPADMILLSTSDVDGACYVETKNLDGETNLKVRQSLKCSKIIKSSRDI 507
            VGDIVR+HNNDEIPAD+ILLSTSD DG CYVETKNLDGETNLKVRQ+LKCS  IK+SRDI
Sbjct: 399  VGDIVRIHNNDEIPADIILLSTSDSDGGCYVETKNLDGETNLKVRQALKCSYKIKTSRDI 458

Query: 508  TRTKFWVESEGPHANLYSYQGNFKWQDTQNGNIRNEPVNINNLLLRGCTLRNTKWAMGMV 567
             RT+FW+ESEGPHANLYSYQGN KW+D+ N  +RNEPV INN+LLRGCTLRNTKWAMG+V
Sbjct: 459  ARTRFWIESEGPHANLYSYQGNLKWKDSTNNELRNEPVTINNMLLRGCTLRNTKWAMGIV 518

Query: 568  IFTGDDTKIMINAGVTPTKKSRISRELNFSVILNFVLLFILCFTAGIVNGVYYKQKPRSR 627
            +FTGDDTKIM+NAGVTPTKKSRISRELNFSV++NF++LFILCF +G+ NG+ Y + PRSR
Sbjct: 519  VFTGDDTKIMLNAGVTPTKKSRISRELNFSVLINFLVLFILCFISGLANGIDYDKHPRSR 578

Query: 628  DYFEFGTIGGSASTNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAIFIYTDVLLYNAK 687
            D+FEFGT+ G+ +TNGFVSFWVAVILYQSLVPISLYISVEIIKTAQA FIY DVLLYNAK
Sbjct: 579  DFFEFGTVAGNPATNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAAFIYGDVLLYNAK 638

Query: 688  LDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRK 747
            LDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRK
Sbjct: 639  LDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRK 698

Query: 748  RQGVDVESEGRREKEEIAKDRETMIDELRSMSDNTQFCPEDLTFVSKEIVEDLKGSSGDH 807
            RQG+DVE+EGRREKEEIAKDR+ MI++LR++S+NTQF P+++TF+SKEIV+D KG +GD 
Sbjct: 699  RQGIDVEAEGRREKEEIAKDRDVMINDLRNLSNNTQFFPDEITFISKEIVQDFKGRNGDI 758

Query: 808  QQKCCEHFLLALALCHSVLVEPNKDDPKKLDIKAQSPDESALVSTARQLGYSFVGSSKSG 867
            Q+KCCEHF+LALALCHSVL EP+  +P KL++KAQSPDE+ALV+TAR LG+ F+G +K+G
Sbjct: 759  QKKCCEHFMLALALCHSVLTEPSPTNPNKLEMKAQSPDEAALVTTARDLGFCFMGKTKTG 818

Query: 868  LIVEIQGVQKEFQVLNVLEFNSSRKRMSCIIKIPGSTPKDEPKALLICKGADSVIYSRLD 927
            ++VEIQG+QKEF++LN+LEFNS+RKRMSCIIKIPG+TP DEP+ALLICKGADSVIYSRL 
Sbjct: 819  MVVEIQGIQKEFEILNILEFNSARKRMSCIIKIPGATPNDEPRALLICKGADSVIYSRLS 878

Query: 928  RT--QNDATLLEKTALHLEEYATEGLRTLCLAQRELTWSEYERWVKTYDVAAASVTNREE 985
                +ND TLLEKTALHLE+YATEGLRTLCLAQRELTWSEY  W   YD+AAAS+TNREE
Sbjct: 879  TKAGENDETLLEKTALHLEQYATEGLRTLCLAQRELTWSEYTEWNARYDIAAASLTNREE 938

Query: 986  ELDKVTDVIERELILLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFS 1045
            +L+ V+D IER+LILLGGTAIEDRLQDGVP+SIALLAEAGIKLWVLTGDKVETAINIGFS
Sbjct: 939  QLEIVSDSIERDLILLGGTAIEDRLQDGVPESIALLAEAGIKLWVLTGDKVETAINIGFS 998

Query: 1046 CNVLNNDMELLVVKASGEDVEEFGSDPIQVVNNLVTKYLREKFGMSGSEEELKEAKREHG 1105
            CN+LNNDMELLVVK +GEDV E+G DP +VVN+L++KYLREKFG+SGSE EL  AK +H 
Sbjct: 999  CNLLNNDMELLVVKTAGEDVLEYGEDPHEVVNSLISKYLREKFGLSGSEMELDNAKGDHS 1058

Query: 1106 LPQGNFAVIIDGDALKVALNGEEMRRKFLLLCKNCKAVLCCRVSPXXXXXXXXXXXXTLD 1165
             P+G+FAV+IDGDALK+AL G++M+RKFLLLCKNCKAVLCCRVSP            TLD
Sbjct: 1059 FPKGDFAVVIDGDALKIALTGDDMKRKFLLLCKNCKAVLCCRVSPAQKAAVVKLVKNTLD 1118

Query: 1166 VMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFRYVTRLVLVHGKWCYK 1225
            VMTLAIGDGSNDVAMIQSADVG+GIAGEEGRQAVMCSDYAIGQFRY+TRL+LVHG+W YK
Sbjct: 1119 VMTLAIGDGSNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQFRYLTRLLLVHGRWSYK 1178

Query: 1226 RLAEMIPQFFYKNVIFTLSLFWYGIYNNFDGSYLFEYTYLTFYNLAFTSVPVILLAVLDQ 1285
            RL+EMIP+FFYKNVIFTL+LFWYGIYNNFDGSYLFEYTYL FYNLAFTS+PVILL +LDQ
Sbjct: 1179 RLSEMIPEFFYKNVIFTLALFWYGIYNNFDGSYLFEYTYLMFYNLAFTSIPVILLGILDQ 1238

Query: 1286 DVSDTVSMLVPQLYRVGILRKEWNQTKFLWYMLDGVYQSVICFFFPYLAYHKNMVVTENG 1345
            DV+DT+S++VPQLYRVGILR EWNQTKFLWYM DG+YQSVICFFFPYL Y +N VVT+NG
Sbjct: 1239 DVNDTISLVVPQLYRVGILRLEWNQTKFLWYMFDGLYQSVICFFFPYLLYKRNGVVTKNG 1298

Query: 1346 LGLDHRYFVGVFVTAIAVTSCNFYVFMEQYRWDWFCGLFICLSLAVFYGWTGIWTXXXXX 1405
            +GL+HRY+VG+ VT IAV +CN Y+ + QYRWDWF G FI LS  V  GWTGIWT     
Sbjct: 1299 MGLEHRYYVGIIVTTIAVFACNLYILIHQYRWDWFSGFFIFLSCIVVIGWTGIWTSSFTS 1358

Query: 1406 NEFYKGAARVFAQPAYWAVLFVGVLFCLLPRFTIDCIRKIFYPKDIEIVREMWLRGDFDL 1465
             + +K   R++  P++WAV F+GV FCLLPRFT DC  + F P D++I+REMW RGD+D 
Sbjct: 1359 LDLWKAGERIYDSPSFWAVFFIGVFFCLLPRFTWDCYTQFFNPSDVQIIREMWKRGDYDH 1418

Query: 1466 YPQGYDPTDPSRPRINEIRPLTD-FKEPISL-DTHFDGVSHSQETIVTEEIPMSILNGEQ 1523
            YP GYDPTDP+RP+I++     +   + I L D  + G + S++++ TEEIPM+I++G  
Sbjct: 1419 YPVGYDPTDPNRPKISKGAKFGERLGQGIVLEDETYAGGNVSRDSVFTEEIPMNIISGTD 1478

Query: 1524 GSRKGYRVSTTLERRDQL---SPVTTTNNLPRRSMASAR----GNKLRTSLDRTREEMLA 1576
            G+ +G+ +S       Q    SP     NL     A+         +R S+DRTR+ MLA
Sbjct: 1479 GTPRGFEMSGRTPDIPQTQWESPEREEQNLLNSPQANVGLGTFEQTVRQSIDRTRDSMLA 1538

Query: 1577 NHQLDTR 1583
            N +LD R
Sbjct: 1539 NRELDNR 1545

>Scas_636.16
          Length = 1554

 Score = 2136 bits (5534), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1027/1507 (68%), Positives = 1220/1507 (80%), Gaps = 37/1507 (2%)

Query: 96   LNGKKTEIHEHENEVDDDLHSFQATPM-PNTGGFEDVELDNNEGSNNDSQADHKLKRVRF 154
            L G    + + E    DD  S   TP+   T  FED+EL N+E  N+   ++ ++KR+R 
Sbjct: 36   LKGDAVTVEDVEETKYDDSSSILPTPVVGGTAQFEDIEL-NSELPNS---SETEMKRLRL 91

Query: 155  GTRR-NKSGRIDINRSKTLKWAKKNFHNAIDEFSTKEDSLEN-SALQNRSDELRTVYYNL 212
            GT+R  +    D N++KT+KWA+KN H    +     D  +N + L NRSDE RT+Y+N+
Sbjct: 92   GTKRVKRETNFDRNKTKTIKWAQKNVHIPFKKHDEDADVDDNETGLLNRSDEFRTIYHNM 151

Query: 213  PLPEDMLDEDGLPLAVYPRNKIRTTKYTPLTFFPKNILFQFHNFANIYFLILLILGAFQI 272
            PLP++ML EDGLP+  YPRNKIRTTKYTPLTFFPKN++ QF+NFANIYFLI++ILGAFQI
Sbjct: 152  PLPDEMLYEDGLPIMEYPRNKIRTTKYTPLTFFPKNVMLQFNNFANIYFLIMIILGAFQI 211

Query: 273  FGVTNPGFASVPLIVIVIITAIKDGIEDSRRTVLDLEVNNTRTHILSGVKNENVAVDNVS 332
            FGVTNPG A+VPLIVI+I+TAIKD IEDSRRT+LD+EVNNTRTHIL G +N NV +DNVS
Sbjct: 212  FGVTNPGLAAVPLIVIIILTAIKDAIEDSRRTLLDMEVNNTRTHILQGPENPNVPIDNVS 271

Query: 333  LWRRFKKANTRALIKIFEYFSENLTAAGXXXXXXXXXXXXXXXXNSRSFGPRGSLDSIGS 392
             WR+FKKANT+ ++K F++ +E  TA G                  ++  PR SLDS  S
Sbjct: 272  SWRKFKKANTKLMLKFFQFINERFTATGKEARKQRQMKRRRAKKLGKTELPRTSLDSYQS 331

Query: 393  YRMSADFGRPSLDYENLNQTMSQANRYNDGE-NLVDRTLQPNPECRFAKDYWKNVKVGDI 451
             RMSAD+ RPSL+  N++ T      + +GE +++D +L P    +FA D+WKNV+VGDI
Sbjct: 332  TRMSADYYRPSLEQSNIDST------FENGEISVLDPSLPPMANSKFANDFWKNVRVGDI 385

Query: 452  VRVHNNDEIPADMILLSTSDVDGACYVETKNLDGETNLKVRQSLKCSKIIKSSRDITRTK 511
            VR+HNNDEIPAD+ILLSTSD+DG CYVETKNLDGE+NLKVRQSL+C+  I++SRDI RTK
Sbjct: 386  VRIHNNDEIPADVILLSTSDIDGGCYVETKNLDGESNLKVRQSLRCTNAIRNSRDICRTK 445

Query: 512  FWVESEGPHANLYSYQGNFKWQDTQNGNIRNEPVNINNLLLRGCTLRNTKWAMGMVIFTG 571
            FWVESEGPHANLY YQGN KW D+ +G   NEP+ INN+LLRGCTLRNTKWAMG+V+FTG
Sbjct: 446  FWVESEGPHANLYVYQGNLKWIDSLDGQTHNEPITINNMLLRGCTLRNTKWAMGIVVFTG 505

Query: 572  DDTKIMINAGVTPTKKSRISRELNFSVILNFVLLFILCFTAGIVNGVYYKQKPRSRDYFE 631
            DDTK MINAGVTPTKKSRISRELNFSV++NFV LFILC  AG+ NG YY++KPRSRD+FE
Sbjct: 506  DDTKTMINAGVTPTKKSRISRELNFSVLINFVFLFILCLIAGVANGAYYRKKPRSRDFFE 565

Query: 632  FGTIGGSASTNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAIFIYTDVLLYNAKLDYP 691
            FGTI G+ +TNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAIFIY DVLLYN +LDYP
Sbjct: 566  FGTIAGNPTTNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAIFIYLDVLLYNERLDYP 625

Query: 692  CTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQGV 751
            CTPKSW+ISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQG+
Sbjct: 626  CTPKSWSISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQGI 685

Query: 752  DVESEGRREKEEIAKDRETMIDELRSMSDNTQFCPEDLTFVSKEIVEDLKGSSGDHQQKC 811
            D E EGR E+E IA+DRE MID+LR +S+N+QF PE+LTFVSKE  +DL G++G+ QQK 
Sbjct: 686  DTEKEGRIEREGIAQDREIMIDDLRKISNNSQFYPEELTFVSKEFSQDLLGNNGEVQQKR 745

Query: 812  CEHFLLALALCHSVLVEPNKDDPKKLDIKAQSPDESALVSTARQLGYSFVGSSKSGLIVE 871
            C+HF+LALALCHSVLVEP+K+DP KL++ AQSPDE+ALV+TAR +G+SF+G +K GL+VE
Sbjct: 746  CQHFMLALALCHSVLVEPDKNDPNKLELTAQSPDETALVTTARDMGFSFIGKTKQGLLVE 805

Query: 872  IQGVQKEFQVLNVLEFNSSRKRMSCIIKIPGSTPKDEPKALLICKGADSVIYSRLDRTQ- 930
            +QG+QKEFQ+LN+LEFNSSRKRMSCI+K+P +T KDEP+ALLICKGADSVIYSRL R   
Sbjct: 806  VQGIQKEFQILNILEFNSSRKRMSCIVKLPPATEKDEPRALLICKGADSVIYSRLSRKPG 865

Query: 931  -NDATLLEKTALHLEEYATEGLRTLCLAQRELTWSEYERWVKTYDVAAASVTNREEELDK 989
             ND TLLEKTALHLE+YATEGLRTLC+ QRE++WSEY+ W + Y++AAAS+  REEELD 
Sbjct: 866  YNDETLLEKTALHLEQYATEGLRTLCVGQREISWSEYQEWNEKYNIAAASLAGREEELDH 925

Query: 990  VTDVIERELILLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCNVL 1049
            V D+IER+L+LLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCN+L
Sbjct: 926  VADLIERDLVLLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCNLL 985

Query: 1050 NNDMELLVVKASGEDVEEFGSDPIQVVNNLVTKYLREKFGMSGSEEELKEAKREHGLPQG 1109
            N DMELLV+K +GEDV+EFG DP ++VN LV+KYL EKF M+GSEEEL  AK++H  PQG
Sbjct: 986  NTDMELLVIKTTGEDVKEFGDDPTEIVNALVSKYLMEKFNMTGSEEELAAAKKDHSPPQG 1045

Query: 1110 NFAVIIDGDALKVALNGEEMRRKFLLLCKNCKAVLCCRVSPXXXXXXXXXXXXTLDVMTL 1169
             FA+IIDG+ALK+AL G+ M+RKFLLLCKNCKAVLCCRVSP            TLDVMTL
Sbjct: 1046 EFAIIIDGEALKIALTGDTMKRKFLLLCKNCKAVLCCRVSPAQKAAVVKLVKDTLDVMTL 1105

Query: 1170 AIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFRYVTRLVLVHGKWCYKRLAE 1229
            AIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFRYVTRLVLVHGKWCYKRLAE
Sbjct: 1106 AIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFRYVTRLVLVHGKWCYKRLAE 1165

Query: 1230 MIPQFFYKNVIFTLSLFWYGIYNNFDGSYLFEYTYLTFYNLAFTSVPVILLAVLDQDVSD 1289
            MIPQFFYKNVIFTL+LFWYG++N+FDGSYLFEYTYLTFYNLAFTS+PVI L +LDQDVS 
Sbjct: 1166 MIPQFFYKNVIFTLALFWYGVHNDFDGSYLFEYTYLTFYNLAFTSLPVIFLGILDQDVSA 1225

Query: 1290 TVSMLVPQLYRVGILRKEWNQTKFLWYMLDGVYQSVICFFFPYLAYHKNMVVTENGLGLD 1349
            TVSM+VPQLYR GILR+EWNQTKFLWYM DG+YQSVIC+FFPYL Y K  ++T+NGLGLD
Sbjct: 1226 TVSMIVPQLYRSGILRQEWNQTKFLWYMFDGIYQSVICYFFPYLIYRKTNIITQNGLGLD 1285

Query: 1350 HRYFVGVFVTAIAVTSCNFYVFMEQYRWDWFCGLFICLSLAVFYGWTGIWTXXXXXNEFY 1409
            HRY+VG+ VT IAVTSCNFYV MEQYRWDWF   F  LS  V++GWTGIW+      EF+
Sbjct: 1286 HRYYVGIPVTGIAVTSCNFYVLMEQYRWDWFTTFFAFLSTIVYFGWTGIWSSSIASYEFW 1345

Query: 1410 KGAARVFAQPAYWAVLFVGVLFCLLPRFTIDCIRKIFYPKDIEIVREMWLRGDFDLYPQG 1469
            KGA+R++  P++WAV FVG LFC+LPRFT D   K  YP D+EI+REMW  GDF  YP  
Sbjct: 1346 KGASRMYGTPSFWAVYFVGFLFCILPRFTYDVFMKYLYPSDVEIIREMWQHGDFARYPDD 1405

Query: 1470 YDPTDPSRPRINEIRPLTDFKEPISLDTHFDGV---SHSQETIVTEEIPMSILNGEQGSR 1526
            YDPTDP++P++ +      +K  I  ++  D V   S SQ TIVTEEIPMS L+ ++ S 
Sbjct: 1406 YDPTDPNKPKVEKAHEWGQYK--IVDESIGDAVVCASDSQGTIVTEEIPMSFLDVKKDS- 1462

Query: 1527 KGYRVSTTLERRDQLSPVTTTNNLPRR-SMASAR---------GNKLRTSLDRTREEMLA 1576
                 S  + R  Q+S  +   +  RR SM +AR          +++RTSLDRTR+EMLA
Sbjct: 1463 -----SNQVTREKQVSRDSLDEDDARRDSMNNARNSMQFRPSSSSRVRTSLDRTRDEMLA 1517

Query: 1577 NHQLDTR 1583
            ++QLDTR
Sbjct: 1518 SNQLDTR 1524

>CAGL0G08085g 763185..767921 highly similar to sp|Q12675 Saccharomyces
            cerevisiae YDR093w, hypothetical start
          Length = 1578

 Score = 2061 bits (5340), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1006/1510 (66%), Positives = 1217/1510 (80%), Gaps = 41/1510 (2%)

Query: 104  HEHENEVDDDLHSFQATPM---PNTGGF-----------EDVELDNNEGSNNDSQADHKL 149
            ++ E+++DDD +S + TP+    + G F           +D+E     G N +S++  ++
Sbjct: 55   YKEEDDMDDD-YSMEPTPIVGRSDNGQFNDDNRVLMFGPDDLERRAQPGKNRESKSGDQI 113

Query: 150  KRVRFGTRRNKSG--RIDINRSKTLKWAKKNFHNAIDEFSTKE-DSLENSALQNRSDELR 206
            KR+R+GT+R +    R DI RSKTLKWAKKN  + ++E    E ++ + + ++N++DELR
Sbjct: 114  KRLRWGTQRRRKSFKRYDIGRSKTLKWAKKNIQDPLEELIGNENEATDETGMRNKADELR 173

Query: 207  TVYYNLPLPEDMLDEDGLPLAVYPRNKIRTTKYTPLTFFPKNILFQFHNFANIYFLILLI 266
             +Y+N PLP+DMLDED  PLA YPRNKIRTTKYTPLTF PKNIL QFHNFANIYFLIL+I
Sbjct: 174  NIYFNQPLPQDMLDEDNKPLANYPRNKIRTTKYTPLTFLPKNILLQFHNFANIYFLILII 233

Query: 267  LGAFQIFGVTNPGFASVPLIVIVIITAIKDGIEDSRRTVLDLEVNNTRTHILSGVKNENV 326
            LGAFQIFGVTNPGF++VPLIVI+IITAIKDGIEDSRRTVLDLEVNNT+TH+L+G++N NV
Sbjct: 234  LGAFQIFGVTNPGFSAVPLIVIIIITAIKDGIEDSRRTVLDLEVNNTKTHVLTGIENYNV 293

Query: 327  AVDNVSLWRRFKKANTRALIKIFEYFSENLTAAGXXXXXXXXXXXXXXXXN-SRSFGPRG 385
            + D++SLWRRFKKAN+R +    +   E LT  G                N +R F  R 
Sbjct: 294  SADDISLWRRFKKANSRIIASFVQVCRETLTKKGRLEKAQRKRQMANHKKNLNRKF--RN 351

Query: 386  SLDSIGSYRMSADFGRPSLDYENLNQTMSQANRYNDGEN-LVDRTLQPNPECRFAKDYWK 444
            SL+S  S RMS D  RPS+D+    +  +  N Y   E+ L+++TL  + E RF+KDYWK
Sbjct: 352  SLNSYRSNRMSRDV-RPSMDF----RPSTDINGYQQNEDTLINKTLPTDMEWRFSKDYWK 406

Query: 445  NVKVGDIVRVHNNDEIPADMILLSTSDVDGACYVETKNLDGETNLKVRQSLKCSKIIKSS 504
            NVKVGDIVR+HNN+EIPAD+ILLSTSD DGACYVETKNLDGETNLKVRQS+KC+  I+SS
Sbjct: 407  NVKVGDIVRIHNNEEIPADIILLSTSDSDGACYVETKNLDGETNLKVRQSMKCTSDIRSS 466

Query: 505  RDITRTKFWVESEGPHANLYSYQGNFKWQDTQNGNIRNEPVNINNLLLRGCTLRNTKWAM 564
             DI RT+FW+ESEGPHANLYSYQGNF+W   ++  ++NEPVNINNLLLRGCTLRNTKWAM
Sbjct: 467  IDIARTRFWIESEGPHANLYSYQGNFRWNSLEDNQLKNEPVNINNLLLRGCTLRNTKWAM 526

Query: 565  GMVIFTGDDTKIMINAGVTPTKKSRISRELNFSVILNFVLLFILCFTAGIVNGVYYKQKP 624
            G+V FTGDDTKIM+NAGVTPTKKSRIS+ELN SV+ NF LLF+LCF AG+ NG+Y+ + P
Sbjct: 527  GVVAFTGDDTKIMLNAGVTPTKKSRISKELNLSVLFNFALLFVLCFIAGLYNGIYHNKHP 586

Query: 625  RSRDYFEFGTIGGSASTNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAIFIYTDVLLY 684
            RSRD+F+FGT  G ++T+GFVSFWVAVILYQSLVPISLYISVEIIKTAQAIFIY DV++Y
Sbjct: 587  RSRDFFDFGTGTGGSATSGFVSFWVAVILYQSLVPISLYISVEIIKTAQAIFIYLDVMMY 646

Query: 685  NAKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAG 744
            N KLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAG
Sbjct: 647  NEKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAG 706

Query: 745  LRKRQGVDVESEGRREKEEIAKDRETMIDELRSMSDNTQFCPEDLTFVSKEIVEDLKGSS 804
            LRKRQGVDV  E + EKE I +DRE MI++L++++ N+QF  +++TFVSKE V+DL G S
Sbjct: 707  LRKRQGVDVAHESKIEKEGIKRDREEMINKLQNLAKNSQFYEDEVTFVSKEFVDDLTGGS 766

Query: 805  GDHQQKCCEHFLLALALCHSVLVEPNKDDPKKLDIKAQSPDESALVSTARQLGYSFVGSS 864
            G  QQK C+HF+LALALCHSVL EP+K+DP KL+IKAQSPDE+ALV+TAR +G+SF+  +
Sbjct: 767  GSVQQKSCQHFMLALALCHSVLTEPSKEDPAKLEIKAQSPDEAALVTTARDMGFSFLKKT 826

Query: 865  KSGLIVEIQGVQKEFQVLNVLEFNSSRKRMSCIIKIPGSTPKDEPKALLICKGADSVIYS 924
            K G+++E+QG++KEFQ+LN+LEFNSSRKRMSCI+KIPG     +PKALLICKGADSVIYS
Sbjct: 827  KEGMVLEVQGIEKEFQILNILEFNSSRKRMSCIVKIPGDDANGKPKALLICKGADSVIYS 886

Query: 925  RLDRTQ-NDATLLEKTALHLEEYATEGLRTLCLAQRELTWSEYERWVKTYDVAAASVTNR 983
            RLD+T  N+ +LLEKTALHLE+YATEGLRTLCLAQREL+W EYERW K YD+AAA+V +R
Sbjct: 887  RLDKTGLNEESLLEKTALHLEQYATEGLRTLCLAQRELSWEEYERWNKKYDIAAAAVVDR 946

Query: 984  EEELDKVTDVIERELILLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIG 1043
            EEEL+KV+D IER LILLGGTAIEDRLQDGVPDSIALL EAGIKLWVLTGDKVETAINIG
Sbjct: 947  EEELEKVSDEIERHLILLGGTAIEDRLQDGVPDSIALLGEAGIKLWVLTGDKVETAINIG 1006

Query: 1044 FSCNVLNNDMELLVVKASGEDVEEFGSDPIQVVNNLVTKYLREKFGMSGSEEELKEAKRE 1103
            FSCN+LNNDMELLV+K +G DVE+ G+ P  +V+ L+++YL +KFGM+GSEEELK+AK E
Sbjct: 1007 FSCNLLNNDMELLVIKTTGPDVEDLGATPKDIVDTLISQYLHDKFGMAGSEEELKKAKAE 1066

Query: 1104 HGLPQGNFAVIIDGDALKVALNGEEMRRKFLLLCKNCKAVLCCRVSPXXXXXXXXXXXXT 1163
            H +P+G FAVIIDG+ALK AL+ E+M+RKFLLLCKNCK+VLCCRVSP            T
Sbjct: 1067 HDIPRGEFAVIIDGEALKYALSTEDMKRKFLLLCKNCKSVLCCRVSPAQKAAVVKLVKNT 1126

Query: 1164 LDVMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFRYVTRLVLVHGKWC 1223
            LDVMTLAIGDGSNDVAMIQSA++GVGIAGEEGRQAVM SDYAIGQFRY+TRL+LVHGKWC
Sbjct: 1127 LDVMTLAIGDGSNDVAMIQSANIGVGIAGEEGRQAVMSSDYAIGQFRYLTRLLLVHGKWC 1186

Query: 1224 YKRLAEMIPQFFYKNVIFTLSLFWYGIYNNFDGSYLFEYTYLTFYNLAFTSVPVILLAVL 1283
            YKRLAEMIPQFFYKN+IFTL+LFW+GIYN++DGSYLFEYTYLTFYNLAFTS+PVILL + 
Sbjct: 1187 YKRLAEMIPQFFYKNMIFTLALFWFGIYNDYDGSYLFEYTYLTFYNLAFTSIPVILLGIF 1246

Query: 1284 DQDVSDTVSMLVPQLYRVGILRKEWNQTKFLWYMLDGVYQSVICFFFPYLAYHKNMVVTE 1343
            DQDVSDT+S++ PQLYRVGILRKEW+QTKFLWYMLDG+YQSVI FFFPYL Y ++M+VT 
Sbjct: 1247 DQDVSDTISLVFPQLYRVGILRKEWSQTKFLWYMLDGLYQSVIAFFFPYLLYRRHMIVTS 1306

Query: 1344 NGLGLDHRYFVGVFVTAIAVTSCNFYVFMEQYRWDWFCGLFICLSLAVFYGWTGIWTXXX 1403
            NGLGLDHRY+VGV VTAIA  SCN Y+ ++Q  WD FC  F+ +S+ +F+ WTGIW+   
Sbjct: 1307 NGLGLDHRYYVGVPVTAIACISCNLYILIQQKHWDVFCSFFVGVSIMIFFTWTGIWSSAS 1366

Query: 1404 XXNEFYKGAARVFAQPAYWAVLFVGVLFCLLPRFTIDCIRKIFYPKDIEIVREMWLRGDF 1463
              NEFY GAARVF  P +WAVLFVG++FCLLPRFT+D  ++ FYPKDI+I+REMW RGDF
Sbjct: 1367 RSNEFYHGAARVFGTPTFWAVLFVGIMFCLLPRFTLDVFKRYFYPKDIDIIREMWSRGDF 1426

Query: 1464 DLYPQGYDPTDPSRPRI--NEIRPLTDFKEPISLDTHFDGVSHSQETIVTEEIPMSILNG 1521
            D +P+ YDPTDP   +I  ++IR  +   E    +++ +  S S E I++EEIP+ +  G
Sbjct: 1427 DSFPKKYDPTDPEVHKIAMSDIRVFSG-AESKEFNSNSNTSSSSSEDILSEEIPLELGKG 1485

Query: 1522 --EQGSRKGYRVSTTLE------RRDQLSPVTTTNNLPRRSMASARGNKLRTSLDRTREE 1573
              + G +  Y      E       +D       T+N  R S  S   N  RTSLDRTRE+
Sbjct: 1486 MNDSGKKSEYESGVGDEILKYYLGKDSNRNTILTDNQKRLSTYSRASN--RTSLDRTRED 1543

Query: 1574 MLANHQLDTR 1583
            MLA +QLDTR
Sbjct: 1544 MLATNQLDTR 1553

>KLLA0C17644g 1557138..1561868 similar to sp|P32660 Saccharomyces
            cerevisiae YER166w, start by similarity
          Length = 1576

 Score = 1996 bits (5170), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 988/1571 (62%), Positives = 1176/1571 (74%), Gaps = 65/1571 (4%)

Query: 31   PFDDSFQFEKPSSAHGNIEVA---KTGGSVLK---RQSKPMKDISTPDLSKVTFXXXXXX 84
            PF+D F FE+ +    N++     +  GS  K   RQ   +K+ ST   SK+        
Sbjct: 27   PFNDRFVFEQGNQFASNLDGTIDNEADGSKTKLKGRQGSILKNGSTSSPSKIG-KKKNQQ 85

Query: 85   XXXXXXXXXXELNGKKTEIHEHENEVDDDLHSFQATPMPNTGGFEDVELDNNEGSNNDSQ 144
                      +L  ++ E    E    DD  S+  TP+ N G F   E D  E     S 
Sbjct: 86   LTFGDTGKTSDLKNEEFEEISFETTGADDQRSYVNTPIINQGNFAVDEEDEREKDRQLSS 145

Query: 145  AD--HKLKRVRFGTRRNKSGRIDINRSKTLKWAKKNFHN--------AIDEFSTKEDSLE 194
            A+    +KR+R+GTRR+K G+  + R+KTL+W KKNFHN        A +  S+ +D+ E
Sbjct: 146  AEDSKHVKRMRWGTRRDKKGKPAMGRAKTLRWTKKNFHNPFADDTNLAAEGHSSDDDNDE 205

Query: 195  NSALQNRSDELRTVYYNLPLPEDMLDEDGLPLAVYPRNKIRTTKYTPLTFFPKNILFQFH 254
            N    +R  E RT+YYNLPLPED+LDEDG     YPRNKIRTTKYTPLTFFPKNI FQF 
Sbjct: 206  NYDKSHRQRETRTIYYNLPLPEDILDEDGNSTIYYPRNKIRTTKYTPLTFFPKNIAFQFK 265

Query: 255  NFANIYFLILLILGAFQIFGVTNPGFASVPLIVIVIITAIKDGIEDSRRTVLDLEVNNTR 314
            N AN+YFL+L+I+G FQIFGV NPG A+VPLIVIV++T+ KD IEDSRRT+LD+EVNN  
Sbjct: 266  NVANVYFLVLIIMGFFQIFGVANPGLATVPLIVIVVLTSFKDAIEDSRRTILDMEVNNAP 325

Query: 315  THILSGVKNENVAVDNVSLWRRFKKANTRALIKIFEYFSENLTAAGXXXXXXXXXXXXXX 374
            THIL GV+N NV+ D VSLWR+FKKANTR L +      E  T  G              
Sbjct: 326  THILKGVENVNVSNDKVSLWRKFKKANTRVLFRFIHLCQELFTEEGKKQRAQRKRHEMHN 385

Query: 375  XXNSRSFGPRGSLDSIGSYR--MSADFGRPSLDYENLNQTMSQANRYNDGENLVDRTLQP 432
                ++  PR SLDS+GSYR  M ++FG                 R  D   L+D +L  
Sbjct: 386  KIR-QTQTPRNSLDSVGSYRNSMESEFGG------------DLTERGKDDLCLLDPSLPV 432

Query: 433  NPECRFAKDYWKNVKVGDIVRVHNNDEIPADMILLSTSDVDGACYVETKNLDGETNLKVR 492
             P+C+FAKDYWK+V VGDIVRVHNNDEIPAD+ILLS+SD DGACYVETKNLDGETNLKVR
Sbjct: 433  LPDCKFAKDYWKSVSVGDIVRVHNNDEIPADIILLSSSDSDGACYVETKNLDGETNLKVR 492

Query: 493  QSLKCSKIIKSSRDITRTKFWVESEGPHANLYSYQGNFKWQDTQNGNIRNEPVNINNLLL 552
            QSLKCS +I++SR+ITRTKF VESEGPH+NLYSYQGN KW D + G  +NEPVNINNLLL
Sbjct: 493  QSLKCSHMIRNSRNITRTKFKVESEGPHSNLYSYQGNLKWVDRETGLEKNEPVNINNLLL 552

Query: 553  RGCTLRNTKWAMGMVIFTGDDTKIMINAGVTPTKKSRISRELNFSVILNFVLLFILCFTA 612
            RGCTLRNTKWAMG+V+FTG DTKIM+NAGVTPTK SRISRELN SV +NF LLF+LCF A
Sbjct: 553  RGCTLRNTKWAMGIVVFTGPDTKIMLNAGVTPTKVSRISRELNLSVFMNFALLFVLCFAA 612

Query: 613  GIVNGVYYKQKPRSRDYFEFGTIGGSASTNGFVSFWVAVILYQSLVPISLYISVEIIKTA 672
            GIVNGVYY+    SR+YFEFG+I GSA+ NG VSFWVA+ILYQS+VPISLYIS+EIIKTA
Sbjct: 613  GIVNGVYYRTDNTSRNYFEFGSIAGSAAANGVVSFWVALILYQSVVPISLYISIEIIKTA 672

Query: 673  QAIFIYTDVLLYNAKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGV 732
            QA+FIY DV LYN +LDYPCTPKSW ISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGV
Sbjct: 673  QALFIYGDVALYNERLDYPCTPKSWTISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGV 732

Query: 733  SYGRAYTEALAGLRKRQGVDVESEGRREKEEIAKDRETMIDELRSMSDNTQFCPEDLTFV 792
            SYGRAYTEALAGLRKRQG+DVE EG  EKE IA+D+E M+  L+ + +N+Q  PE++TFV
Sbjct: 733  SYGRAYTEALAGLRKRQGIDVEEEGALEKEGIAQDKEIMLANLKILGENSQLRPENVTFV 792

Query: 793  SKEIVEDLKGSSGDHQQKCCEHFLLALALCHSVLVEPNKDDPKKLDIKAQSPDESALVST 852
            SKE V+D  G++G+ Q+KC E+F+LALALCH+VLVE NKDDP+ +D KAQSPDE+ALV T
Sbjct: 793  SKEFVQDTAGANGETQKKCNENFMLALALCHTVLVEENKDDPEIMDFKAQSPDEAALVGT 852

Query: 853  ARQLGYSFVGSSKSGLIVEIQGVQKEFQVLNVLEFNSSRKRMSCIIKIPGSTPKDEPKAL 912
            AR +G+SFVG +K+G+IV+IQGVQKE+++LNVLEFNS+RKRMSCI+KIP   P +EP+AL
Sbjct: 853  ARDMGFSFVGRTKNGVIVDIQGVQKEYRLLNVLEFNSTRKRMSCILKIPSENPNEEPRAL 912

Query: 913  LICKGADSVIYSRLDRTQNDATLLEKTALHLEEYATEGLRTLCLAQRELTWSEYERWVKT 972
            LICKGADS+IYSRL +  ND  LLEKTALHLE+YATEGLRTLC+AQREL+W EY+ W + 
Sbjct: 913  LICKGADSIIYSRLSK-NNDEKLLEKTALHLEQYATEGLRTLCIAQRELSWKEYQEWNEK 971

Query: 973  YDVAAASVTNREEELDKVTDVIERELILLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLT 1032
            +++AAA++ +RE+E++KV DVIEREL LLGGTAIEDRLQDGVPDSIA L EAGIKLWVLT
Sbjct: 972  HEIAAAALVDREDEMEKVADVIERELTLLGGTAIEDRLQDGVPDSIATLGEAGIKLWVLT 1031

Query: 1033 GDKVETAINIGFSCNVLNNDMELLVVKASGEDVEEFGSDPIQVVNNLVTKYLREKFGMSG 1092
            GDKVETAINIGFSCN+LNN+MELLV+KASG+DV+ +GS P ++V NL+ KYL+EKF MSG
Sbjct: 1032 GDKVETAINIGFSCNLLNNEMELLVIKASGDDVDIYGSKPAEIVKNLILKYLQEKFQMSG 1091

Query: 1093 SEEELKEAKREHGLPQGNFAVIIDGDALKVALNGEEMRRKFLLLCKNCKAVLCCRVSPXX 1152
            S EEL+EAK+ H  P GNF VIIDGDALK+AL  ++++R+FLLLCK CKAVLCCRVSP  
Sbjct: 1092 SYEELEEAKKVHEPPTGNFGVIIDGDALKLALRNDDVKREFLLLCKRCKAVLCCRVSPAQ 1151

Query: 1153 XXXXXXXXXXTLDVMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFRYV 1212
                      TLDVMTLAIGDGSNDVAMIQSAD+GVGIAGEEGRQAVM SDYAIGQFRY+
Sbjct: 1152 KAAVVKLVKNTLDVMTLAIGDGSNDVAMIQSADIGVGIAGEEGRQAVMSSDYAIGQFRYL 1211

Query: 1213 TRLVLVHGKWCYKRLAEMIPQFFYKNVIFTLSLFWYGIYNNFDGSYLFEYTYLTFYNLAF 1272
            TRLVLVHG+W YKR+AEMIP FFYKNVIFTLSLFWYG+YNN+DGSYLFEYTYLT +NLAF
Sbjct: 1212 TRLVLVHGRWSYKRMAEMIPLFFYKNVIFTLSLFWYGVYNNYDGSYLFEYTYLTLFNLAF 1271

Query: 1273 TSVPVILLAVLDQDVSDTVSMLVPQLYRVGILRKEWNQTKFLWYMLDGVYQSVICFFFPY 1332
            TS+PVI L +LDQDV+D VSM+VPQLYRVGILR EWNQTKF  YM D +YQSVICFF PY
Sbjct: 1272 TSLPVIFLGILDQDVNDIVSMVVPQLYRVGILRSEWNQTKFWLYMFDAMYQSVICFFLPY 1331

Query: 1333 LAYHKNMVVTENGLGLDHRYFVGVFVTAIAVTSCNFYVFMEQYRWDWFCGLFICLSLAVF 1392
            L Y+K  +VT+NG GLDHRY+VGVFV  IAV SCN YV + QYRWDWF  LFI LS    
Sbjct: 1332 LCYYKTGIVTQNGFGLDHRYWVGVFVATIAVVSCNTYVLLHQYRWDWFSSLFIALSCLCI 1391

Query: 1393 YGWTGIWTXXXXXNEFYKGAARVFAQPAYWAVLFVGVLFCLLPRFTIDCIRKIFYPKDIE 1452
            + WTGIW+      EFYK AA ++ QP +WA++F G+LFCLLPRF  D   + + PKDI+
Sbjct: 1392 FAWTGIWSSFTSSGEFYKSAAHIYGQPVFWAIMFAGILFCLLPRFAADTFLRTYMPKDID 1451

Query: 1453 IVREMWLRGDFDLYPQGYDPTDPSRPRINEIRPLTDFKEPISLDTHFDGVSHSQETIVTE 1512
            I+RE W RGDFD YP+GYDPTDP RP++         K     +   +    S ++I TE
Sbjct: 1452 IIRECWKRGDFDHYPEGYDPTDPDRPKV---------KNAFVYNKDIEMAQSSTDSIQTE 1502

Query: 1513 EIPMSILNGEQGSRKGYRVSTTLERRDQLSPVTTTNNLPRRSMASARGNKLRTSLDRTRE 1572
            EIPM  L         +  S T       SP +  +N  +RS         R SL+ TR 
Sbjct: 1503 EIPMDEL---------FNSSAT-------SPRSYPHNRHQRSSG-------RPSLEITRA 1539

Query: 1573 EMLANHQLDTR 1583
            EM  ++QLD R
Sbjct: 1540 EMRNSNQLDNR 1550

>AGR120C [4431] [Homologous to ScYER166W (DNF1) - SH; ScYDR093W (DNF2)
            - SH] (972456..977099) [4644 bp, 1547 aa]
          Length = 1547

 Score = 1917 bits (4967), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 939/1555 (60%), Positives = 1166/1555 (74%), Gaps = 76/1555 (4%)

Query: 31   PFDDSFQFEKPSSAHGNIEVAKTGGSVLKRQSKPMKDISTPDLSKVTFXXXXXXXXXXXX 90
            PF D FQFE      G  E  +   S+LK + +P +        K+ F            
Sbjct: 42   PFSDEFQFEV-----GGREGRQP--SILKAERQPQRQ-----GGKLAFA----------- 78

Query: 91   XXXXELNGKKTEIHEHENEVDDDLHSFQATPMPN-TGGFEDVELDNNEGSNNDSQADHKL 149
                      T   EH   VD     F  T  P   G  + V L  ++G   + ++  ++
Sbjct: 79   ----------TGTGEH---VDGANSEFSMTLTPTRVGQPQSVPL--SDGKRRELRSAKEM 123

Query: 150  KRVRFGTRRNKSGRIDINRSKTLKWAKKNFHNAI-DEFSTKEDSLENSALQNRSDELRTV 208
            K +R+GT+R+++GR  + R++TL+W KKN+ N   D  S   D+    A ++R+ E R V
Sbjct: 124  KILRWGTQRHRTGR-PVGRARTLRWGKKNYDNLPEDRGSGGSDTDAGVAGKSRAAEKRAV 182

Query: 209  YYNLPLPEDMLDEDGLPLAVYPRNKIRTTKYTPLTFFPKNILFQFHNFANIYFLILLILG 268
            Y+N+PLP ++  E+G P+  YPRNKIRTTKYTPL+F PKN+ +QF N ANIYFL+L+ L 
Sbjct: 183  YFNMPLPPELTGENGRPVVNYPRNKIRTTKYTPLSFLPKNLAYQFKNAANIYFLLLVCLS 242

Query: 269  AFQIFGVTNPGFASVPLIVIVIITAIKDGIEDSRRTVLDLEVNNTRTHILSGVKNENVAV 328
               IFGVTNP  A++PLI IV+IT +KD  EDSRRT+LDLEVNN R+HIL GV+N NV+ 
Sbjct: 243  FVSIFGVTNPALAAIPLIAIVVITGLKDAFEDSRRTILDLEVNNMRSHILHGVENNNVSA 302

Query: 329  DNVSLWRRFKKANTRALIKIFEYFSENLTAAGXXXXXXXXXXXXXXXXNSRSFGPRGSLD 388
            DNVSLWR+FKK NTR LI    +F E+ T AG                +     PR SLD
Sbjct: 303  DNVSLWRKFKKLNTRLLIATVRFFRESFTEAGRRRRAQRAREESQMAASRLGSDPRMSLD 362

Query: 389  SIGSYRMSADFGRPSLDYENLNQTMSQANRYNDGENLVDRTLQPNPECRFAKDYWKNVKV 448
            S+GSYR       PSLD++N+ Q +S     +D  ++++R L P P+CRF K +WK+++V
Sbjct: 363  SMGSYR-------PSLDFDNIGQLVS-----SDQVSVLNRNLPPVPDCRFGKSHWKDIRV 410

Query: 449  GDIVRVHNNDEIPADMILLSTSDVDGACYVETKNLDGETNLKVRQSLKCSKIIKSSRDIT 508
            GDIVR+HNNDEIPAD+ILLSTSD DGACYVETKNLDGETNLKVRQSLKCS  I++S+DI+
Sbjct: 411  GDIVRIHNNDEIPADIILLSTSDADGACYVETKNLDGETNLKVRQSLKCSHRIRNSKDIS 470

Query: 509  RTKFWVESEGPHANLYSYQGNFKWQDTQNGNIRNEPVNINNLLLRGCTLRNTKWAMGMVI 568
            R KFWVESEGPHANLYSYQGNFKW D++ G + NEPVNINN+LLRGC+LRNTKWAMG+V+
Sbjct: 471  RCKFWVESEGPHANLYSYQGNFKWVDSETGVMHNEPVNINNMLLRGCSLRNTKWAMGIVM 530

Query: 569  FTGDDTKIMINAGVTPTKKSRISRELNFSVILNFVLLFILCFTAGIVNGVYYKQKPRSRD 628
            FTG DTKIM+NAGVTPTK+SRISRELN+SVILNFV LF+LC  AG+VNG+YY++   SR 
Sbjct: 531  FTGTDTKIMLNAGVTPTKRSRISRELNYSVILNFVFLFVLCLAAGLVNGIYYRRDATSRT 590

Query: 629  YFEFGTIGGSASTNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAIFIYTDVLLYNAKL 688
            +FEFGT+ G+   NG ++F+VA+ILYQSLVPISLYIS+EIIKTAQA FIY DVLLYN KL
Sbjct: 591  FFEFGTVAGTPFANGILAFFVALILYQSLVPISLYISIEIIKTAQAAFIYGDVLLYNPKL 650

Query: 689  DYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKR 748
            DYPCTP++WNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKR
Sbjct: 651  DYPCTPRTWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKR 710

Query: 749  QGVDVESEGRREKEEIAKDRETMIDELRSMSDNTQFCPEDLTFVSKEIVEDLKGSSGDHQ 808
            QGVD+E EG RE+ EI +D++ M++ L  +  N+Q  P  +TFVSKE+V+DL G++   Q
Sbjct: 711  QGVDIEEEGARERAEIEEDKKQMVELLLKLGKNSQLDPHTVTFVSKELVQDLGGANSQEQ 770

Query: 809  QKCCEHFLLALALCHSVLVEPNKDDPKKLDIKAQSPDESALVSTARQLGYSFVGSSKSGL 868
            ++  EHF+L+LALCHSV+VE NK++P+KLDIKAQSPDE+ALV TAR +G+SFVG +K+G+
Sbjct: 771  KEAVEHFMLSLALCHSVVVEENKNNPEKLDIKAQSPDEAALVETARDMGFSFVGRTKNGV 830

Query: 869  IVEIQGVQKEFQVLNVLEFNSSRKRMSCIIKIPGSTPKDEPKALLICKGADSVIYSRLDR 928
            I+EIQGVQKEF++LNVLEFNS+RKRMSCI+KIP +    +PKALL+CKGADSVIYSRLDR
Sbjct: 831  IIEIQGVQKEFRILNVLEFNSTRKRMSCIVKIPAADENSKPKALLLCKGADSVIYSRLDR 890

Query: 929  TQNDATLLEKTALHLEEYATEGLRTLCLAQRELTWSEYERWVKTYDVAAASVTNREEELD 988
            ++ND  LLE+TALHLE++ATEGLRTLC+AQRE+ W EY  W +  ++AAAS+ NREE L+
Sbjct: 891  SRNDPKLLERTALHLEQFATEGLRTLCVAQREIDWDEYLNWNERRELAAASLDNREEALE 950

Query: 989  KVTDVIERELILLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCNV 1048
            +V D IER+L+LLGGTAIEDRLQDGVPDSI++LA+AGIKLWVLTGDKVETAINIGFSCN+
Sbjct: 951  RVADAIERQLVLLGGTAIEDRLQDGVPDSISILADAGIKLWVLTGDKVETAINIGFSCNL 1010

Query: 1049 LNNDMELLVVKASGEDVEEFGSDPIQVVNNLVTKYLREKFGMSGSEEELKEAKREHGLPQ 1108
            L +DMELLV+K+SGEDVE  G     VV  L+ KYL   F M GS EEL  A+++H  PQ
Sbjct: 1011 LGSDMELLVIKSSGEDVEHLGEKDSDVVLALIDKYLETHFNMKGSPEELAAARKDHTPPQ 1070

Query: 1109 GNFAVIIDGDALKVALNGEEMRRKFLLLCKNCKAVLCCRVSPXXXXXXXXXXXXTLDVMT 1168
              F V+IDGDALK+AL+GE++RRKFLLLCKNCKAVLCCRVSP            +LDV+T
Sbjct: 1071 SAFGVVIDGDALKLALHGEDIRRKFLLLCKNCKAVLCCRVSPSQKAAVVKLVKESLDVVT 1130

Query: 1169 LAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFRYVTRLVLVHGKWCYKRLA 1228
            LAIGDGSNDVAMIQ+ADVG+GIAGEEGRQAVM +DYAIGQFRY+TRLVLVHG+W YKRLA
Sbjct: 1131 LAIGDGSNDVAMIQAADVGIGIAGEEGRQAVMSADYAIGQFRYLTRLVLVHGRWSYKRLA 1190

Query: 1229 EMIPQFFYKNVIFTLSLFWYGIYNNFDGSYLFEYTYLTFYNLAFTSVPVILLAVLDQDVS 1288
            EMIPQFFYKN+ FTL+LFW+GI +N+DGSYLFEYTYL FYNLAFTS+PVI L ++DQD S
Sbjct: 1191 EMIPQFFYKNITFTLALFWFGICSNYDGSYLFEYTYLMFYNLAFTSLPVIFLGIMDQDAS 1250

Query: 1289 DTVSMLVPQLYRVGILRKEWNQTKFLWYMLDGVYQSVICFFFPYLAYHKNMVVTENGLGL 1348
            D +S++VPQLY+VGILR EW Q KF WY  DGVYQS+ICFFFPYL Y++  ++T+N  GL
Sbjct: 1251 DVLSVVVPQLYKVGILRTEWTQNKFWWYCFDGVYQSIICFFFPYLCYYRTGLITKNAYGL 1310

Query: 1349 DHRYFVGVFVTAIAVTSCNFYVFMEQYRWDWFCGLFICLSLAVFYGWTGIWTXXXXXNEF 1408
            DHRY  GVFVT+IAV SCN YV + QYRWDWF  LFI LS  + + WTG+W+      EF
Sbjct: 1311 DHRYTFGVFVTSIAVVSCNLYVLIHQYRWDWFTTLFIFLSCGILFFWTGVWSSATYSGEF 1370

Query: 1409 YKGAARVFAQPAYWAVLFVGVLFCLLPRFTIDCIRKIFYPKDIEIVREMWLRGDFDLYPQ 1468
            YK A R++AQP +WAVLFVGV+FCLLPRFT D ++K+F+P+DI+IVRE W RGDFD+YP+
Sbjct: 1371 YKTAVRLYAQPVFWAVLFVGVIFCLLPRFTWDAVQKLFFPRDIDIVRECWWRGDFDMYPE 1430

Query: 1469 GYDPTDPSRPRINEIRPLTDFKEPISLDTHFDGVSHSQETIVTEEIPMSILNGEQGSRKG 1528
             YDPTDP+RPRIN      D             +  ++ T+++E+IPM +++        
Sbjct: 1431 DYDPTDPNRPRINVSHTGVDRASDDERSRTGSDLGVTRTTVISEDIPMGLIDK------- 1483

Query: 1529 YRVSTTLERRDQLSPVTTTNNLPRRSMASARGNKLRTSLDRTREEMLANHQLDTR 1583
               +    R D  +P+ + ++              R SL+ TR EML  HQLD+R
Sbjct: 1484 ---TAPHSRADPTTPLGSEDS-------------ARYSLEVTRREMLQTHQLDSR 1522

>KLLA0A04015g complement(355624..359655) similar to sp|P39524
            Saccharomyces cerevisiae YAL026c DRS2 P-type
            amino-phospholipids-ATPase, start by similarity
          Length = 1343

 Score =  648 bits (1672), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/1057 (36%), Positives = 580/1057 (54%), Gaps = 104/1057 (9%)

Query: 438  FAKDYWKNVKVGDIVRVHNNDEIPADMILLSTSDVDGACYVETKNLDGETNLKVRQSLKC 497
            F +  W ++ VGDI+RV + + IPAD+I+LS+S+ +G CY+ET NLDGETNLK++Q+ + 
Sbjct: 298  FVRKKWIDIAVGDIIRVRSEEAIPADLIILSSSEPEGLCYIETANLDGETNLKIKQARQE 357

Query: 498  SKIIKSSRDITRTKFWVESEGPHANLYSYQGNFKWQDTQNGNIRNEPVNINNLLLRGCTL 557
            +      + + +    V+SE P+++LY+Y+G      T NG+    P++ + +LLRG TL
Sbjct: 358  TANYLDEKALCKLHGRVQSEHPNSSLYTYEGTM----TLNGS--TFPLSPDQMLLRGATL 411

Query: 558  RNTKWAMGMVIFTGDDTKIMINAGVTPTKKSRISRELNFSVILNFVLLFILCFTAGIVNG 617
            RNT W  G+++FTG +TK+M NA  TP K++ + R +N  ++  F +L +L   +   N 
Sbjct: 412  RNTAWIFGLIVFTGHETKLMRNATATPIKRTAVERVINMQILALFGVLIVLALISSTGNV 471

Query: 618  VYYKQKPRSRDYFEF-GTIGGSASTNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAIF 676
            +  K+      Y    GT          ++FW   IL+ +LVPISL+++VE+IK  QA  
Sbjct: 472  IMTKRDSAHLGYLYIEGTNKAGLFFKDILTFW---ILFSNLVPISLFVTVEMIKYYQAYM 528

Query: 677  IYTDVLLYNAKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGR 736
            I +D+ LY+ + D P   ++ ++ ++LGQIEYIFSDKTGTLT+NVMEFK  +I G    R
Sbjct: 529  IGSDLDLYHEESDTPTVVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSVSIAG----R 584

Query: 737  AYTEALAGLRKRQGVDVESEGRREKEEIAKDRETMIDELRSMSDNTQFCPEDLTFVSKEI 796
             Y E                       I +DR   +++             ++ F S E 
Sbjct: 585  CYIET----------------------IPEDRRATVED-----------GIEIGFHSFES 611

Query: 797  VEDLKGSSGDHQQKCCEHFLLALALCHSVLVEPNKDDPKKLDIKAQSPDESALVSTARQL 856
            ++D      D +      FL  LA CH+V+ E   D   K   +A SPDE ALV  A  L
Sbjct: 612  LKDKMTDPEDDEAGIVIEFLTLLATCHTVIPETQSDGTIKY--QAASPDEGALVQGAADL 669

Query: 857  GYSF-VGSSKSGLIVEIQGVQKEFQVLNVLEFNSSRKRMSCIIKIPGSTPKDEPKALLIC 915
            G+ F +    S  I      Q E+Q+LN+ EFNS+RKRMS I ++P  + K      L C
Sbjct: 670  GFRFDIRRPNSVSISTPFSEQLEYQLLNICEFNSTRKRMSAIFRMPDGSIK------LFC 723

Query: 916  KGADSVIYSRLDRTQNDATLLEKTALHLEEYATEGLRTLCLAQRELTWSEYERWVKTYDV 975
            KGAD+VI  RLD   N    ++ T  HLE+YA EGLRTLC+A R +   EYE W K Y+ 
Sbjct: 724  KGADTVILERLDSEFN--PYVQSTLRHLEDYAAEGLRTLCIASRTIPEKEYEEWSKIYEA 781

Query: 976  AAASVTNREEELDKVTDVIERELILLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDK 1035
            A+ ++ +R EELD+  ++IE +L  LG TAIED+LQ+GVP++I  L EAG+K+WVLTGD+
Sbjct: 782  ASTTMKDRTEELDRAAELIEHDLFFLGATAIEDKLQEGVPETIHHLQEAGLKVWVLTGDR 841

Query: 1036 VETAINIGFSCNVLNNDMELLVVKASGEDVEEFGSDPIQVVNNLVTKYLREKFGMSGSEE 1095
             ETAINIG SC +L+ DM LL+V    E+ +E          NL +K             
Sbjct: 842  QETAINIGMSCRLLSEDMNLLIVN---EETKE------DTRTNLQSKL------------ 880

Query: 1096 ELKEAKREHGLPQ---GNFAVIIDGDALKVALNGEEMRRKFLLLCKNCKAVLCCRVSPXX 1152
                A   H + Q    + A++IDG +L  AL  E++  +FL + K CKAV+CCRVSP  
Sbjct: 881  ---NAIESHQISQQDMNSLALVIDGKSLGYALE-EDLEDQFLTIGKLCKAVICCRVSPLQ 936

Query: 1153 XXXXXXXXXXTLDVMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFRYV 1212
                          + LAIGDG+NDV+MIQ+A VGVGI+G EG QA   +D+AIGQFR++
Sbjct: 937  KALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADFAIGQFRFL 996

Query: 1213 TRLVLVHGKWCYKRLAEMIPQFFYKNVIFTLSLFWYGIYNNFDGSYLFEYTYLTFYNLAF 1272
             +L++VHG W Y+R++  I   FYKN+   ++ FWY   N F G  + E   LTFYN+ F
Sbjct: 997  RKLLIVHGSWSYQRISLAILYSFYKNMALYMTQFWYVFANAFSGQSIMESWTLTFYNVFF 1056

Query: 1273 TSVPVILLAVLDQDVSDTVSMLVPQLYRVGILRKEWNQTKFLWYMLDGVYQSVICFFFPY 1332
            T +P  ++ + DQ V+  +    PQLY++G   + ++ T F  ++L+G Y S + F    
Sbjct: 1057 TVMPPFVIGIFDQFVTSRLLDRYPQLYKLGQKGQFFSVTIFWGWVLNGFYHSAVVFIGSV 1116

Query: 1333 LAYHKNMVVTENGLGLDHRYF-VGVFVTAIAVTSCNFYVFMEQYRWDWFCGLFICLSLAV 1391
            L Y     +   G   DH  + VG++ T+I +      +   Q  W  F  + I  SL +
Sbjct: 1117 LFYRYGNCLNMGGETADHWVWGVGIYTTSIIIVLGKAALITSQ--WTKFTLVAIPGSLVI 1174

Query: 1392 ----FYGWTGIWTXXXXXNEFYKGAARVFAQPAYWAVLFVGVLFCLLPRFTIDCIRKIFY 1447
                F  ++ ++       E+Y     V+    +W +  V  +F LL  F     ++ + 
Sbjct: 1175 WLLFFPFYSAVFPRVNVSKEYYGIIGHVYGSATFWLMCIVLPVFALLRDFVWKYYKRTYS 1234

Query: 1448 PKDIEIVREMWLRGDFDLYPQGYDPTDPSRPRINEIR 1484
            P+   +V+EM          Q Y+ +D  RPR+ + +
Sbjct: 1235 PESYHVVQEM----------QKYNISD-YRPRMEQFQ 1260

 Score = 60.8 bits (146), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 40/126 (31%), Positives = 62/126 (49%), Gaps = 8/126 (6%)

Query: 201 RSDELRTVYYNLPLPEDMLDEDGLPLAVYPRNKIRTTKYTPLTFFPKNILFQFHNFANIY 260
           +SDE RT+  N        D        Y  N I TTKY   TF PK +  +F  +AN++
Sbjct: 182 KSDEPRTILLN--------DSSANSRFGYRDNHISTTKYNAATFLPKFLFQEFSKYANLF 233

Query: 261 FLILLILGAFQIFGVTNPGFASVPLIVIVIITAIKDGIEDSRRTVLDLEVNNTRTHILSG 320
           FL   I+        TN       L+V++I++A+K+ +ED +R+  D E+N++   +L  
Sbjct: 234 FLFTSIIQQVPNVTPTNRYTTIGTLLVVLIVSAVKESVEDLKRSNADKELNHSLCDVLDE 293

Query: 321 VKNENV 326
              E V
Sbjct: 294 RSGEFV 299

>Kwal_26.7070
          Length = 1315

 Score =  647 bits (1668), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/1060 (36%), Positives = 580/1060 (54%), Gaps = 109/1060 (10%)

Query: 438  FAKDYWKNVKVGDIVRVHNNDEIPADMILLSTSDVDGACYVETKNLDGETNLKVRQS-LK 496
            F    W N+ VGDI++V++ + IPAD+I++++S+ +G CY+ET NLDGETNLK++Q+ ++
Sbjct: 293  FTLSKWVNISVGDIIKVNSEEAIPADVIVIASSEPEGLCYIETANLDGETNLKIKQARIE 352

Query: 497  CSKIIKSSRDITRTKFWVESEGPHANLYSYQGNFKWQDTQNGNIRNEPVNINNLLLRGCT 556
             SK I    D+   +  V SE P+++LY+Y+G      T N N +N  ++   ++LRG T
Sbjct: 353  TSKFIDKD-DLAGMRGKVLSEHPNSSLYTYEG------TMNLNGKNISLSPEQMVLRGAT 405

Query: 557  LRNTKWAMGMVIFTGDDTKIMINAGVTPTKKSRISRELNFSVILNFVLLFILCFTAGIVN 616
            LRNT W  G+V+FTG +TK+M NA  TP K++ + R +N  ++  F +L +L   + I N
Sbjct: 406  LRNTAWIYGLVVFTGHETKLMRNATATPIKRTAVERVINMQIVALFGVLIVLALISSIGN 465

Query: 617  GVYYKQKPRSRDYFEF-GTIGGSASTNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAI 675
             +          Y    GT          +++W   IL+ +LVPISL+++VE+IK  QA 
Sbjct: 466  VIKVTSDAEHLTYLYLQGTNKVGLFFKDILTYW---ILFSNLVPISLFVTVEMIKYYQAY 522

Query: 676  FIYTDVLLYNAKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYG 735
             I +D+ LY+   D P   ++ ++ ++LGQIEYIFSDKTGTLT+NVMEFK C+I G  Y 
Sbjct: 523  MIASDLDLYDEASDSPTVVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSCSIAGKCYI 582

Query: 736  RAYTEALAGLRKRQGVDVESEGRREKEEIAKDRETMIDELRSMSDNTQFCPEDLTFVSKE 795
                E  A   +  G+++   G R+            D ++   ++TQ            
Sbjct: 583  ETIPEDKAATTE-DGIEI---GFRK-----------FDSMKETLNDTQ------------ 615

Query: 796  IVEDLKGSSGDHQQKCCEHFLLALALCHSVLVEPNKDDPKKLDIKAQSPDESALVSTARQ 855
                      D        FL  LA CH+V+ E  +D   K   +A SPDE ALV  A  
Sbjct: 616  ----------DPDSHIINDFLTLLATCHTVIPEFQEDGSIKY--QAASPDEGALVEGAAS 663

Query: 856  LGYSFV--GSSKSGLIVEIQGVQKEFQVLNVLEFNSSRKRMSCIIKIPGSTPKDEPKALL 913
            LGY F+    +   +++E  G ++E+Q+LN+ EFNS+RKRMS I ++P    K      L
Sbjct: 664  LGYKFIIRKPNSVSVLIEDLGQEQEYQLLNICEFNSTRKRMSAIFRLPNGEIK------L 717

Query: 914  ICKGADSVIYSRLDRTQNDATLLEKTALHLEEYATEGLRTLCLAQRELTWSEYERWVKTY 973
             CKGAD+VI  RL   +N    +E T  HLE+YA EGLRTLCLA R +T SEY  W   Y
Sbjct: 718  FCKGADTVILERLKAGEN--PYIEATLRHLEDYAAEGLRTLCLASRTVTESEYAEWKDIY 775

Query: 974  DVAAASVTNREEELDKVTDVIERELILLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTG 1033
            D A+ ++ +R ++LD   ++IE++L LLG TAIED+LQDGVP++I  L +AGIK+WVLTG
Sbjct: 776  DAASTTLDDRAQKLDDAAELIEKDLFLLGATAIEDKLQDGVPETIHTLQDAGIKVWVLTG 835

Query: 1034 DKVETAINIGFSCNVLNNDMELLVVKASGEDVEEFGSDPIQVVNNLVTKYLREKFGMSGS 1093
            D+ ETA+NIG SC +L+ DM LL++    ED E               K L EK      
Sbjct: 836  DRQETAVNIGMSCRLLSEDMNLLIINE--EDKEA------------TRKNLTEKL----- 876

Query: 1094 EEELKEAKREHGLPQ---GNFAVIIDGDALKVALNGEEMRRKFLLLCKNCKAVLCCRVSP 1150
                 +A  +H + Q    + A++IDG +L  AL  + +    L + K CKAV+CCRVSP
Sbjct: 877  -----KAISDHQISQQDMNSLALVIDGKSLGFALEAD-LEDYLLAIGKLCKAVICCRVSP 930

Query: 1151 XXXXXXXXXXXXTLDVMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFR 1210
                          D + LAIGDG+NDV+MIQ+A VGVGI+G EG QA   +D+AI QF+
Sbjct: 931  LQKALVVKMVKRKTDSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADFAIAQFK 990

Query: 1211 YVTRLVLVHGKWCYKRLAEMIPQFFYKNVIFTLSLFWYGIYNNFDGSYLFEYTYLTFYNL 1270
            Y+ +L+LVHG W Y+R+++ I   FYKN+   ++ FWY   N + G  + E   +TFYN+
Sbjct: 991  YLKKLLLVHGSWSYQRISQAILYSFYKNIALYMTQFWYVFANAYSGQSIMESWTMTFYNV 1050

Query: 1271 AFTSVPVILLAVLDQDVSDTVSMLVPQLYRVGILRKEWNQTKFLW-YMLDGVYQSVICFF 1329
             FT +P  ++ V DQ VS  +    PQLY++G  R ++   +  W ++++G Y S + F 
Sbjct: 1051 FFTVLPPFVMGVFDQFVSSRLLDRYPQLYKLG-QRGQFFSVRIFWGWVINGFYHSAVTFI 1109

Query: 1330 FPYLAYHKNMVVTENGLGLDH-RYFVGVFVTAIAVTSCNFYVFMEQYRWDWFCGLFICLS 1388
               L Y    V+  +G   DH  + V ++  ++ +      +   Q  W  F    I  S
Sbjct: 1110 GSTLFYRNGNVLNSHGETADHWAWGVSIYTCSVIIVIGKAALVTNQ--WTKFTAFAIPGS 1167

Query: 1389 LA---VFYG-WTGIWTXXXXXNEFYKGAARVFAQPAYWAVLFVGVLFCLLPRFTIDCIRK 1444
            L    VF+  +  I        E+Y   + V+    +W +  V   F L+        ++
Sbjct: 1168 LVFWLVFFPIYASILPHANVSKEYYGVVSHVYGSATFWLMCIVLPTFALMRDLVWKYYKR 1227

Query: 1445 IFYPKDIEIVREMWLRGDFDLYPQGYDPTDPSRPRINEIR 1484
             + P+   +V+EM          Q Y+  D  RPRI + +
Sbjct: 1228 TYTPESYHVVQEM----------QKYNIGD-YRPRIEQFQ 1256

 Score = 57.4 bits (137), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 30/91 (32%), Positives = 50/91 (54%)

Query: 229 YPRNKIRTTKYTPLTFFPKNILFQFHNFANIYFLILLILGAFQIFGVTNPGFASVPLIVI 288
           +  N I TTKY   TF PK +  +F  +AN++FL    +        TN       L+++
Sbjct: 197 FGSNHISTTKYNLATFIPKFLFQEFSKYANLFFLFTSAIQQVPNVTPTNRYTTIGTLLIV 256

Query: 289 VIITAIKDGIEDSRRTVLDLEVNNTRTHILS 319
           +I++AIK+ +ED +R   D E+N++R  + S
Sbjct: 257 LIVSAIKEIVEDLKRAQSDSELNDSRAQVFS 287

>CAGL0G06270g 598357..602343 highly similar to sp|P39524 Saccharomyces
            cerevisiae YAL026c DRS2, start by similarity
          Length = 1328

 Score =  646 bits (1667), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/1060 (36%), Positives = 579/1060 (54%), Gaps = 105/1060 (9%)

Query: 435  ECRFAKDYWKNVKVGDIVRVHNNDEIPADMILLSTSDVDGACYVETKNLDGETNLKVRQS 494
            E  F +  W ++KVGDI+RV++ + IPAD+I+LS+S+ +G CY+ET NLDGETNLK++Q+
Sbjct: 274  EGDFIQKRWIDIKVGDIIRVNSEEPIPADIIILSSSEPEGLCYIETANLDGETNLKIKQA 333

Query: 495  LKCSKIIKSSRDITRTKFWVESEGPHANLYSYQGNFKWQDTQNGNIRNEPVNINNLLLRG 554
               +  I  SR++   K  + SE P+++LY+Y+G  +   T+       P++   ++LRG
Sbjct: 334  RTETAKIMDSRELRNIKGVISSEQPNSSLYTYEGTLEMNGTKI------PLSPEQMILRG 387

Query: 555  CTLRNTKWAMGMVIFTGDDTKIMINAGVTPTKKSRISRELNFSVILNFVLLFILCFTAGI 614
             TLRNT W  G+VIFTG +TK+M NA  TP K++ + + +N  +I  F +L +L   + I
Sbjct: 388  ATLRNTGWIFGIVIFTGHETKLMRNATATPIKRTAVEKVINMQIIALFTVLVVLILISSI 447

Query: 615  VNGVYYKQKPRSRDYFEF-GTIGGSASTNGFVSFWVAVILYQSLVPISLYISVEIIKTAQ 673
             N +      +   Y    GT         F++FW   IL+ +LVPISL+++VE+IK  Q
Sbjct: 448  GNVIMSTADAKHLSYLYLQGTNKAGLFFKDFLTFW---ILFSNLVPISLFVTVELIKYYQ 504

Query: 674  AIFIYTDVLLYNAKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVS 733
            A  I +D+ LY  + D P   K+ ++ ++LGQIEYIFSDKTGTLT+N+MEFK C+I G  
Sbjct: 505  AFMIGSDLDLYYEETDTPTVVKTSSLVEELGQIEYIFSDKTGTLTRNIMEFKSCSIAGRC 564

Query: 734  YGRAYTEALAGLRKRQGVDVESEGRREKEEIAKDRETMIDELRSMSDNTQFCPEDLTFVS 793
            Y     E  A   +  G++V   G R  +++ K           ++ N+  C        
Sbjct: 565  YAEHIPEDKAATFE-DGIEV---GYRSFDDLKK----------QLTTNSDDC-------- 602

Query: 794  KEIVEDLKGSSGDHQQKCCEHFLLALALCHSVLVEPNKDDPKKLDIKAQSPDESALVSTA 853
                            K  + FL  LA CH+V+ E   D   K   +A SPDE ALV   
Sbjct: 603  ----------------KIIDEFLTLLATCHTVIPEFQADGSIKY--QAASPDEGALVEGG 644

Query: 854  RQLGYSFVGSSKSGLIVEI-QGVQKEFQVLNVLEFNSSRKRMSCIIKIPGSTPKDEPKAL 912
              LGY F+    + + + I +  ++E+Q+LN+ EFNS+RKRMS I + P  + K      
Sbjct: 645  ALLGYKFLIRKPNSVTILINEEEEREYQLLNICEFNSTRKRMSAIFRFPDDSIK------ 698

Query: 913  LICKGADSVIYSRLDRTQNDATLLEKTALHLEEYATEGLRTLCLAQRELTWSEYERWVKT 972
            L+CKGADSVI  RL  T N    ++ T  HLE+YATEGLRTLCLA +++   EY  W K 
Sbjct: 699  LLCKGADSVILERLSETGN--FYVDATTRHLEDYATEGLRTLCLATKDIPEDEYNAWNKK 756

Query: 973  YDVAAASVTNREEELDKVTDVIERELILLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLT 1032
            Y  AA ++ +R E+LD V + IE  L L+G TAIED+LQ+GVPD+I  L EAGIK+WVLT
Sbjct: 757  YMDAATTLDHRAEKLDAVAEEIESGLTLIGATAIEDKLQEGVPDTIRTLQEAGIKIWVLT 816

Query: 1033 GDKVETAINIGFSCNVLNNDMELLVVKASGEDVEEFGSDPIQVVNNLVTKYLREKFGMSG 1092
            GDK ETAINIG SC +L+ DM LL++    E+ +E              + + EK     
Sbjct: 817  GDKQETAINIGMSCRLLSEDMNLLII---SEETKE-----------ATRRNMEEKLA--- 859

Query: 1093 SEEELKEAKREHGLPQGN---FAVIIDGDALKVALNGEEMRRKFLLLCKNCKAVLCCRVS 1149
                   A  EH L + +    A++IDG +L  AL  + +   FL + K CKAV+CCRVS
Sbjct: 860  -------ALHEHSLSEHDMNTLALVIDGHSLSFALEAD-LEDYFLAIGKMCKAVICCRVS 911

Query: 1150 PXXXXXXXXXXXXTLDVMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQF 1209
            P              + + LAIGDG+NDV+MIQ+A VGVGI+G EG QA   +D ++GQF
Sbjct: 912  PLQKALVVKMVKRKTNSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADISVGQF 971

Query: 1210 RYVTRLVLVHGKWCYKRLAEMIPQFFYKNVIFTLSLFWYGIYNNFDGSYLFEYTYLTFYN 1269
            R++ +L+LVHG W Y+R++  I   FYKN    ++ FWY   N F G  + E   ++ YN
Sbjct: 972  RFLKKLLLVHGAWSYQRISVAILYSFYKNTALYMTQFWYVFANAFSGQSIMESWTMSLYN 1031

Query: 1270 LAFTSVPVILLAVLDQDVSDTVSMLVPQLYRVGILRKEWNQTKFLWYMLDGVYQSVICFF 1329
            + FT +P  ++ V DQ V+  +    PQLY++G   + ++ + F  ++++G Y S + F 
Sbjct: 1032 VFFTVLPPFVIGVFDQFVNSRLLERYPQLYKLGQKGQFFSVSIFWGWIVNGFYHSAVVFV 1091

Query: 1330 FPYLAYHKNMVVTENGLGLDH-RYFVGVFVTAIAVTSCNFYVFMEQY-RWDWFC---GLF 1384
               L Y     + ++G   DH  + + ++ +++ +      +   Q+ ++  F     LF
Sbjct: 1092 GTILFYRYGFALRKHGETADHWSWGIAIYTSSVIIVLGKAALVTNQWTKFTLFAIPGSLF 1151

Query: 1385 ICLSLAVFYGWTGIWTXXXXXNEFYKGAARVFAQPAYWAVLFVGVLFCLLPRFTIDCIRK 1444
              L     YG   I+       E++      +    +W  L V   F L   F     ++
Sbjct: 1152 FWLIFFPIYG--SIFPYAKISREYFGVVEHTYGSATFWLTLIVLPTFALTRDFIWKYYKR 1209

Query: 1445 IFYPKDIEIVREMWLRGDFDLYPQGYDPTDPSRPRINEIR 1484
            ++ P+   +++EM          Q Y+ +D  RP +   +
Sbjct: 1210 MYAPESYHLIQEM----------QKYNVSD-YRPHVQHFQ 1238

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 32/89 (35%), Positives = 49/89 (55%)

Query: 229 YPRNKIRTTKYTPLTFFPKNILFQFHNFANIYFLILLILGAFQIFGVTNPGFASVPLIVI 288
           Y  N I TTKY   TF PK +  +F  +AN++FL    +        TN       L+V+
Sbjct: 181 YIDNHISTTKYNAATFLPKFLFQEFSKYANLFFLCTSAIQQVPHVSPTNRYTTIGTLMVV 240

Query: 289 VIITAIKDGIEDSRRTVLDLEVNNTRTHI 317
           +I++AIK+ +ED +R   D E+NN++  I
Sbjct: 241 LIVSAIKESVEDLKRASSDNELNNSKAEI 269

>YAL026C (DRS2) [42] chr1 complement(95633..99700) Membrane-spanning
            Ca-ATPase (P-type) required for ribosome assembly and
            involved in late Golgi function, member of the cation
            transporting (E1-E2) P-type ATPase superfamily [4068 bp,
            1355 aa]
          Length = 1355

 Score =  644 bits (1662), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/1094 (36%), Positives = 585/1094 (53%), Gaps = 117/1094 (10%)

Query: 409  LNQTMSQANRYNDGENLVDRTLQPNPECR--FAKDYWKNVKVGDIVRVHNNDEIPADMIL 466
            + + +    R N  + L + T +   E    F +  W +++VGDI+RV + + IPAD I+
Sbjct: 263  MKECIEDIKRANSDKELNNSTAEIFSEAHDDFVEKRWIDIRVGDIIRVKSEEPIPADTII 322

Query: 467  LSTSDVDGACYVETKNLDGETNLKVRQS-LKCSKIIKSSRDITRTKFWVESEGPHANLYS 525
            LS+S+ +G CY+ET NLDGETNLK++QS ++ +K I   + +      V SE P+++LY+
Sbjct: 323  LSSSEPEGLCYIETANLDGETNLKIKQSRVETAKFI-DVKTLKNMNGKVVSEQPNSSLYT 381

Query: 526  YQGNFKWQDTQNGNIRNEPVNINNLLLRGCTLRNTKWAMGMVIFTGDDTKIMINAGVTPT 585
            Y+G     D      R  P++ + ++LRG TLRNT W  G+VIFTG +TK++ NA  TP 
Sbjct: 382  YEGTMTLND------RQIPLSPDQMILRGATLRNTAWIFGLVIFTGHETKLLRNATATPI 435

Query: 586  KKSRISRELNFSVILNFVLLFILCFTAGIVNGVYYKQKPRSRDYFEF-GTIGGSASTNGF 644
            K++ + + +N  +I  F +L +L   + I N +      +   Y    GT         F
Sbjct: 436  KRTAVEKIINRQIIRLFTVLIVLILISSIGNVIMSTADAKHLSYLYLEGTNKAGLFFKDF 495

Query: 645  VSFWVAVILYQSLVPISLYISVEIIKTAQAIFIYTDVLLYNAKLDYPCTPKSWNISDDLG 704
            ++FW   IL+ +LVPISL+++VE+IK  QA  I +D+ LY  K D P   ++ ++ ++LG
Sbjct: 496  LTFW---ILFSNLVPISLFVTVELIKYYQAFMIGSDLDLYYEKTDTPTVVRTSSLVEELG 552

Query: 705  QIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQGVDVESEGRREKEEI 764
            QIEYIFSDKTGTLT+N+MEFK C+I G  Y                           ++I
Sbjct: 553  QIEYIFSDKTGTLTRNIMEFKSCSIAGHCY--------------------------IDKI 586

Query: 765  AKDRETMIDELRSMSDNTQFCPEDLTFVSKEIVEDLK---GSSGDHQQKCCEHFLLALAL 821
             +D+   +              ED   V     +DLK       D        FL  LA 
Sbjct: 587  PEDKTATV--------------EDGIEVGYRKFDDLKKKLNDPSDEDSPIINDFLTLLAT 632

Query: 822  CHSVLVEPNKDDPKKLDIKAQSPDESALVSTARQLGYSFV---GSSKSGLIVEIQGVQKE 878
            CH+V+ E   D   K   +A SPDE ALV     LGY F+   G+S + L+ E  G +KE
Sbjct: 633  CHTVIPEFQSDGSIKY--QAASPDEGALVQGGADLGYKFIIRKGNSVTVLLEE-TGEEKE 689

Query: 879  FQVLNVLEFNSSRKRMSCIIKIPGSTPKDEPKALLICKGADSVIYSRLDRTQNDATLLEK 938
            +Q+LN+ EFNS+RKRMS I + P  + K      L CKGAD+VI  RLD   N    +E 
Sbjct: 690  YQLLNICEFNSTRKRMSAIFRFPDGSIK------LFCKGADTVILERLDDEANQ--YVEA 741

Query: 939  TALHLEEYATEGLRTLCLAQRELTWSEYERWVKTYDVAAASVTNREEELDKVTDVIEREL 998
            T  HLE+YA+EGLRTLCLA R+++  EYE W   Y+ AA ++ NR E+LD+  ++IE+ L
Sbjct: 742  TMRHLEDYASEGLRTLCLAMRDISEGEYEEWNSIYNEAATTLDNRAEKLDEAANLIEKNL 801

Query: 999  ILLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCNVLNNDMELLVV 1058
            IL+G TAIED+LQDGVP++I  L EAGIK+WVLTGD+ ETAINIG SC +L+ DM LL++
Sbjct: 802  ILIGATAIEDKLQDGVPETIHTLQEAGIKIWVLTGDRQETAINIGMSCRLLSEDMNLLII 861

Query: 1059 KASGEDVEEFGSDPIQVVNNLVTKYLREKFGMSGSEEELKEAKREHGLPQGN---FAVII 1115
                 D  E          NL+ K                 A  EH L   +    A++I
Sbjct: 862  NEETRDDTE---------RNLLEKI---------------NALNEHQLSTHDMKSLALVI 897

Query: 1116 DGDALKVALNGEEMRRKFLLLCKNCKAVLCCRVSPXXXXXXXXXXXXTLDVMTLAIGDGS 1175
            DG +L  AL   E+    L + K CKAV+CCRVSP                + LAI  G+
Sbjct: 898  DGKSLGFALE-PELEDYLLTVAKLCKAVICCRVSPLQKALVVKMVKRKSSSLLLAIASGA 956

Query: 1176 NDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFRYVTRLVLVHGKWCYKRLAEMIPQFF 1235
            NDV+MIQ+A VGVGI+G EG QA   +D A+GQF+++ +L+LVHG W Y+R++  I   F
Sbjct: 957  NDVSMIQAAHVGVGISGMEGMQAARSADIALGQFKFLKKLLLVHGSWSYQRISVAILYSF 1016

Query: 1236 YKNVIFTLSLFWYGIYNNFDGSYLFEYTYLTFYNLAFTSVPVILLAVLDQDVSDTVSMLV 1295
            YKN    ++ FWY   N F G  + E   ++FYNL FT  P  ++ V DQ VS  +    
Sbjct: 1017 YKNTALYMTQFWYVFANAFSGQSIMESWTMSFYNLFFTVWPPFVIGVFDQFVSSRLLERY 1076

Query: 1296 PQLYRVGILRKEWNQTKFLWYMLDGVYQSVICFFFPYLAYHKNMVVTENGLGLDH-RYFV 1354
            PQLY++G   + ++   F  ++++G + S I F    L Y     +  +G   DH  + V
Sbjct: 1077 PQLYKLGQKGQFFSVYIFWGWIINGFFHSAIVFIGTILIYRYGFALNMHGELADHWSWGV 1136

Query: 1355 GVFVTAIAVTSCNFYVFMEQYRWDWFCGLFICLSL---AVFYG-WTGIWTXXXXXNEFYK 1410
             V+ T++ +      +   Q  W  F  + I  SL    +F+  +  I+       E+Y 
Sbjct: 1137 TVYTTSVIIVLGKAALVTNQ--WTKFTLIAIPGSLLFWLIFFPIYASIFPHANISREYYG 1194

Query: 1411 GAARVFAQPAYWAVLFVGVLFCLLPRFTIDCIRKIFYPKDIEIVREMWLRGDFDLYPQGY 1470
                 +    +W  L V  +F L+  F     ++++ P+   +++EM          Q Y
Sbjct: 1195 VVKHTYGSGVFWLTLIVLPIFALVRDFLWKYYKRMYEPETYHVIQEM----------QKY 1244

Query: 1471 DPTDPSRPRINEIR 1484
            + +D SRP + + +
Sbjct: 1245 NISD-SRPHVQQFQ 1257

 Score = 58.5 bits (140), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 34/98 (34%), Positives = 52/98 (53%)

Query: 229 YPRNKIRTTKYTPLTFFPKNILFQFHNFANIYFLILLILGAFQIFGVTNPGFASVPLIVI 288
           Y  N I TTKY   TF PK +  +F  +AN++FL    +        TN       L+V+
Sbjct: 198 YSDNHISTTKYNFATFLPKFLFQEFSKYANLFFLCTSAIQQVPHVSPTNRYTTIGTLLVV 257

Query: 289 VIITAIKDGIEDSRRTVLDLEVNNTRTHILSGVKNENV 326
           +I++A+K+ IED +R   D E+NN+   I S   ++ V
Sbjct: 258 LIVSAMKECIEDIKRANSDKELNNSTAEIFSEAHDDFV 295

>ADR350W [2091] [Homologous to ScYAL026C (DRS2) - SH]
            complement(1320732..1324667) [3936 bp, 1311 aa]
          Length = 1311

 Score =  621 bits (1601), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/1058 (36%), Positives = 575/1058 (54%), Gaps = 103/1058 (9%)

Query: 437  RFAKDYWKNVKVGDIVRVHNNDEIPADMILLSTSDVDGACYVETKNLDGETNLKVRQSLK 496
            +F    W ++ VGDI+RV + + IPAD+I+LS+S+ +G CY+ET NLDGETNLK++Q+  
Sbjct: 289  QFISKKWIDIAVGDIIRVRSEEAIPADLIVLSSSEPEGLCYIETANLDGETNLKIKQARP 348

Query: 497  CSKIIKSSRDITRTKFWVESEGPHANLYSYQGNFKWQDTQNGNIRNEPVNINNLLLRGCT 556
             +  I   R+++  +  + SE P+ +LY+Y+G        N  I   P++ + +LLRG T
Sbjct: 349  ETSKILDVRELSAMRGKILSEQPNTSLYTYEGTMI---LHNNRI---PLSPDQILLRGAT 402

Query: 557  LRNTKWAMGMVIFTGDDTKIMINAGVTPTKKSRISRELNFSVILNFVLLFILCFTAGIVN 616
            LRNT W  G+VIFTG +TK+  NA  TP K++ + R +N  ++  F +L  L   +   N
Sbjct: 403  LRNTVWIFGIVIFTGHETKLTRNATATPIKRTAVERVINLQIVALFGVLICLSLISSFGN 462

Query: 617  G-VYYKQKPRSRDYFEFGTIGGSASTNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAI 675
              V Y QK      +  GT   +      ++FW   IL+ +LVPISL+++VE+IK  QA 
Sbjct: 463  LIVMYNQKENLSYLYLQGTNMVALFFKNILTFW---ILFSNLVPISLFVTVEMIKYYQAY 519

Query: 676  FIYTDVLLYNAKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYG 735
             I +D+ L++ + + P   ++ ++ ++LGQIEYIFSDKTGTLTQNVMEFK C+I G    
Sbjct: 520  MIASDLDLFHEESNMPTVVRTSSLVEELGQIEYIFSDKTGTLTQNVMEFKSCSIAG---- 575

Query: 736  RAYTEALAGLRKRQGVDVESEGRREKEEIAKDRETMIDELRSMSDNTQFCPEDLTFVSKE 795
            R Y ++                      I +D++   DE             ++ + + +
Sbjct: 576  RCYIQS----------------------IPEDKDAAFDE-----------GIEVGYRTYD 602

Query: 796  IVEDLKGSSGDHQQKCCEHFLLALALCHSVLVEPNKDDPKKLDIKAQSPDESALVSTARQ 855
             + +L  + G       + FL  L++CH+V+  P   +   +  +A SPDE ALV  A  
Sbjct: 603  DMHELLHTPGSGDGAIIDEFLTLLSICHTVI--PEFQENGSIKYQAASPDEGALVQGAAD 660

Query: 856  LGYSFVGSSKSGLIVEIQGVQKE--FQVLNVLEFNSSRKRMSCIIKIPGSTPKDEPKALL 913
            LGY F+    + + +  + + +E  +++LN+ EFNS+RKRMS I + P ++ +      L
Sbjct: 661  LGYKFIIRKPNSVTILREDITEEVVYELLNICEFNSTRKRMSAIFRFPDNSIR------L 714

Query: 914  ICKGADSVIYSRLDRTQNDATLLEKTALHLEEYATEGLRTLCLAQRELTWSEYERWVKTY 973
            +CKGAD+VI  RL  T N    +  T  HLE+YA EGLRTLC+A R +  SEYE W K Y
Sbjct: 715  LCKGADTVILERLAATSN--PYVAATLRHLEDYAAEGLRTLCIASRTIPESEYEEWSKLY 772

Query: 974  DVAAASVTNREEELDKVTDVIERELILLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTG 1033
            D AA ++ NR EELDKV ++IE+ L+LLG TAIED+LQDGVP++I  L +AGIK+WVLTG
Sbjct: 773  DAAATTMHNRSEELDKVAEMIEKGLVLLGATAIEDKLQDGVPETIHTLQQAGIKVWVLTG 832

Query: 1034 DKVETAINIGFSCNVLNNDMELLVVKASGEDVEEFGSDPIQVVNNLVTKYLREKFGMSGS 1093
            D+ ETAINIG SC +L+ DM LL+V    ED +E         NNL+ K LR        
Sbjct: 833  DRQETAINIGMSCKLLSEDMNLLIVN---EDTKE------STRNNLIDK-LR-------- 874

Query: 1094 EEELKEAKREHGLPQGN---FAVIIDGDALKVALNGEEMRRKFLLLCKNCKAVLCCRVSP 1150
                  A  +H + Q +    A++IDG +L  AL   ++    L + K C+AV+CCRVSP
Sbjct: 875  ------AINDHQISQQDMNTLALVIDGKSLGFALE-PDLEEFLLAIGKMCRAVICCRVSP 927

Query: 1151 XXXXXXXXXXXXTLDVMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFR 1210
                            + LAIGDG+NDV+MIQ+A VGVGI+G EG QA   +D+A+GQF+
Sbjct: 928  LQKALVVKMVKRRTKSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADFALGQFK 987

Query: 1211 YVTRLVLVHGKWCYKRLAEMIPQFFYKNVIFTLSLFWYGIYNNFDGSYLFEYTYLTFYNL 1270
            Y+ +L+LVHG W Y+R+++ I   FYKN+   ++ FWY +YN F G  + E   LTFYN 
Sbjct: 988  YLKKLLLVHGSWSYQRISQAILYSFYKNIALYMTQFWYVLYNAFSGQSIMESWTLTFYNW 1047

Query: 1271 AFTSVPVILLAVLDQDVSDTVSMLVPQLYRVGILRKEWNQTKFLWYMLDGVYQSVICFFF 1330
              T+ P       DQ     +     Q   VG   + W  T F    ++G Y + I    
Sbjct: 1048 GGTAAPPGPPKRRDQFERSGLLNRDAQSCTVGQKGQFWPATIFRGSAINGNYHNWITIDG 1107

Query: 1331 PYLAYHKNMVVTENGLGLDHRYFVGVFVTAIAVTSCNFYVFMEQYRWDWFCGLFICLSLA 1390
              + Y        +G   DH +  GV +   ++        +   +W  F  L I  SL 
Sbjct: 1108 WIMDYRYGAAGAMHGETADH-WVWGVAIQPTSIIFVLGKAALITNQWTKFTVLAIPGSLV 1166

Query: 1391 VFYGWTGIWTXXX----XXNEFYKGAARVFAQPAYWAVLFVGVLFCLLPRFTIDCIRKIF 1446
             +  +  I+           E+Y   + V+    +WA+ +V  +  LL        ++ +
Sbjct: 1167 FWLLFFPIYAYLLPGLNVSKEYYGIVSHVYGSFTFWAMCYVLPVLALLRDLLWKYYKRTY 1226

Query: 1447 YPKDIEIVREMWLRGDFDLYPQGYDPTDPSRPRINEIR 1484
             P+   +V+EM          Q YD +D +RPRI + +
Sbjct: 1227 TPESYHVVQEM----------QKYDISD-NRPRIEQFQ 1253

 Score = 62.4 bits (150), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 52/91 (57%)

Query: 229 YPRNKIRTTKYTPLTFFPKNILFQFHNFANIYFLILLILGAFQIFGVTNPGFASVPLIVI 288
           Y  N I TTKY   TF PK +  +F  +AN++FL   I+        TN       LIV+
Sbjct: 194 YGDNHISTTKYNAATFLPKFLFQEFSKYANLFFLFTSIIQQVPNVTPTNRFTTIGTLIVV 253

Query: 289 VIITAIKDGIEDSRRTVLDLEVNNTRTHILS 319
           ++++AIK+ +ED +R+  D E+N++R  + S
Sbjct: 254 LVVSAIKESVEDLKRSNSDKELNHSRADVYS 284

>YIL048W (NEO1) [2619] chr9 (261436..264891) Member of the Drs2p-like
            ATPases family in the superfamily of P-type ATPases,
            overproduction confers neomycin resistance [3456 bp, 1151
            aa]
          Length = 1151

 Score =  334 bits (857), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 287/1023 (28%), Positives = 476/1023 (46%), Gaps = 153/1023 (14%)

Query: 444  KNVKVGDIVRVHNNDEIPADMILLSTSDVDGACYVETKNLDGETNLKVRQSLKCSKIIKS 503
            K++KVGD+++VH  D IPAD++LL +S+  G  +++T  LDGET+ K+R +   ++ +  
Sbjct: 268  KDLKVGDLIKVHKGDRIPADLVLLQSSEPSGESFIKTDQLDGETDWKLRVACPLTQNLSE 327

Query: 504  SRDITRTKFWVESEGPHANLYSYQGNFKWQDTQNGNIRNEPVNINNLLLRGCTLRNTKWA 563
            +  I R    + +  P  +++ + G   ++D+ +      P++++N L     L ++ + 
Sbjct: 328  NDLINRIS--ITASAPEKSIHKFLGKVTYKDSTSN-----PLSVDNTLWANTVLASSGFC 380

Query: 564  MGMVIFTGDDTKIMINAGVTPTKKSRISRELN-FSVILN---FVLLFILCFTAGIVNGVY 619
            +  V++TG DT+  +N      K   +  E+N  S IL    F L  +L   AG  N  +
Sbjct: 381  IACVVYTGRDTRQAMNTTTAKVKTGLLELEINSISKILCACVFALSILLVAFAGFHNDDW 440

Query: 620  YKQKPRSRDYFEFGTIGGSASTNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAIFIYT 679
            Y                        +     +IL+ +++P+SL +++++ K+  A  I  
Sbjct: 441  Y------------------------IDILRYLILFSTIIPVSLRVNLDLAKSVYAHQIEH 476

Query: 680  DVLLYNAKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYT 739
            D      K       ++  I +DLG+IEY+ SDKTGTLTQN M+ KK  +  VSY     
Sbjct: 477  D------KTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSYTSETL 530

Query: 740  EALAGLRKRQGVDVESEGRREKEEIAKDRETMIDELRSMSDNTQFCPEDLTFVSKEIVED 799
            + ++   +             K  ++  R+ M   +R M                     
Sbjct: 531  DIVSDYVQSLVSSKNDSLNNSKVALSTTRKDMSFRVRDM--------------------- 569

Query: 800  LKGSSGDHQQKCCEHFLLALALCHSVLVEPNKDDPKKLDIKAQSPDESALVSTARQLGYS 859
                            +L LA+CH+  V P  +D  +L  +A SPDE A+V     +G S
Sbjct: 570  ----------------ILTLAICHN--VTPTFED-DELTYQAASPDEIAIVKFTESVGLS 610

Query: 860  FVGSSKS--GLIVEIQGVQKEFQVLNVLEFNSSRKRMSCIIKIPGSTPKDEP--KALLIC 915
                 +    L+ E  G    +++L V  FNS  KRM  I+       +DE   +   + 
Sbjct: 611  LFKRDRHSISLLHEHSGKTLNYEILQVFPFNSDSKRMGIIV-------RDEQLDEYWFMQ 663

Query: 916  KGADSVIYSRLDRTQNDATLLEKTALHLEEYATEGLRTLCLAQRELTWSEYERWVKTYDV 975
            KGAD+V+ S++   +++  L E+T       A EGLRTL + +++L    YE++ K Y+ 
Sbjct: 664  KGADTVM-SKI--VESNDWLEEETG----NMAREGLRTLVIGRKKLNKKIYEQFQKEYND 716

Query: 976  AAASVTNREEELDKV-TDVIERELILLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGD 1034
            A+ S+ NR++++ +V T  +E +L LLG T +ED+LQ  V  SI LL  AGIK+W+LTGD
Sbjct: 717  ASLSMLNRDQQMSQVITKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGD 776

Query: 1035 KVETAINIGFSCNVLNNDMELLVVKASGEDVEEFGSDPIQVVNNLVTKYLREKFGMSGSE 1094
            KVETA  +  S  ++          + G+ V              +TK  R + G     
Sbjct: 777  KVETARCVSISAKLI----------SRGQYVHT------------ITKVTRPE-GAFNQL 813

Query: 1095 EELKEAKREHGLPQGNFAVIIDGDALKVALNGEEMRRKFLLLCKNCKAVLCCRVSPXXXX 1154
            E LK  +        N  ++IDG++L + L   E  ++F  +  +   V+ CR +P    
Sbjct: 814  EYLKINR--------NACLLIDGESLGMFLKHYE--QEFFDVVVHLPTVIACRCTPQQKA 863

Query: 1155 XXXXXXXXTLDVMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFRYVTR 1214
                            IGDG NDV+MIQ ADVGVGI G+EG+QA + +D++I QF ++T 
Sbjct: 864  DVALVIRKMTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQFCHLTE 923

Query: 1215 LVLVHGKWCYKRLAEMIPQFFYKNVIFTLSLFWYGIYNNFDGSYLFEYTYLTFYNLAFTS 1274
            L+L HG+  YKR A++     ++ +I  +    Y I + F+   L++   +  Y   +T 
Sbjct: 924  LLLWHGRNSYKRSAKLAQFVMHRGLIIAICQAVYSICSLFEPIALYQGWLMVGYATCYTM 983

Query: 1275 VPVILLAVLDQDVSDTVSMLVPQLYRVGILRKEWN-QTKFLWYMLDGVYQSVICFFFPYL 1333
             PV  L  LD D+ ++++ + P+LY+     K  + +T F+W +L     SVI  F    
Sbjct: 984  APVFSLT-LDHDIEESLTKIYPELYKELTEGKSLSYKTFFVWVLLSLFQGSVIQLFSQAF 1042

Query: 1334 AYHKNMVVTENGLGLDHRYFVGVFVTAIAVTSCNFYVFMEQYRWDWFCGLFICLSLAVFY 1393
                      + L  D    V +  TA+ V      V +E Y W+    L   ++  +FY
Sbjct: 1043 T---------SLLDTDFTRMVAISFTALVVNEL-IMVALEIYTWNK-TMLVTEIATLLFY 1091

Query: 1394 GWTGIWTXXXXXNEFYKGAARVFAQPAYWAVLFVGVLFCLLPRFTIDCIRKIFYPKDIEI 1453
                I +     + F  G         Y+A L V +L  + P +T   I +  +P     
Sbjct: 1092 ----IVSVPFLGDYFDLG---YMTTVNYYAGLLVILLISIFPVWTAKAIYRRLHPPSYAK 1144

Query: 1454 VRE 1456
            V+E
Sbjct: 1145 VQE 1147

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 46/91 (50%)

Query: 229 YPRNKIRTTKYTPLTFFPKNILFQFHNFANIYFLILLILGAFQIFGVTNPGFASVPLIVI 288
           Y  N++   KY  +TF P  +  QF  F N+YFL++ +  A     +       VPL  +
Sbjct: 170 YVSNELSNAKYNAVTFVPTLLYEQFKFFYNLYFLVVALSQAVPALRIGYLSSYIVPLAFV 229

Query: 289 VIITAIKDGIEDSRRTVLDLEVNNTRTHILS 319
           + +T  K+ I+D +R   D E NN   H+++
Sbjct: 230 LTVTMAKEAIDDIQRRRRDRESNNELYHVIT 260

>ADL079C [1662] [Homologous to ScYIL048W (NEO1) - SH] (544854..548354)
            [3501 bp, 1166 aa]
          Length = 1166

 Score =  331 bits (849), Expect = 7e-94,   Method: Compositional matrix adjust.
 Identities = 270/955 (28%), Positives = 468/955 (49%), Gaps = 140/955 (14%)

Query: 444  KNVKVGDIVRVHNNDEIPADMILLSTSDVDGACYVETKNLDGETNLKVRQSLKCSKIIKS 503
            KN++VGD+V++H +  IPADMILL +S+  G  +V+T  LDGET+ K+R +   ++ +  
Sbjct: 286  KNLRVGDLVKLHKDSRIPADMILLQSSEPSGETFVKTDQLDGETDWKLRVAPSLTQNL-- 343

Query: 504  SRDITRTKFWVESEGPHANLYSYQGNFKWQDTQNGNIRNEPVNINNLLLRGCTLRNTKWA 563
            ++D   TK  + +  P  +++ + G   ++ +      + P++++N L     L ++   
Sbjct: 344  TQDEMLTKVHITASAPEKSIHMFTGKLTYKGS------SAPLSVDNTLWANTVLASSGTC 397

Query: 564  MGMVIFTGDDTKIMINAGVTPTKKSRISRELN-FSVILNFVLLFILCFTAGIVNGVYYKQ 622
            +  VI+TG DT+  +N   +  K   +  E+N  S I     L I  FT  I+  V    
Sbjct: 398  VACVIYTGTDTRQAMNTSKSSVKTGLLELEINSLSKI-----LCICVFTLSILLVV---- 448

Query: 623  KPRSRDYFEFGTIGGSASTNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAIFIYTDVL 682
                        IGG      +V     +IL+ +++P+SL +++++ K+  A  I +D  
Sbjct: 449  ------------IGGLDDDKWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYARQIESDKS 496

Query: 683  LYNAKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEAL 742
            + +  +      ++  I +DLG+IEY+ SDKTGTLTQN M+ +K  +  VSY        
Sbjct: 497  IPDTIV------RTSTIPEDLGRIEYLLSDKTGTLTQNDMQLRKIHLGTVSY-------- 542

Query: 743  AGLRKRQGVDVESEGRREKEEIAKDRETMIDELRSMSDNTQFCPEDLTFVSKEIVEDLKG 802
                                   +  + + D +++++      P ++      +     G
Sbjct: 543  ---------------------TMETMDMVTDYIQTLTS-----PANMGAAGVAVT----G 572

Query: 803  SSGDHQQKCCEHFLLALALCHSVLVEPNKDDPKKLDIKAQSPDESALVSTARQLGYSFVG 862
            S  +  Q+     ++ LA CH+  V PN +D  +L  +A SPDE A+V    ++G S   
Sbjct: 573  SRKEVSQR-VRDLVVTLATCHN--VTPNFED-NELAYQAASPDEIAIVKFTERVGLSLFK 628

Query: 863  SSKSGLIV--EIQGVQKEFQVLNVLEFNSSRKRMSCIIKIPGSTPKDEPKALLICKGADS 920
              +  L +  E  GV  ++ +L+V  F S  KRM  I++      + + +   + KGAD+
Sbjct: 629  RDRHSLTLFHEYSGVNLQYDILHVFPFTSDTKRMGIIVR-----DRTKNEIWFLQKGADT 683

Query: 921  VIYSRLDRTQNDATLLEKTALHLEEYATEGLRTLCLAQRELTWSEYERWVKTYDVAAASV 980
            V+ S++   Q++  L E+ +      A EGLRTL +A+++L+   YE++ K Y  A+ S+
Sbjct: 684  VM-SKI--VQSNDWLEEEVS----NMAREGLRTLVIARKKLSTRLYEQFSKEYKDASLSM 736

Query: 981  TNREEELDKVTDV-IERELILLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETA 1039
             NR+E +++V    +E  L LLG T +ED+LQ  V  SI LL  AG+K+W+LTGDKVETA
Sbjct: 737  LNRDEAMNEVVKRHLEHNLELLGLTGVEDKLQKDVKTSIELLRNAGVKIWMLTGDKVETA 796

Query: 1040 INIGFSCNVLNNDMELLVVKASGEDVEEFGSDPIQVVNNLVTKYLREKFGMSGSEEELKE 1099
              +  S  +++           G+ V            + +TK  R    +  S  E  +
Sbjct: 797  RCVCVSAKLISR----------GQYV------------HTITKLTRRDGAL--SRLEYLK 832

Query: 1100 AKREHGLPQGNFAVIIDGDALKVALNGEEMRRKFLLLCKNCKAVLCCRVSPXXXXXXXXX 1159
            A R       N  ++IDGD+L + ++    R +F  +      V+ CR +P         
Sbjct: 833  ANR-------NSCLLIDGDSLAIYMS--HYRAEFFEIVICLPVVIACRCTPQQKADVALL 883

Query: 1160 XXXTLDVMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFRYVTRLVLVH 1219
                       IGDG NDV+MIQ ADVGVGI G+EG+QA + +DY+I QF ++T+L+L H
Sbjct: 884  IREMTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADYSITQFCHLTKLLLWH 943

Query: 1220 GKWCYKRLAEMIPQFFYKNVIFTLSLFWYGIYNNFDGSYLFEYTYLTFYNLAFTSVPVIL 1279
            G+  YKR A++     ++ ++ ++    Y I +N     L++   +  Y   +T  PV  
Sbjct: 944  GRNSYKRSAKLSQFVIHRGLLISVCQAVYSISSNLKPIALYQGWLMVGYATCYTMAPVFS 1003

Query: 1280 LAVLDQDVSDTVSMLVPQLYR-VGILRKEWNQTKFLWYMLDGVYQSVICFFFPYLAYHKN 1338
            L  LD D+ ++++   P+LY+ +   R    +T F+W +L  ++Q  +   F  L     
Sbjct: 1004 LT-LDHDIDESLTKTYPELYKELTEGRSLSYKTFFVWVIL-SLFQGAVIQGFSQLFI--- 1058

Query: 1339 MVVTENGLGLD-HRYFVGVFVTAIAVTSCNFYVFMEQYRWDWFCGLFICLSLAVF 1392
                  G+G +  +  V +  TA+ +      V +E Y W+    +   ++ A++
Sbjct: 1059 ------GVGSEVFKKMVALSFTALVINEL-IMVALEIYTWNKTMAISEIVTFAIY 1106

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 54/106 (50%), Gaps = 3/106 (2%)

Query: 229 YPRNKIRTTKYTPLTFFPKNILFQFHNFANIYFLILLILGAFQIFGVTNPGFASVPLIVI 288
           YP N I   KY  +TF P  +  QF  F N+YFL++ +  +     +       VPL  +
Sbjct: 188 YPTNAISNAKYNAITFLPIVLYEQFKFFFNLYFLLVSLSQSIPALRIGYLSSYIVPLAFV 247

Query: 289 VIITAIKDGIEDSRRTVLDLEVNNTRTHILSG---VKNENVAVDNV 331
           +++T  K+ ++D +R   D E NN    +L+    V ++N+ V ++
Sbjct: 248 LVVTMSKEAMDDIQRRRRDRETNNELYEVLNNSQLVPSKNLRVGDL 293

>CAGL0L00715g 86810..90244 highly similar to sp|P40527 Saccharomyces
            cerevisiae YIL048w NEO1 ATPase whose overproduction
            confers neomycin resistance, hypothetical start
          Length = 1144

 Score =  328 bits (840), Expect = 6e-93,   Method: Compositional matrix adjust.
 Identities = 264/895 (29%), Positives = 433/895 (48%), Gaps = 141/895 (15%)

Query: 444  KNVKVGDIVRVHNNDEIPADMILLSTSDVDGACYVETKNLDGETNLKVRQSLKCSKIIKS 503
            K++KVGD++++     +PAD+ILL +S+  G  +++T  LDGET+ K+R  + C+     
Sbjct: 262  KDLKVGDLIKISKGARVPADLILLQSSEPSGEAFIKTDQLDGETDWKLR--IACTLTQNL 319

Query: 504  SRDITRTKFWVESEGPHANLYSYQGNFKWQDTQNGNIRNEPVNINNLLLRGCTLRNTKWA 563
            + D    K  + +  P  +++S+ G   ++DT    +      I+N L     L ++ + 
Sbjct: 320  NEDDLLEKITITASAPEKSIHSFLGRVTYKDTNTSGL-----TIDNTLWANTVLASSGFC 374

Query: 564  MGMVIFTGDDTKIMINAGVTPTKKSRISRELN-FSVILN---FVLLFILCFTAGIVNGVY 619
            +G VI+TG DT+  +N      K   +  E+N  S IL    F+L  +L   AG+ N  +
Sbjct: 375  IGCVIYTGRDTRQAMNTTSAKVKTGLLELEINDISKILCACVFILSILLVVFAGLHNDDW 434

Query: 620  YKQKPRSRDYFEFGTIGGSASTNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAIFIYT 679
            Y                        V     +IL+ +++P+SL +++++ K+  A  I  
Sbjct: 435  Y------------------------VDIMRYLILFSTIIPVSLRVNLDLAKSVYAHQIEH 470

Query: 680  DVLLYNAKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSY----G 735
            D      K       ++  I +DLG+IEY+ SDKTGTLTQN M+ KK  +  VSY     
Sbjct: 471  D------KTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKVHLGNVSYTTETA 524

Query: 736  RAYTEALAGLRKRQGVDVESEGRREKEEIAKDRETMIDELRSMSDNTQFCPEDLTFVSKE 795
               ++ + G+ + +   V + G R      KD  T + +L                    
Sbjct: 525  DIVSDYIQGMIESKNDSVTNLGPRSTTR--KDAATHVIDL-------------------- 562

Query: 796  IVEDLKGSSGDHQQKCCEHFLLALALCHSVLVEPNKDDPKKLDIKAQSPDESALVSTARQ 855
                                +  LA+CH+V   P  +D  +L  +A SPDE A+V     
Sbjct: 563  --------------------ITTLAICHNV--TPTFED-DELTYQAASPDEIAIVKFTES 599

Query: 856  LGYSFVGSSKSG--LIVEIQGVQKEFQVLNVLEFNSSRKRMSCIIKIPGSTPKDEPKALL 913
            +G S     +    L+ E  G    + VL +  FNS  KRM  I+       K + +   
Sbjct: 600  VGLSLFKRDRHSMSLLHEHSGTILNYDVLTMFPFNSDTKRMGIIVY-----DKQKDQYWF 654

Query: 914  ICKGADSVIYSRLDRTQNDATLLEKTALHLEEYATEGLRTLCLAQRELTWSEYERWVKTY 973
            + KGAD+V+ +R+    N+  L E+T       A EGLRTL + +++LT   YE++ K Y
Sbjct: 655  LQKGADTVM-NRI--VANNDWLEEETG----NMAREGLRTLVIGRKKLTKKIYEQFKKEY 707

Query: 974  DVAAASVTNREEEL-DKVTDVIERELILLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLT 1032
            +  +AS+ NRE+E+ + ++  +E +L LLG T +ED+LQ  V  SI LL  AGIK+W+LT
Sbjct: 708  EEVSASMYNREQEMANTISKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLT 767

Query: 1033 GDKVETAINIGFSCNVLNNDMELLVVKASGEDVEEFGSDPIQVVNNLVTKYLREKFGMSG 1092
            GDKVETA  +  S  ++          + G+ V            ++VTK L +  G   
Sbjct: 768  GDKVETARCVSISAKLI----------SRGQYV------------HVVTK-LSKPEGAFN 804

Query: 1093 SEEELKEAKREHGLPQGNFAVIIDGDALKVALNGEEMRRKFLLLCKNCKAVLCCRVSPXX 1152
              E LK  K        N  ++IDG++L + L  +  R++F  +  +   V+ CR +P  
Sbjct: 805  QLEYLKVNK--------NACLLIDGESLGMFL--KYYRQEFFDVVVHLPTVIACRCTPQQ 854

Query: 1153 XXXXXXXXXXTLDVMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFRYV 1212
                              IGDG NDV+MIQ ADVGVGI G+EG+QA + +D++I QF ++
Sbjct: 855  KADVALIIRELTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQFCHL 914

Query: 1213 TRLVLVHGKWCYKRLAEMIPQFFYKNVIFTLSLFWYGIYNNFDGSYLFEYTYLTFYNLAF 1272
            T L+L HG+  YKR A++     ++ +I  +    + + + F+   L++   +  Y   +
Sbjct: 915  TELLLWHGRNSYKRSAKLAQFVMHRGLIIAICQAVFSVCSQFEPIALYQGWLMVGYATCY 974

Query: 1273 TSVPVILLAVLDQDVSDTVSMLVPQLYRVGILRKEWN-QTKFLWYMLDGVYQSVI 1326
            T  PV  L  LD D+ ++++ + P+LY+     K  + +T F+W  L   YQ ++
Sbjct: 975  TMAPVFSLT-LDHDIDESLTKMYPELYKDLTEGKSLSYKTFFVWVAL-SFYQGLV 1027

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 34/69 (49%)

Query: 229 YPRNKIRTTKYTPLTFFPKNILFQFHNFANIYFLILLILGAFQIFGVTNPGFASVPLIVI 288
           +P N++   KY  +TF P  +  QF  F N+YFL++ +  A     +       VPL  +
Sbjct: 164 FPSNEVSNAKYNAVTFLPTLLYEQFKFFFNLYFLLVALSQAIPALRIGYLSSYVVPLAFV 223

Query: 289 VIITAIKDG 297
           + +T  K+ 
Sbjct: 224 LTVTMAKEA 232

>Scas_704.38
          Length = 1161

 Score =  321 bits (822), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 257/883 (29%), Positives = 440/883 (49%), Gaps = 131/883 (14%)

Query: 444  KNVKVGDIVRVHNNDEIPADMILLSTSDVDGACYVETKNLDGETNLKVRQSLKCSKIIKS 503
            K++KVGD++++   D +PAD++LL +S+  G  +++T  LDGET+ K+R +   ++ + +
Sbjct: 278  KDLKVGDLIKISKGDRLPADLVLLQSSEPSGETFIKTDQLDGETDWKLRIAPALTQNL-T 336

Query: 504  SRDITRTKFWVESEGPHANLYSYQGNFKWQDTQNGNIRNEPVNINNLLLRGCTLRNTKWA 563
              D+   K  + +  P   ++++ G   ++DT +      P++I+N L     L +T + 
Sbjct: 337  EPDLM-NKVSITASAPEKAIHNFLGKVTYKDTSSN-----PLSIDNTLWANTVLASTGFC 390

Query: 564  MGMVIFTGDDTKIMINAGVTPTKKSRISRELN-FSVILN---FVLLFILCFTAGIVNGVY 619
            +G V++TG DT+  +N      K   +  E+N  S IL    F L  IL   AG  N  +
Sbjct: 391  IGCVVYTGRDTRQAMNTTTATVKTGLLELEINSISKILCASVFALSIILVVFAGFHNSDW 450

Query: 620  YKQKPRSRDYFEFGTIGGSASTNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAIFIYT 679
            Y    R                         +IL+ +++P+SL +++++ K+  A  I  
Sbjct: 451  YLDVMR------------------------YLILFSTIIPVSLRVNLDLAKSVYAHQIEH 486

Query: 680  DVLLYNAKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYT 739
            D  +    +      ++  I +DLG+IEY+ SDKTGTLTQN M+ KK  +  VSY     
Sbjct: 487  DDTIPETIV------RTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSY----- 535

Query: 740  EALAGLRKRQGVDVESEGRREKEEIAKDRETMIDELRSMSDNTQFCPEDLTFVSKEIVED 799
                     + +D+ S+               +D L + S++     + +   S++   D
Sbjct: 536  -------TSETLDIVSD--------------YVDALVNSSNSANPSGKSVPSTSRK---D 571

Query: 800  LKGSSGDHQQKCCEHFLLALALCHSVLVEPNKDDPKKLDIKAQSPDESALVSTARQLGYS 859
            L     D         ++ LA+CH+V   P  +D  +L  +A SPDE A+V     +G S
Sbjct: 572  LSARVRD--------MVVTLAICHNV--TPTFED-DELTYQAASPDEIAIVKFTESVGLS 620

Query: 860  FVGSSKSG--LIVEIQGVQKEFQVLNVLEFNSSRKRMSCIIKIPGSTPKDEPKALLICKG 917
                 +    L+    G    +++L V  FNS  KRM  I+       KDE     + KG
Sbjct: 621  LFKRDRHSISLLHGHSGSILTYEILQVFPFNSDSKRMGIIVH---DEQKDE--YWFMQKG 675

Query: 918  ADSVIYSRLDRTQNDATLLEKTALHLEEYATEGLRTLCLAQRELTWSEYERWVKTYDVAA 977
            AD+V+ +R+   +N+  L E+T       A EGLRTL + +++L+ + Y+++ K YD A+
Sbjct: 676  ADTVM-ARI--VENNDWLEEETG----NMAREGLRTLVVGRKKLSRNIYDQFKKDYDDAS 728

Query: 978  ASVTNREEELDKV-TDVIERELILLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKV 1036
             S+ NR+++++ V T  +E +L LLG T +ED+LQ+ V  SI LL  AGIK+W+LTGDKV
Sbjct: 729  LSMVNRDQQMNAVITKYLEYDLELLGLTGVEDKLQNDVKSSIELLRNAGIKIWMLTGDKV 788

Query: 1037 ETAINIGFSCNVLNNDMELLVVKASGEDVEEFGSDPIQVVNNLVTKYLREKFGMSGSEEE 1096
            ETA  +  S  ++          + G+ V            +++TK  + +    G+  +
Sbjct: 789  ETARCVSISAKLI----------SRGQYV------------HIITKLTKPE----GALNQ 822

Query: 1097 LKEAKREHGLPQGNFAVIIDGDALKVALNGEEMRRKFLLLCKNCKAVLCCRVSPXXXXXX 1156
            L+  K   G       ++IDG++L + L     +R+F  +      V+ CR +P      
Sbjct: 823  LEYLKVNKGA-----CLLIDGESLGMFL--RYYKREFFDVVICLPTVVACRCTPQQKADV 875

Query: 1157 XXXXXXTLDVMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFRYVTRLV 1216
                          IGDG NDV+MIQ ADVGVGI G+EG+QA + +D++I +F ++T L+
Sbjct: 876  ALVIREFTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITEFCHLTELL 935

Query: 1217 LVHGKWCYKRLAEMIPQFFYKNVIFTLSLFWYGIYNNFDGSYLFEYTYLTFYNLAFTSVP 1276
            L HG+  YKR A++     ++ ++  +    Y I + F+   L++   +  Y   +T  P
Sbjct: 936  LWHGRNSYKRSAKLAQFIMHRGLVIAICQAVYSICSKFEPIGLYQGFLMVGYATCYTMAP 995

Query: 1277 VILLAVLDQDVSDTVSMLVPQLYRVGILRKEWN-QTKFLWYML 1318
            V  +  LD D+ ++++ + P+LY+     K  + +T F+W  L
Sbjct: 996  VFSMT-LDHDIEESLTKIYPELYKDLTEGKSLSYKTFFVWCAL 1037

 Score = 54.3 bits (129), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 47/94 (50%)

Query: 229 YPRNKIRTTKYTPLTFFPKNILFQFHNFANIYFLILLILGAFQIFGVTNPGFASVPLIVI 288
           YP N+I   KY   TF P  +  QF  F N+YFL++ +  A     +       VPL  +
Sbjct: 180 YPGNEISNAKYNAFTFIPTLLYEQFKFFYNLYFLVVALSQAIPALRIGYLSSYVVPLAFV 239

Query: 289 VIITAIKDGIEDSRRTVLDLEVNNTRTHILSGVK 322
           + +T  K+ ++D +R   D E N+   H+L+  K
Sbjct: 240 LTVTMSKEAMDDIQRRRRDNESNSELYHVLNQSK 273

>Kwal_23.5789
          Length = 1133

 Score =  320 bits (820), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 272/1024 (26%), Positives = 476/1024 (46%), Gaps = 150/1024 (14%)

Query: 444  KNVKVGDIVRVHNNDEIPADMILLSTSDVDGACYVETKNLDGETNLKVRQSLKCSKIIKS 503
            K++KVGD++++      PAD++LL +S+  G  +++T  LDGET+ K+R  + C      
Sbjct: 254  KDLKVGDLIKIGKGARAPADLVLLQSSEPSGEIFIKTDQLDGETDWKLR--IACPLTQHL 311

Query: 504  SRDITRTKFWVESEGPHANLYSYQGNFKWQDTQNGNIRNEPVNINNLLLRGCTLRNTKWA 563
            S+D    +  + +  P  ++ ++ G   +     G I+++P++++N +       +   A
Sbjct: 312  SQDDLLYRISITASVPEKSINNFLGKLTF-----GEIQSQPLSVDNTMWANTVFASAGTA 366

Query: 564  MGMVIFTGDDTKIMINAGVTPTKKSRISRELNFSVILNFVLLFILCFTAGIVNGVYYKQK 623
            +  V++TG DT+  +N  ++  K   +  E+N        L  ILC    I++       
Sbjct: 367  IACVVYTGADTRQAMNTSMSSVKTGLLELEIN-------SLSKILCACVFILS------- 412

Query: 624  PRSRDYFEFGTIGGSASTNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAIFIYTDVLL 683
                         G  + + +V     +IL+ +++P+SL +++++ K+  A  I  D  +
Sbjct: 413  ------VALVAFAGFNNNDWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYAHQIEHDSTI 466

Query: 684  YNAKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALA 743
                +      ++  I +DLG+IEY+ SDKTGTLTQN ME KK  +  VSY         
Sbjct: 467  PETIV------RTSTIPEDLGRIEYLLSDKTGTLTQNDMELKKLHLGTVSY--------- 511

Query: 744  GLRKRQGVDVESEGRREKEEIAKDRETMIDELRSMSDNTQFCPEDLTFVSKEIVEDLKGS 803
                                     + + D +R+MSDN      + + V     +DL G 
Sbjct: 512  --------------------TMDTMDIVTDYVRAMSDNL-----NSSAVPSASKKDLPGR 546

Query: 804  SGDHQQKCCEHFLLALALCHSVLVEPNKDDPKKLDIKAQSPDESALVSTARQLGYSFVGS 863
              D         +L LALCH V   P  +D  +L  +A SPDE A+V     +G +    
Sbjct: 547  VRD--------LVLTLALCHQV--TPTFED-GELTYQAASPDEIAIVKFTESVGLTLFRR 595

Query: 864  SKSG--LIVEIQGVQKEFQVLNVLEFNSSRKRMSCIIKIPGSTPKDEPKALLICKGADSV 921
             +    L+ +  G   E+ +L+V  FNS  KRM  +I       K + +   + KGAD V
Sbjct: 596  DRHSITLLHDQSGTNFEYDILHVFPFNSDNKRMGIVI-----FDKQKDEYWFLQKGAD-V 649

Query: 922  IYSRLDRTQNDATLLEKTALHLEEYATEGLRTLCLAQRELTWSEYERWVKTYDVAAASVT 981
            + S++   Q +  L E+T       A EGLRTL + ++ L+    + + K Y+ A+  + 
Sbjct: 650  VMSKI--VQKNDWLEEETG----NLAREGLRTLVIGRKRLSKKLLQTFTKDYEDASLMML 703

Query: 982  NREEELDKV-TDVIERELILLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAI 1040
            NRE  +  V +  +E +L +LG T +ED+LQ+ V  SI LL  AGIK+W+LTGDKVETA 
Sbjct: 704  NREVTMSNVISKHLEHDLEILGLTGVEDKLQEDVKSSIELLRNAGIKIWMLTGDKVETAR 763

Query: 1041 NIGFSCNVLNNDMELLVVKASGEDVEEFGSDPIQVVNNLVTKYLREKFGMSGSEEELKEA 1100
             +  S  +++           G+ V            + VTK  + +    G+   L+  
Sbjct: 764  CVSISAKLVSR----------GQYV------------HTVTKVNKPE----GALTHLELL 797

Query: 1101 KREHGLPQGNFAVIIDGDALKVALNGEEMRRKFLLLCKNCKAVLCCRVSPXXXXXXXXXX 1160
            K        N  ++IDG++L + L  E  R++F  +  N  AV+ CR +P          
Sbjct: 798  KI-----NTNSCLLIDGESLGLYL--EYYRQQFFEIVVNLPAVIACRCTPQQKADVATFI 850

Query: 1161 XXTLDVMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFRYVTRLVLVHG 1220
                      IGDG NDV+MIQSADVGVGI G+EG+QA + +D++I QF ++++L+L HG
Sbjct: 851  REVTGKRVCCIGDGGNDVSMIQSADVGVGIVGKEGKQASLAADFSITQFCHLSKLLLWHG 910

Query: 1221 KWCYKRLAEMIPQFFYKNVIFTLSLFWYGIYNNFDGSYLFEYTYLTFYNLAFTSVPVILL 1280
            +  YKR A++     ++ ++ ++    Y I + F+   L++   +  Y   +T  PV  L
Sbjct: 911  RNSYKRSAKLAQFVIHRGLLISVCQAVYSISSKFEPIALYQGWLMVGYATCYTMAPVFSL 970

Query: 1281 AVLDQDVSDTVSMLVPQLYRVGILRKEWN-QTKFLWYMLDGVYQSVICFFFPYLAYHKNM 1339
              LD D+ ++++   P+LY+     K  + +T F+W +L  ++Q  +             
Sbjct: 971  T-LDHDIDESLTKTYPELYKELTAGKSLSYKTFFVWVVL-SLFQGCVI-----------Q 1017

Query: 1340 VVTENGLGLDHRYFVGVFVTAIAVTSCN--FYVFMEQYRWDWFCGLFICLSLAVFYGWTG 1397
             +++    LD   F  +   +  V   N    V +E Y W+    +   ++  +F G   
Sbjct: 1018 GLSQGFTSLDELDFKRLVALSFTVLILNELIMVAIEIYTWNKTMVVSEVVTFLIFVGSVP 1077

Query: 1398 IWTXXXXXNEFYKGAARVFAQPAYWAVLFVGVLFCLLPRFTIDCIRKIFYPKDIEIVREM 1457
            +        E++       ++P Y+  L + +   ++P +    + +   P     V++ 
Sbjct: 1078 L------LEEYFD--LTYMSRPEYYGKLAIILSLSIIPVWAAKALHRRLNPPSYAKVQQF 1129

Query: 1458 WLRG 1461
            +   
Sbjct: 1130 YFSA 1133

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 66/230 (28%), Positives = 98/230 (42%), Gaps = 31/230 (13%)

Query: 107 ENEVDDDLHSFQATPMPNTGG------FEDVELDNNEGSNNDSQADHKLKRVRFGTRRNK 160
           E+ +D  L S Q     +TGG      FE   L +NE   N  Q+D +       T  N 
Sbjct: 31  EDSLDAALESLQI----HTGGSPAREDFEMTSLRSNESQKNARQSDTEPLINNGATAPNS 86

Query: 161 ---SGRIDINRSKTLKWAKKNFHNAIDEFSTKEDSLENSALQNRSDELRTVYYNLPLPED 217
                R D +RS     +   F + I +F     S + S  +  S+ ++       L +D
Sbjct: 87  WSHDPRHDSDRSTA---SGSPFWSRITKFMRSSHSPKVSTYKATSNSIQ-------LKDD 136

Query: 218 M-LDEDGLP--LAVYPR-----NKIRTTKYTPLTFFPKNILFQFHNFANIYFLILLILGA 269
             LD +  P    VY R     N I   KY P+TF PK +  QF  F N+YFL++ +  A
Sbjct: 137 QQLDREIHPSTTPVYDRYKYAPNAISNAKYNPVTFIPKILYEQFKFFFNLYFLLVALSQA 196

Query: 270 FQIFGVTNPGFASVPLIVIVIITAIKDGIEDSRRTVLDLEVNNTRTHILS 319
                +       VPL  ++ +T  K+ ++D +R   D E NN    +LS
Sbjct: 197 IPALRIGYLSSYIVPLAFVLTVTMSKEALDDIQRRRRDRESNNELYEVLS 246

>Sklu_2193.1 YIL048W, Contig c2193 334-3765 reverse complement
          Length = 1143

 Score =  320 bits (820), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 256/885 (28%), Positives = 430/885 (48%), Gaps = 139/885 (15%)

Query: 444  KNVKVGDIVRVHNNDEIPADMILLSTSDVDGACYVETKNLDGETNLKVRQSLKCSKIIKS 503
            K++KVGD++++H    IPAD++LL +S+  G  +++T  LDGET+ K+R  + CS     
Sbjct: 264  KDLKVGDLIKIHKGTRIPADLVLLQSSEPSGESFIKTDQLDGETDWKLR--VACSLTQNL 321

Query: 504  SRDITRTKFWVESEGPHANLYSYQGNFKWQDTQNGNIRNEPVNINNLLLRGCTLRNTKWA 563
            S D    K  + +  P  +++ + G   ++D+ +       ++++N +     L +    
Sbjct: 322  STDDLLNKISITASSPEKSIHRFLGKLTYKDSSSN-----ALSVDNTMWANTVLASVGSC 376

Query: 564  MGMVIFTGDDTKIMINAGVTPTKKSRISRELN-FSVILN---FVLLFILCFTAGIVNGVY 619
            +G V++TG DT+  +N  ++  K   +  E+N  S IL    FVL  +L   AG  N  +
Sbjct: 377  IGCVVYTGTDTRQAMNTTMSSVKTGLLELEINSLSKILCACVFVLSIVLVAFAGFGNKDW 436

Query: 620  YKQKPRSRDYFEFGTIGGSASTNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAIFIYT 679
            Y                        V     +IL+ +++P+SL +++++ K+  A  I  
Sbjct: 437  Y------------------------VDIMRYLILFSTIIPVSLRVNLDLGKSVYARQIEH 472

Query: 680  DVLLYNAKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYT 739
            D  + +  +      ++  I +DLG+IEY+ SDKTGTLTQN M+ KK  +  VSY     
Sbjct: 473  DATIPDTIV------RTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKLHLGTVSY----- 521

Query: 740  EALAGLRKRQGVDVESEGRREKEEIAKDRETMIDELRSMSDNTQFCPEDLTFVSKEIVED 799
                                +  +I  D    + EL S S  T   P   +   K++   
Sbjct: 522  ------------------TMDTMDIVTD---YVQELVSSSTTT---PMPQSTAKKDLPNR 557

Query: 800  LKGSSGDHQQKCCEHFLLALALCHSVLVEPNKDDPKKLDIKAQSPDESALVSTARQLGYS 859
            ++              ++ LA+CH+V   P  +D  +L  +A SPDE A+V     +G S
Sbjct: 558  VRD------------LVVTLAICHNV--TPTFED-GELTYQAASPDEIAIVKFTESVGLS 602

Query: 860  FVGSSKSG--LIVEIQGVQKEFQVLNVLEFNSSRKRMSCII--KIPGSTPKDEPKALLIC 915
                 +    L  +      E+ +L V  FNS  KRM  I+  K+ G       +   + 
Sbjct: 603  LFKRDRHSVSLFHQHSATNFEYDILQVFPFNSDTKRMGIIVYDKVKG-------EHWFMQ 655

Query: 916  KGADSVIYSRLDRTQNDATLLEKTALHLEEYATEGLRTLCLAQRELTWSEYERWVKTYDV 975
            KGAD+V+ +R+   Q++  L E+        A EGLRTL + +++L+   YE++ K Y  
Sbjct: 656  KGADTVM-ARI--VQSNDWLDEEVG----NMAREGLRTLVIGRKKLSPKSYEQFRKEYHD 708

Query: 976  AAASVTNREEELDKVTDV-IERELILLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGD 1034
            A+ S+ NR+E +  V    +E  L LLG T +ED+LQ+ V  SI LL  AG+K+W+LTGD
Sbjct: 709  ASLSMLNRDETMSSVIKKHLEHNLELLGLTGVEDKLQNDVKSSIELLRNAGVKIWMLTGD 768

Query: 1035 KVETAINIGFSCNVLNNDMELLVVKASGEDVEEFGSDPIQVVNNLVTKYLREKFGMSGSE 1094
            KVETA  +  S  +++           G+ V            + VTK  R + G   + 
Sbjct: 769  KVETARCVSISAKLISR----------GQYV------------HTVTKLSRPE-GALNAL 805

Query: 1095 EELKEAKREHGLPQGNFAVIIDGDALKVALNGEEMRRKFLLLCKNCKAVLCCRVSPXXXX 1154
            E LK  K           ++IDG++L + L     +++F  +  +  AV+ CR +P    
Sbjct: 806  EYLKINKSS--------CLLIDGESLGMFLT--YYKQEFFDIVVDLPAVIACRCTPQQKA 855

Query: 1155 XXXXXXXXTLDVMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFRYVTR 1214
                            IGDG NDV+MIQ ADVGVGI G+EG+QA + +D+++ QF ++T+
Sbjct: 856  DVALLIREITGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSVTQFCHLTK 915

Query: 1215 LVLVHGKWCYKRLAEMIPQFFYKNVIFTLSLFWYGIYNNFDGSYLFEYTYLTFYNLAFTS 1274
            L+L HG+  YKR A++     ++ +I ++    Y + + F+   L++   +  Y   +T 
Sbjct: 916  LLLWHGRNSYKRSAKLAQFVIHRGLIISVCQAVYSVCSKFEPIALYQGWLMVGYATCYTM 975

Query: 1275 VPVILLAVLDQDVSDTVSMLVPQLYRVGILRKEWN-QTKFLWYML 1318
             PV  L  LD D+ ++++ + P+LY+        + +T F+W +L
Sbjct: 976  APVFSLT-LDHDIDESLTKIYPELYKELTAGTSLSYKTFFVWVIL 1019

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 48/94 (51%)

Query: 229 YPRNKIRTTKYTPLTFFPKNILFQFHNFANIYFLILLILGAFQIFGVTNPGFASVPLIVI 288
           YP N I   KY P+TF P  +  QF  F N+YFL++ +  A     +       VPL  +
Sbjct: 166 YPSNAISNAKYNPITFIPIILYEQFKFFFNLYFLLVALSQAIPALRIGYLSSYIVPLAFV 225

Query: 289 VIITAIKDGIEDSRRTVLDLEVNNTRTHILSGVK 322
           +++T  K+ ++D +R   D E NN    +L+  +
Sbjct: 226 LMVTMSKEAMDDIQRRQRDKESNNELYEVLNKAQ 259

>Kwal_56.23467
          Length = 280

 Score =  284 bits (727), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 138/289 (47%), Positives = 184/289 (63%), Gaps = 42/289 (14%)

Query: 1304 LRKEWNQTKFLWYMLDGVYQSVICFFFPYLAYHKNMVVTENGLGLDHRYFVGVFVTAIAV 1363
            +R EWN TKF  YM+DG+YQSVI FFFP+LAY+K  +V+ NGLGLDHRY+VG+ V +IA 
Sbjct: 1    MRSEWNLTKFWLYMVDGLYQSVISFFFPFLAYYKTGMVSPNGLGLDHRYWVGILVGSIAS 60

Query: 1364 TSCNFYVFMEQYRWDWFCGLFICLSLAVFYGWTGIWTXXXXXNEFYKGAARVFAQPAYWA 1423
             SCN Y+ + Q+RWDWF  LFI LS  V YGWTGIW+      EFYK AA V+  P YWA
Sbjct: 61   VSCNLYILIHQFRWDWFSTLFIALSCLVVYGWTGIWSTFTTSGEFYKSAAHVYGSPIYWA 120

Query: 1424 VLFVGVLFCLLPRFTIDCIRKIFYPKDIEIVREMWLRGDFDLYPQGYDPTDPSRPRI--- 1480
            + FVGVLFCLLPRFT D  +K+F+PKDI+I+RE W++G FD YP+ YDPTDP+RP+I   
Sbjct: 121  IFFVGVLFCLLPRFTFDVFQKMFFPKDIDIIREFWVQGHFDQYPEDYDPTDPNRPQIAKA 180

Query: 1481 -NEIRPL-----TDFKEPISLDTHFDGVSHSQETIVTEEIPMSILNGEQGSRKGYRVSTT 1534
              ++ P      +D+   I+   H      S++T+ TEEIPM+ +  +  + + +     
Sbjct: 181  DTKLHPRYVEEGSDYAHAITTANH-----GSRDTVYTEEIPMTFMEADDNNPEPFH---- 231

Query: 1535 LERRDQLSPVTTTNNLPRRSMASARGNKLRTSLDRTREEMLANHQLDTR 1583
                            PR        + +RTSLDRTR +M A+++LD R
Sbjct: 232  ----------------PR--------SNIRTSLDRTRMQMRASNELDGR 256

>KLLA0C08393g 734655..738101 highly similar to sp|P40527 Saccharomyces
            cerevisiae YIL048w NEO1 ATPase whose overproduction
            confers neomycin resistance, start by similarity
          Length = 1148

 Score =  305 bits (780), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 260/929 (27%), Positives = 447/929 (48%), Gaps = 147/929 (15%)

Query: 444  KNVKVGDIVRVHNNDEIPADMILLSTSDVDGACYVETKNLDGETNLKVRQSLKCSKIIKS 503
            K++KVGDI+++     +PAD+++L T++ +G  +++T  LDGET+ K+R  L CS     
Sbjct: 271  KDLKVGDIIKLKKGARVPADVVVLQTNEPNGESFIKTDQLDGETDWKLR--LACSLTQSL 328

Query: 504  SRDITRTKFWVESEGPHANLYSYQGNFKWQDTQNGNIRNEPVNINNLLLRGCTLRNTKWA 563
            + +       + +  P  +++++ G   ++D+ +      P++++N +     L ++   
Sbjct: 329  TENDLLNNITITASAPEHSIHNFLGKITYKDSTSS-----PLSVDNTMWENTVLASSAAC 383

Query: 564  MGMVIFTGDDTKIMINAGVTPTKKSRISRELN-FSVILN---FVLLFILCFTAGIVNGVY 619
            +  +++TG +T+  +N   +  K   +  E+N  S IL    F+L  +L   AG  N  +
Sbjct: 384  ICCIVYTGRETRQALNTTKSKAKTGLLELEINGLSKILCACVFLLSIMLVAFAGFNNNDW 443

Query: 620  YKQKPRSRDYFEFGTIGGSASTNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAIFIYT 679
            Y                        V     +IL+ +++P+SL +++++ K+  A  I  
Sbjct: 444  Y------------------------VDIMRYLILFSTIIPVSLRVNLDLGKSVYAYKIEH 479

Query: 680  DVLLYNAKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYT 739
            D  + +  +      ++  I +DLG+IEY+ SDKTGTLTQN M+ KK  +  VSY     
Sbjct: 480  DKQIEDTIV------RTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSY----- 528

Query: 740  EALAGLRKRQGVDVESEGRREKEEIAKDRETMIDELRSMSDNTQFCPEDLTF--VSKEIV 797
                     + +D+                 + D ++SM+  T       T   +S  ++
Sbjct: 529  -------TNETMDI-----------------VTDFIQSMNSRTSNSTPTTTRKNISDRVI 564

Query: 798  EDLKGSSGDHQQKCCEHFLLALALCHSVLVEPNKDDPKKLDIKAQSPDESALVSTARQLG 857
            +                 +  LA+CH+  V P  +D  +L  +A SPDE A+V     +G
Sbjct: 565  D----------------LVTTLAICHN--VTPTFED-GELTYQAASPDEIAIVKFTESVG 605

Query: 858  YSFVGSSKS--GLIVEIQGVQKEFQVLNVLEFNSSRKRMSCIIKIPGSTPKDEPKALLIC 915
             S     +    L  +  G++ E+ +  +  FNS  KRM  II       K + +   + 
Sbjct: 606  LSLFRRDRHSISLFHDHSGMKLEYDIKILFPFNSDSKRMGVII-----FDKLKQEYWFLQ 660

Query: 916  KGADSVIYSRLDRTQNDATLLEKTALHLEEYATEGLRTLCLAQRELTWSEYERWVKTYDV 975
            KGAD+V+ S + R  ND  L E+T+      ATEGLRTL + +++L+ + +E++ K Y  
Sbjct: 661  KGADTVMSSIVVR--NDW-LEEETS----NMATEGLRTLVIGRKKLSTNLFEQFEKEYSE 713

Query: 976  AAASVTNREEELDKVT-DVIERELILLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGD 1034
            A+ ++ +RE  +  V    +E +L LLG T +ED+LQ  V  SI LL  AGIK+W+LTGD
Sbjct: 714  ASLTMMDREVHMQNVVRKFLENDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGD 773

Query: 1035 KVETAINIGFSCNVLNNDMELLVVKASGEDVEEFGSDPIQVVNNLVTKYLREKFGMSGSE 1094
            KVETA  +  S  ++          + G+ V            + VTK  + +    G+ 
Sbjct: 774  KVETARCVSISAKLI----------SRGQYV------------HTVTKVNKPE----GAL 807

Query: 1095 EELKEAKREHGLPQGNFAVIIDGDALKVALNGEEMRRKFLLLCKNCKAVLCCRVSPXXXX 1154
              L     E+     N  ++IDG++L + L  +    +F  +  N   V+ CR +P    
Sbjct: 808  HHL-----EYLQVNQNSCLLIDGESLGLYL--QYFPDEFFDIVVNLPTVVACRCTPQQKA 860

Query: 1155 XXXXXXXXTLDVMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFRYVTR 1214
                            IGDG NDV+MIQ ADVGVGI G+EG+QA + +D++I QF ++T+
Sbjct: 861  DVAVFIRQATGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQFCHLTK 920

Query: 1215 LVLVHGKWCYKRLAEMIPQFFYKNVIFTLSLFWYGIYNNFDGSYLFEYTYLTFYNLAFTS 1274
            L+L HG+  YK  A++     ++ +I ++    Y I + F+   L++   +  Y   +T 
Sbjct: 921  LLLWHGRNSYKSSAKLSQFVIHRGLIISVCQAVYSICSMFEPLALYQGWLMVGYATCYTM 980

Query: 1275 VPVILLAVLDQDVSDTVSMLVPQLYRVGILRKEWN-QTKFLWYMLDGVYQSVICF---FF 1330
             PV  L  LD D+ ++++ L P+LY+   L K  + +T F+W  L      VI     FF
Sbjct: 981  APVFSLT-LDHDIDESLTTLYPELYKELTLGKSLSFKTFFVWVALSVFQGCVIQMASQFF 1039

Query: 1331 PYLA---YHKNMVVTENGLGLDHRYFVGV 1356
              L    + K + ++   L L+    VG+
Sbjct: 1040 TSLNDSDFTKMVAISFTALVLNELIMVGL 1068

 Score = 57.0 bits (136), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 55/228 (24%), Positives = 91/228 (39%), Gaps = 25/228 (10%)

Query: 105 EHENEVDDDLHSFQ----ATPMPNTGGFEDVELDNNEGSNNDSQADHKLKRVRFGTRRNK 160
           + E+ +D  L S Q    +    N+  FED E+ +  G +               T  + 
Sbjct: 34  QFEDSLDAALESLQLPEHSHRRENSTVFEDFEMKSMHGDHQTGMLHSDADTAPLITNHSN 93

Query: 161 SGRIDINRSKTLK-------WAKKN--FHNAIDEFSTKEDSLENSALQNRSDELRTVYYN 211
           +GR+  N  +  +       W+K    F ++  +  +K  SL   +  N  D  +     
Sbjct: 94  NGRMLSNSDRNAQNTNNITVWSKAKSWFEHSFTKAKSKPSSLSVYSSTNSVDGNK----- 148

Query: 212 LPLPEDMLDEDGLPLAV-------YPRNKIRTTKYTPLTFFPKNILFQFHNFANIYFLIL 264
           + L +  ++ +  P          YP N I   KY P TF P  +  QF  F N+YFLI+
Sbjct: 149 IELNDHNVEREIHPATTPIYDRKKYPSNVISNAKYNPFTFIPLILYEQFKFFFNLYFLIV 208

Query: 265 LILGAFQIFGVTNPGFASVPLIVIVIITAIKDGIEDSRRTVLDLEVNN 312
            +  A     +       VPL  ++ +T  K+ ++D  R   D E NN
Sbjct: 209 ALSQAIPQLRIGYLSSYIVPLAFVLTVTMSKEAMDDINRRKRDREANN 256

>Kwal_23.3556
          Length = 1597

 Score =  294 bits (753), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 175/562 (31%), Positives = 290/562 (51%), Gaps = 40/562 (7%)

Query: 902  GSTPKDEPKALLICKGADSVIYSRLDRTQNDATLLEKTALHLEEYATEGLRTLCLAQREL 961
              TP +    LL     +  I+S  D  QN+  +LE+T   +E+++T GLRTL  + + +
Sbjct: 924  AKTPPEVLGPLLDDNSIEEYIWSE-DLIQNEEFVLERTLQAIEDFSTSGLRTLLYSYKWI 982

Query: 962  TWSEYERWVKTYDVAAASVTNREEELDKVTDVIERELILLGGTAIEDRLQDGVPDSIALL 1021
               +YE+W K Y  A  S+ NR+E++  V +++E  L LLG TAIED+LQ+GV D+I  +
Sbjct: 983  PSEDYEKWSKKYHAAKTSLENRKEKMHSVGELVETSLHLLGATAIEDKLQEGVADAIDKI 1042

Query: 1022 AEAGIKLWVLTGDKVETAINIGFSCNVLNNDMELLVVKASGEDVEEFGSDPIQVVNNLVT 1081
              AGIK+W+LTGDK ETAINIG+SCN++++   ++++ A  E++                
Sbjct: 1043 RRAGIKMWMLTGDKRETAINIGYSCNLIHDYSTVVILSAKDENISS-------------- 1088

Query: 1082 KYLREKFGMSGSEEELKEAKREHGLPQGNFAVIIDGDALKVALNGEEMRRKFLLLCKNCK 1141
                    ++   +E++     H +      V+IDG  L    +   +   F+ LC    
Sbjct: 1089 -------KLTAVSQEIERGNIAHCV------VVIDGSTLTTFESNPTLMSVFVELCTKTD 1135

Query: 1142 AVLCCRVSPXXXXXXXXXXXXT-LDVMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVM 1200
            +V+CCR SP            T   ++TLAIGDG+ND+AMIQSAD+GVGIAG+EG QA  
Sbjct: 1136 SVICCRASPSQKALMVTHIRNTDKKLVTLAIGDGANDIAMIQSADIGVGIAGKEGLQASR 1195

Query: 1201 CSDYAIGQFRYVTRLVLVHGKWCYKRLAEMIPQFFYKNVIFTLSLFWYGIYNNFDGSYLF 1260
             SDY+I QFR++ +L+LVHG++ Y R  + +   FYK ++F L+   Y  +  F G+ L+
Sbjct: 1196 SSDYSIAQFRFLLKLLLVHGRYNYVRTTKFVLCTFYKELLFYLTQMIYQRHTMFSGTSLY 1255

Query: 1261 EYTYLTFYNLAFTSVPVILLAVLDQDVSDTVSMLVPQLYRVGILRKEWNQTKFLWYMLDG 1320
            E   L+ +N  FTS+PV+ + + ++D+     + +P+LY +G L + +N   FL++M   
Sbjct: 1256 EPWSLSMFNTLFTSLPVLCIGMFEKDLKPMTLLAIPELYSIGRLSQSFNLRVFLYWMFLA 1315

Query: 1321 VYQSVICFFFPYLAYHKNMVVTENGLGLDHRYFVGVFVTAIAVTSCNFYV-FMEQYRWDW 1379
               S+I  F  +  +        + L  +  Y +GV      +T  N     +E +  + 
Sbjct: 1316 ALNSLIITFLNWKIW------AVSSLSDNTVYPIGVINFTAIITLVNVKCQLLETHNRNV 1369

Query: 1380 FCGLFICLSLAVFYGWTGIWTXXXXXNEFYKGAARVFAQ----PAYWAVLFVGVLFCLLP 1435
                 + +S+  +  W  +       +  Y     ++ Q      +W    V V+  L+ 
Sbjct: 1370 LAICSLVISVGGWLLWCCLLPGIYSEDGMYDVLTGLYFQFGNDITFWCACLVLVVLPLII 1429

Query: 1436 RFTIDCIRKIFYPKDIEIVREM 1457
                  ++ + +P D EI  E+
Sbjct: 1430 DVVFKTVKIMIFPSDSEISMEL 1451

 Score =  289 bits (739), Expect = 7e-79,   Method: Compositional matrix adjust.
 Identities = 225/768 (29%), Positives = 373/768 (48%), Gaps = 119/768 (15%)

Query: 229 YPRNKIRTTKYTPLTFFPKNILFQFHNFANIYFLILLILGAFQIFGVTNPGFASVPLIVI 288
           Y  N I +++YT  TF P+ +  QF   AN YF ++ +L     +  T      VPL++ 
Sbjct: 108 YISNLITSSRYTIYTFLPRQLYAQFSRLANAYFFLVAVLQMIPGWSTTGTYTTIVPLLIF 167

Query: 289 VIITAIKDGIEDSRRTVLDLEVNNTRTHILSGVKNENVAVDNVSLWRRFKKANTRALIKI 348
           + I+  ++  +D RR  LD E N+         K   V V + S    F + N       
Sbjct: 168 MGISMSREAWDDFRRHKLDREEND---------KTARVLVKSSSPHTEFSRPN------- 211

Query: 349 FEYFSENLTAAGXXXXXXXXXXXXXXXXNSRSFGPRGSLDSIGSYRMSADFGRPSLDYEN 408
                                                SL S+  ++ SA      L    
Sbjct: 212 -------------------------------------SLYSLPQWQQSAT-STSMLTNPT 233

Query: 409 LNQTMSQANRYNDGENLVDRTLQPNPECRFAKDYWKNVKVGDIVRVHNNDEIPADMILLS 468
           L  T   A   ND     D  L+        +  WK++KVGD V +  ++ +PADM++L+
Sbjct: 234 LESTAEAATSQNDDHTNWD-LLKSKYGVEAVEKKWKDIKVGDYVVLEQDEWVPADMLVLT 292

Query: 469 TSDVDGACYVETKNLDGETNLKVRQSL-KCSKIIKSSRDITRTKFWVESEGPHANLYSYQ 527
            SD    C+VET  LDGETNLK +Q L + S+++K++  +T  K  V  E P+ +L++++
Sbjct: 293 CSDEKNECFVETMALDGETNLKNKQPLTEVSEVMKTAAGLTEFKAKVTVEDPNIDLHNFE 352

Query: 528 GNFKWQDTQNGNIRNEPVNINNLLLRGCTLRNTKWAMGMVIFTGDDTKIMINAGVTP-TK 586
           GN +      G  R   +  ++++ RG  +RNT  A+GMV+FTG++TKI +NA   P  K
Sbjct: 353 GNLELL----GENRKLTIGPDHIIYRGSIIRNTSNAVGMVVFTGEETKIRMNAIKNPRIK 408

Query: 587 KSRISRELNFSVI-LNFVLLFILCFTAGIVNGVYYKQKPRSRDYFEFGTIGGSASTNGFV 645
             ++ R +N  V+ + FV+  +  F+      +  K    +R ++ F +  G A T   +
Sbjct: 409 APKLQRAINLIVLFMVFVVASMALFSLLGQRIIKKKYVDNNRAWYLFNSDAGLAPT--VM 466

Query: 646 SFWVAVILYQSLVPISLYISVEIIKTAQAIFIYTDVLLYNAKLDYPCTPKSWNISDDLGQ 705
           SF   +I+Y +L+P+SLY+++EIIK  Q+  +  D+ +Y+A+ + PC  ++  I ++LGQ
Sbjct: 467 SF---IIMYNTLIPLSLYVTMEIIKAMQSKLMEWDIDMYHAETNTPCESRTATILEELGQ 523

Query: 706 IEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQG-----VDVESEGRRE 760
           + YIFSDKTGTLT N M F+  ++ G S+   +  A   L K +      V+V S   R 
Sbjct: 524 VSYIFSDKTGTLTDNKMVFRALSVCGSSWIHDFDPAAEKLTKSESSDSNTVEVVSVDDRS 583

Query: 761 --------KEEIAKDRETMIDELRSMSD--------NTQFCPEDLT-------------- 790
                     ++  + +T ID   + S          ++ C ED                
Sbjct: 584 FLQNFGAADRKVPSNHKTSIDYKGNSSAIYTGRPSMASRICEEDKNPKKIEPEKSSKTGL 643

Query: 791 FVSKEIVEDLKGSSGDHQQKCCEHFLLALALCHSVLVEPNK--DDPKKLDIKAQSPDESA 848
             S E++  ++ +   H  K    F+L+LALCH+ L + +   +    ++ +A SPDE A
Sbjct: 644 RSSTELIRYIQQNPNTHFAKKVSFFILSLALCHACLPKSSSGVEGEDCVEYQASSPDELA 703

Query: 849 LVSTARQLGYSFVGSSKSGLIVEI--QGVQKE-----FQVLNVLEFNSSRKRMSCIIKIP 901
           LV+ AR +GY+ +  +   L ++    G   E     +++LN +EF+S RKRMS ++++ 
Sbjct: 704 LVTAARDMGYAVMNRNSDVLTIKTYPNGFDAEPHLDKYEILNNIEFSSHRKRMSVLVRL- 762

Query: 902 GSTPKDEPKALLICKGADSVIYSRLDRTQNDATLLEKTALHLEEYATE 949
              P +E + LLICKGAD+VI  RL    +++ L  +  + L+E  +E
Sbjct: 763 ---PHEENRILLICKGADNVILERL----HNSDLANQKIVELQETTSE 803

>KLLA0E01650g complement(155975..160627) similar to sp|Q12674
            Saccharomyces cerevisiae YMR162c, start by similarity
          Length = 1550

 Score =  293 bits (750), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 182/544 (33%), Positives = 286/544 (52%), Gaps = 47/544 (8%)

Query: 930  QNDATLLEKTALHLEEYATEGLRTLCLAQRELTWSEYERWVKTYDVAAASVTNREEELDK 989
            +N+  +LEKT   ++E++TEGLRTL  + + +   EY+ W   Y  A  S+TNR  ++ +
Sbjct: 931  KNEEFILEKTLNAIDEFSTEGLRTLLYSYKWIPAEEYKAWEAKYHEAKTSLTNRSTQIAE 990

Query: 990  VTDVIERELILLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCNVL 1049
            V   IE +L LLG TAIED+LQ+GVP++I  +  AGIK+W+LTGDK ETAINIG++C ++
Sbjct: 991  VGGHIETDLELLGATAIEDKLQEGVPEAIQKIRRAGIKMWMLTGDKRETAINIGYACKLI 1050

Query: 1050 NNDMELLVVKASGEDVEEFGSDPIQVVNNLVTKYLREKFGMSGSEEELKEAKREHGLPQG 1109
             +   ++++K + +              NL++K       M+   EEL   K  H +   
Sbjct: 1051 YDYSTVVILKKNDD--------------NLISK-------MTALGEELDTGKIAHCV--- 1086

Query: 1110 NFAVIIDGDALKVALNGEEMRRKFLLLCKNCKAVLCCRVSPXXXXXXXXX-XXXTLDVMT 1168
               ++IDG +L V  N   M   F+ LC    +V+CCR SP               D++T
Sbjct: 1087 ---LVIDGASLAVFENNPTMMSVFIELCTKTDSVICCRASPSQKALIVTNIRLKNKDLVT 1143

Query: 1169 LAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFRYVTRLVLVHGKWCYKRLA 1228
            LAIGDG+ND+AMIQSAD+GVGI G+EG QA   SDY+I QFRY+ +L+ VHG++ Y R +
Sbjct: 1144 LAIGDGANDIAMIQSADIGVGITGKEGLQASRSSDYSIAQFRYLLKLLFVHGRYNYVRTS 1203

Query: 1229 EMIPQFFYKNVIFTLSLFWYGIYNNFDGSYLFEYTYLTFYNLAFTSVPVILLAVLDQDVS 1288
            + +   FYK V+F L+   Y     F G+ L+E   L+ +N  FTS+PVI + + ++D+ 
Sbjct: 1204 KFVLCTFYKEVLFYLTQMIYQRQTMFSGTSLYEPWSLSMFNTLFTSLPVICIGMFEKDLK 1263

Query: 1289 DTVSMLVPQLYRVGILRKEWNQTKFLWYMLDGVYQSVICFFFPYLAYHKNMVVTENGLGL 1348
                + VP+LY +G   + +N   FL +ML     SV+  F  +  +      ++N +  
Sbjct: 1264 PMTLLAVPELYTMGQKCQAFNLKIFLVWMLTAAGISVLITFLNFEIWGFT-AQSDNSI-- 1320

Query: 1349 DHRYFVGVFVTAIAVTSCNFYV-----FMEQYRWDWFCGLFICLSLAVFYGWTGIWTXXX 1403
               Y +GV    I  TS  F +     F+E    +W     + +S   +  W  +     
Sbjct: 1321 ---YPIGV----INFTSICFLINVKCQFIETRNRNWLAFASLLISCIGWILWCCLLPGIY 1373

Query: 1404 XXNEFYKGAARVFAQ----PAYWAVLFVGVLFCLLPRFTIDCIRKIFYPKDIEIVREMWL 1459
              N  Y     ++ Q      +WA   + ++F ++        R + +P D +I  E+  
Sbjct: 1374 GENAIYDVLIGLYHQFGRDITWWASCLILIMFPMMIDIVCQTFRAMIWPTDGDIFAELEQ 1433

Query: 1460 RGDF 1463
            + D 
Sbjct: 1434 KDDI 1437

 Score =  236 bits (602), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 168/553 (30%), Positives = 284/553 (51%), Gaps = 75/553 (13%)

Query: 430 LQPNPECRFAKDYWKNVKVGDIVRVHNNDEIPADMILLSTSDVDGACYVETKNLDGETNL 489
           L+   +    K  WK++KVG+ V ++++D +PAD++LLST   +   +VET  LDGETNL
Sbjct: 261 LRSQFDIHIKKKEWKDLKVGEFVLLNSDDWVPADILLLSTDGENNEAFVETMALDGETNL 320

Query: 490 KVRQSL-KCSKIIKSSRDITRTKFWVESEGPHANLYSYQGNFKWQDTQNGNIRNEPVNIN 548
           K +  L + +K + S+  ++        E P+ +LY+++G  +     +G +   P+  +
Sbjct: 321 KSKNPLPELAKRMTSATGLSMHSATTTLEDPNNDLYNFEGTVEI----DGELY--PLGSD 374

Query: 549 NLLLRGCTLRNTKWAMGMVIFTGDDTKIMINAGVTP-TKKSRISRELNFSVILNFVLLFI 607
           N++ RG  LRNT+  +G+VIFTG++TKI +NA   P TK  ++  ++N       ++LF+
Sbjct: 375 NVVYRGSILRNTQSIVGIVIFTGEETKIRMNAIKNPRTKAPKLQGKINL------IVLFM 428

Query: 608 LCFTAGIVNGVYYKQKPRSRDYFE-------FGTIGGSASTNGFVSFWVAVILYQSLVPI 660
           +   A +    Y  Q    ++Y +       F    G+A T   +SF   +I+Y +L+P+
Sbjct: 429 VFVVAAMAMFSYLGQHILKKNYVDNNRAWYLFQEDAGTAPT--IMSF---IIMYNTLIPL 483

Query: 661 SLYISVEIIKTAQAIFIYTDVLLYNAKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQN 720
           SLY++ EIIK  Q+  +  D+ +Y+ + D PC  ++  I ++LGQ+ YIFSDKTGTLT N
Sbjct: 484 SLYVTTEIIKAMQSKLMEWDIDMYHIESDTPCESRTATILEELGQVSYIFSDKTGTLTDN 543

Query: 721 VMEFKKCTINGVSY----------------------GRAYTEAL---AGLRKRQGVDVES 755
            M F+K +I G S+                       R++       +   K     +E 
Sbjct: 544 KMIFRKFSICGSSWLHEIDEDLIDPIDDDIDVISIEDRSFLNEFDLRSTHSKNPRTSIEY 603

Query: 756 EGR-------REKEEIAKDRETMIDELRSMSDNTQFCPEDLTFVSKEIVEDLKGSSGDHQ 808
           +G        R    +   R+ + ++L +   N+    E+   +   +  DL      H 
Sbjct: 604 KGNSGAVYSGRPSMALQIQRQELAEDLNTTRTNSSRSSEEKNGLKTTV--DLLLYIQKHP 661

Query: 809 QK----CCEHFLLALALCHSVLVEPNKDDPKKLDIKAQSPDESALVSTARQLGYSFVGSS 864
                   + F+L+LALCH+ L +   D    +  ++ SPDE ALV+ AR +G+     +
Sbjct: 662 NTEFSIRAKFFILSLALCHTCLPKKTHDGTDSILYQSSSPDELALVTAARDMGFVVTNRN 721

Query: 865 KSGLIVEI-------QGVQKEFQVLNVLEFNSSRKRMSCIIKIPGSTPKDEPKALLICKG 917
            S L +         Q + ++++VL  + F+S RKRMS  +K+P     D+ + LLICKG
Sbjct: 722 SSTLSIATYPNGFDDQPIVEDYEVLEYINFDSQRKRMSVAVKMPN----DDDRVLLICKG 777

Query: 918 ADSVIYSRLDRTQ 930
           AD+VI  RL  ++
Sbjct: 778 ADNVILERLRNSE 790

 Score = 58.5 bits (140), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 35/122 (28%), Positives = 61/122 (50%), Gaps = 1/122 (0%)

Query: 229 YPRNKIRTTKYTPLTFFPKNILFQFHNFANIYFLILLILGAFQIFGVTNPGFASVPLIVI 288
           Y  N I +++YT  +F P+ +  QF   AN YFL++ IL     +  T      VPL + 
Sbjct: 116 YRDNVITSSRYTVYSFLPRQLYAQFSKLANAYFLLVAILQMIPSWSTTGTYTTIVPLSIF 175

Query: 289 VIITAIKDGIEDSRRTVLDLEVNNTRTHILS-GVKNENVAVDNVSLWRRFKKANTRALIK 347
           + I+  ++  +D +R  LD E NN  T +L+ G  ++ +  D++         +T A++ 
Sbjct: 176 LSISMAREAWDDFKRHRLDKEENNKSTKVLTMGKDHDELESDSIYSLSNVSARSTDAILS 235

Query: 348 IF 349
            F
Sbjct: 236 DF 237

>CAGL0H04477g 421857..426737 similar to sp|Q12674 Saccharomyces
            cerevisiae YMR162c, start by similarity
          Length = 1626

 Score =  291 bits (745), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 184/556 (33%), Positives = 290/556 (52%), Gaps = 54/556 (9%)

Query: 912  LLICKGADSVIYSRLDRTQNDATLLEKTALHLEEYATEGLRTLCLAQRELTWSEYERWVK 971
            LL   G+D++I        N+  +LEKT   +E ++TEGLRTL  A + ++  ++E+W  
Sbjct: 941  LLNYIGSDALI-------SNEEYVLEKTLEDIESFSTEGLRTLLFAHKWISNEDFEQWRT 993

Query: 972  TYDVAAASVTNREEELDKVTDVIERELILLGGTAIEDRLQDGVPDSIALLAEAGIKLWVL 1031
             Y  A  S++ R++++D+V   IE EL LLG TAIED+LQ+GV ++I  +  AGIK+W+L
Sbjct: 994  RYHEAKTSLSERKQKIDEVGAQIEDELYLLGATAIEDKLQEGVSEAIEKIRRAGIKMWML 1053

Query: 1032 TGDKVETAINIGFSCNVLNNDMELLVVKASGEDVEEFGSDPIQVVNNLVTKYLREKFGMS 1091
            TGDK ETAINIG+SC ++++   ++++  S E              N+++K       M+
Sbjct: 1054 TGDKRETAINIGYSCKLIHDYSTVVILTTSDE--------------NIISK-------MN 1092

Query: 1092 GSEEELKEAKREHGLPQGNFAVIIDGDALKVALNGEEMRRKFLLLCKNCKAVLCCRVSPX 1151
               +E+      H +      ++IDG  L +  +   +   F  LC    +V+CCR SP 
Sbjct: 1093 AISQEVDSGNVAHCV------IVIDGATLAMFEDNPTLMSVFTELCTKTDSVVCCRASPA 1146

Query: 1152 XXXXXXXXXXXT-LDVMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFR 1210
                       T   ++TLAIGDG+ND+AMIQSAD+GVGIAG+EG QA   +DY+IGQFR
Sbjct: 1147 QKALMVSNIRNTDKSIVTLAIGDGANDIAMIQSADIGVGIAGKEGLQASRSADYSIGQFR 1206

Query: 1211 YVTRLVLVHGKWCYKRLAEMIPQFFYKNVIFTLSLFWYGIYNNFDGSYLFEYTYLTFYNL 1270
            ++ +L+LVHG++ Y R A+ I   FYK + F L+   Y  Y  F G+ L+E   L+ YN 
Sbjct: 1207 FILKLLLVHGRYNYIRTAKFILCTFYKELTFYLTQLIYQRYTMFSGTSLYEPWSLSMYNT 1266

Query: 1271 AFTSVPVILLAVLDQDVSDTVSMLVPQLYRVGILRKEWNQTKFLWYMLDGVYQSVICFFF 1330
             FTS+PV+ + + ++D+     + VP+LY +G L K +N + F  ++  G   ++I  F 
Sbjct: 1267 LFTSLPVLCVGMFEKDLKPVTLLTVPELYSMGRLSKAFNWSIFAEWVFLGTANALIITFL 1326

Query: 1331 PYLAYHKNMVVTENGLGLDHRYFVGVFVTAIAVTSCNFYV-FMEQYRWDWFCGLFICLSL 1389
              +A+       E  L  +  Y +G    +  V   N    F+E    +W     + LS 
Sbjct: 1327 NIVAW------GETSLSDNTLYPLGFVNFSATVALINVKAQFIEMRNRNWLAFTSVILSC 1380

Query: 1390 AVFYGWTGIWTXXXXXNEFYK---GAARVFAQP-AYWAVLFVGVLFCLLPRFTIDCIRKI 1445
              +  W          +  Y    G    F +   +W      ++  +LP   +D + K 
Sbjct: 1381 GGWLVWCCALPILNRSDGIYDVTYGLYHHFGRDITFWC---TSLILAVLP-IIVDVVYKT 1436

Query: 1446 F----YPKDIEIVREM 1457
            F     P D +I  E+
Sbjct: 1437 FKIMLAPSDSDIFAEL 1452

 Score =  236 bits (603), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 166/564 (29%), Positives = 303/564 (53%), Gaps = 75/564 (13%)

Query: 437 RFAKDYWKNVKVGDIVRVHNNDEIPADMILLSTSDVDGACYVETKNLDGETNLKVR-QSL 495
           R  +  WK+++VGD V +  +D +PAD+++L++   +   ++ET  LDGETNLK +    
Sbjct: 257 RIVEKKWKDIRVGDFVLLQQDDWVPADILILTSDGDNSEVFIETMALDGETNLKGKVPHP 316

Query: 496 KCSKIIKSSRDITRTKFWVESEGPHANLYSYQGNFKWQDTQNGNIRNEPVNINNLLLRGC 555
           + +K+ KS+  +      V  E P+ +LY+++GN +  ++ + + +  P+  +N++ RG 
Sbjct: 317 EINKLTKSASGLANINAQVTVEDPNNDLYNFEGNLEL-NSGSSSKKKYPLGPDNVIYRGS 375

Query: 556 TLRNTKWAMGMVIFTGDDTKIMINAGVTP-TKKSRISRELNFSVILNFVLLFILCFTAGI 614
            +RNT+  +GMVIFTG+++KI +NA   P TK  ++ R++N  V+    ++  +   + +
Sbjct: 376 IIRNTRNCVGMVIFTGEESKIRMNALRNPRTKAPKLQRKINMIVVFMVFVVACMSLFSYL 435

Query: 615 VNGVYYKQK-PRSRDYFEFGTIGGSASTNGFVSFWVAVILYQSLVPISLYISVEIIKTAQ 673
            + +  K+    ++ ++      G+A T   +SF   +I+Y +++P+SLY+++E+IK AQ
Sbjct: 436 GHTIQIKRYVNNNKAWYLLQEDAGTAPT--IMSF---IIMYNTIIPLSLYVTMELIKVAQ 490

Query: 674 AIFIYTDVLLYNAKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVS 733
           +  +  D+ +Y+A+ D PC  ++  I ++LGQ+ YIFSDKTGTLT N M F+K +  G S
Sbjct: 491 SRMMEWDIDMYHAESDTPCAVRTATILEELGQVSYIFSDKTGTLTDNKMLFRKLSFCGTS 550

Query: 734 YGRAYTEAL-----AGLRKRQGVDV----------------ESEGRREKE-EIAKDRETM 771
           +    T+ +     A L  +  +DV                +S  +R  +     DR T 
Sbjct: 551 WVHNATQDISEFKPAQLSNKNDIDVISIDDQSFLSKLGYTSQSNPKRYMDINDFPDRRTS 610

Query: 772 ID-------------ELRSM------------SDNTQFCPEDL--TFVSKEIVEDLKGSS 804
           ++              +RS+            S +    PED+  TF   E++  ++ + 
Sbjct: 611 VEYKGNATVKYTGRPSMRSLYVPPKKETNASNSQDASDIPEDIKSTF---ELIYYIQSNP 667

Query: 805 GDHQQKCCEHFLLALALCHSVL---VEPNKDDPKKLDIKAQSPDESALVSTARQLGYSFV 861
                K  + F+L+LA+CH  L    E   D+   ++ ++ SPDE ALV+ AR +GY   
Sbjct: 668 KSLFAKKAKMFILSLAICHICLPKRTEEGNDEDDIIEYQSSSPDELALVTAARDMGYIVY 727

Query: 862 GSSKSGLIVEI--QGVQ-----KEFQVLNVLEFNSSRKRMSCIIKIPGSTPKDEPKALLI 914
             + + L ++    G       + F++L +++FNS RKRMS I+++    P+++ + LL 
Sbjct: 728 NRNANILTLKTFPDGFDELPRFENFEILELVDFNSQRKRMSVIVRV----PEEKDRVLLF 783

Query: 915 CKGADSVIYSRLDRTQNDATLLEK 938
           CKGAD+VI  RL   +    +L++
Sbjct: 784 CKGADNVILERLHNKEMALDMLDQ 807

 Score = 64.7 bits (156), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 49/91 (53%)

Query: 228 VYPRNKIRTTKYTPLTFFPKNILFQFHNFANIYFLILLILGAFQIFGVTNPGFASVPLIV 287
            Y  N I +++YT ++FFP+ +  QF   AN+YF I+ IL     +  T      VPL V
Sbjct: 122 AYCNNLITSSRYTIISFFPRQLYAQFSKLANVYFFIVAILQMIPGWSTTGTYTTIVPLCV 181

Query: 288 IVIITAIKDGIEDSRRTVLDLEVNNTRTHIL 318
            + I+  ++  +D RR  LD E NN  T +L
Sbjct: 182 FMAISMAREAYDDYRRHKLDKEENNKLTKVL 212

>YMR162C (DNF3) [4117] chr13 complement(578950..583920) Member of the
            Drs2p-like family of the P-type ATPase superfamily of
            membrane transporters [4971 bp, 1656 aa]
          Length = 1656

 Score =  279 bits (714), Expect = 8e-76,   Method: Compositional matrix adjust.
 Identities = 176/542 (32%), Positives = 279/542 (51%), Gaps = 45/542 (8%)

Query: 931  NDATLLEKTALHLEEYATEGLRTLCLAQRELTWSEYERWVKTYDVAAASVTNREEELDKV 990
            N+  ++E+T   ++E++TEGLRTL  A + +   +YE W K Y  A  S+T+R+ ++D+ 
Sbjct: 1013 NEEYVIERTLQAIDEFSTEGLRTLVYAYKWIDIGQYENWNKRYHQAKTSLTDRKIKVDEA 1072

Query: 991  TDVIERELILLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCNVLN 1050
               IE  L LLG TAIED+LQDGV ++I  +  AGIK+W+LTGDK ETAINIG+SC ++ 
Sbjct: 1073 GAEIEDGLNLLGVTAIEDKLQDGVSEAIEKIRRAGIKMWMLTGDKRETAINIGYSCMLIK 1132

Query: 1051 NDMELLVVKASGEDVEEFGSDPIQVVNNLVTKYLREKFGMSGSEEELKEAKREHGLPQGN 1110
            +   ++++  + E              N+++K       M+   +E+      H +    
Sbjct: 1133 DYSTVVILTTTDE--------------NIISK-------MNAVSQEVDSGNIAHCV---- 1167

Query: 1111 FAVIIDGDALKVALNGEEMRRKFLLLCKNCKAVLCCRVSPXXXXXXXXXXXXT-LDVMTL 1169
              V+IDG  + +          F+ LC    +V+CCR SP            T  +++TL
Sbjct: 1168 --VVIDGATMAMFEGNPTYMSVFVELCTKTDSVICCRASPSQKALMVSNIRNTDPNLVTL 1225

Query: 1170 AIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFRYVTRLVLVHGKWCYKRLAE 1229
            AIGDG+ND+AMIQSAD+GVGIAG+EG QA   SDY+IGQFR++ +L+ VHG++ Y R ++
Sbjct: 1226 AIGDGANDIAMIQSADIGVGIAGKEGLQASRVSDYSIGQFRFLLKLLFVHGRYNYIRTSK 1285

Query: 1230 MIPQFFYKNVIFTLSLFWYGIYNNFDGSYLFEYTYLTFYNLAFTSVPVILLAVLDQDVSD 1289
             +   FYK + F  +   Y  Y  F GS L+E   L+ +N  FTS+PV+ + + ++D+  
Sbjct: 1286 FMLCTFYKEITFYFTQLIYQRYTMFSGSSLYEPWSLSMFNTLFTSLPVLCIGMFEKDLKP 1345

Query: 1290 TVSMLVPQLYRVGILRKEWNQTKFLWYMLDGVYQSVICFFFPYLAYHKNMVVTENGLGLD 1349
               + VP+LY  G L + +N   F+ +++     S+I  F   + +  + +       L 
Sbjct: 1346 MTLLTVPELYSYGRLSQGFNWLIFMEWVILATTNSLIITFLNVVMWGMSSLSDNTMYPLG 1405

Query: 1350 HRYFVGVFVTAIAVTSCNFYVFMEQYRWDWFCGLFICLSLAVFYGWTGIWTXXXXXNEFY 1409
               F  + V  I V S     F+E +  +W     + LS   +  W          ++ Y
Sbjct: 1406 LINFTAI-VALINVKS----QFVEMHNRNWLAFTSVVLSCGGWLVWCCALPILNNTDQIY 1460

Query: 1410 KGAARVFAQ----PAYWAVLFVGVLFCLLPRFTIDCIRKIF----YPKDIEIVREMWLRG 1461
              A   +        +W    V     LLP  T+D + K F    +P D +I  E+  + 
Sbjct: 1461 DVAYGFYNHFGKDITFWCTSLV---LALLP-ITLDIVYKTFKVMIWPSDSDIFAELEQKS 1516

Query: 1462 DF 1463
            D 
Sbjct: 1517 DI 1518

 Score =  213 bits (541), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 172/607 (28%), Positives = 294/607 (48%), Gaps = 113/607 (18%)

Query: 443 WKNVKVGDIVRVHNNDEIPADMILLSTSDVDGACYVETKNLDGETNLKVRQSL-KCSKII 501
           W+ ++VGD V +  +D +PAD++LL+    +  C+VET  LDGETNLK +Q   + +K+ 
Sbjct: 299 WEKLRVGDFVLLTQDDWVPADLLLLTCDGENSECFVETMALDGETNLKSKQPHPELNKLT 358

Query: 502 KSSRDITRTKFWVESEGPHANLYSYQGNFKWQDTQNGNIRNEPVNINNLLLRGCTLRNTK 561
           K++  +      V  E P+ +LY+++GN + ++ +N  I   P+  +N++ RG  LRNT+
Sbjct: 359 KAASGLANINAQVTVEDPNIDLYNFEGNLELKNHRNDTIMKYPLGPDNVIYRGSILRNTQ 418

Query: 562 WAMGMVIFTGDDTKIMINAGVTP-TKKSRISRELNFSVI-LNFVLLFILCFTAGIVNGVY 619
             +GMVIF+G++TKI +NA   P TK  ++ R++N  ++ + FV+  I  F+   +  V 
Sbjct: 419 NVVGMVIFSGEETKIRMNALKNPRTKAPKLQRKINMIIVFMVFVVATISLFS--YLGHVL 476

Query: 620 YKQK--PRSRDYFEFGTIGGSASTNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAIFI 677
           +K+K   +++ ++ F    G A T   +SF   +I+Y +++P+SLY+++EIIK  Q+  +
Sbjct: 477 HKKKYIDQNKAWYLFQADAGVAPT--IMSF---IIMYNTVIPLSLYVTMEIIKVVQSKMM 531

Query: 678 YTDVLLYNAKLDYPCTPK-------------------------------------SWNIS 700
             D+ +Y+A+ + PC  +                                     SW  +
Sbjct: 532 EWDIDMYHAETNTPCESRTATILEELGQVSYIFSDKTGTLTDNKMIFRKFSLCGSSWLHN 591

Query: 701 DDLGQIEYIFSDK---TGTLTQNVMEFKKCTINGVSYGR-------AYTEALAGLRKRQG 750
            DLG  E  F D    T +L          +I+ VS G         +++A      R  
Sbjct: 592 VDLGNSEDNFEDNRDNTNSLRLPPKAHNGSSIDVVSIGDQNVLDRLGFSDAPIEKGHRPS 651

Query: 751 VDVESEGRREKE------EIAKDRETMIDELRSM--SDNTQFCPEDLTFVSKEIVEDLKG 802
           +D   + R   E       I   R +M    RS+   DN+    +       E   +   
Sbjct: 652 LDNFPKSRNSIEYKGNSSAIYTGRPSM----RSLFGKDNSHLSKQASVISPSETFSENIK 707

Query: 803 SSGDHQQ-----------KCCEHFLLALALCHSVLVEPNKDDP---KKLDIKAQSPDESA 848
           SS D  Q           +  + F L+LALCHS L +   ++      ++ ++ SPDE A
Sbjct: 708 SSFDLIQFIQRYPTALFSQKAKFFFLSLALCHSCLPKKTHNESIGEDSIEYQSSSPDELA 767

Query: 849 LVSTARQLGYSFVGSSKSGLIVEI-------QGVQKEFQVLNVLEFNSSRKRMSCIIKIP 901
           LV+ AR LGY  +  +   L ++        +   + +++LN ++FNS RKRMS ++++P
Sbjct: 768 LVTAARDLGYIVLNRNAQILTIKTFPDGFDGEAKLENYEILNYIDFNSQRKRMSVLVRMP 827

Query: 902 GSTPKDEP-KALLICKGADSVIYSRLDRTQNDATLLEKTALHLEEYATEGLRTLCLAQRE 960
                ++P + LLICKGAD+VI  R               LH  E A + +  +C + +E
Sbjct: 828 -----NQPNQVLLICKGADNVIMER---------------LHDRELAAKKMADICTSTKE 867

Query: 961 LTWSEYE 967
              +E E
Sbjct: 868 RKDAEAE 874

 Score = 55.5 bits (132), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 32/97 (32%), Positives = 50/97 (51%), Gaps = 2/97 (2%)

Query: 229 YPRNKIRTTKYTPLTFFPKNILFQFHNFANIYFLILLILGAFQIFGVTNPGFASVPLIVI 288
           Y  N+I +++YT  +F P+ +  QF   AN YF I+ +L     +  T      +PL V 
Sbjct: 138 YCDNRITSSRYTFYSFLPRQLYAQFSKLANTYFFIVAVLQMIPGWSTTGTYTTIIPLCVF 197

Query: 289 VIITAIKDGIEDSRRTVLDLEVNNTRTHILSGVKNEN 325
           + I+  ++  +D RR  LD E NN    +L  VK+ N
Sbjct: 198 MGISMTREAWDDFRRHRLDKEENNKPVGVL--VKDGN 232

>AFL191W [3004] [Homologous to ScYMR162C (DNF3) - SH]
            complement(79156..83883) [4728 bp, 1575 aa]
          Length = 1575

 Score =  276 bits (706), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 186/567 (32%), Positives = 285/567 (50%), Gaps = 64/567 (11%)

Query: 927  DRTQNDATLLEKTALHLEEYATEGLRTLCLAQRELTWSEYERWVKTYDVAAASVTNREEE 986
            D   N+  ++E+T   ++ + TEGLRTL  + + +   EYE W   Y  A A++ NR E+
Sbjct: 929  DLITNEEYVIERTLQDMDAFTTEGLRTLLYSFKWIGNQEYETWNSRYSAAKAALVNRREQ 988

Query: 987  LDKVTDVIERELILLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSC 1046
            +D V ++IER+L LLG   IED+LQ+GVPD+I  L  AGIK+W+LTGDK ETAINIG+SC
Sbjct: 989  MDTVGEIIERDLTLLGTIGIEDKLQEGVPDAIDKLRRAGIKMWMLTGDKRETAINIGYSC 1048

Query: 1047 NVLNNDMELLVVKASGEDVEEFGSDPIQVVNNLVTKYLREKFGMSGSEEELKEAKREHGL 1106
             ++++   ++++  + E              N+ +K       ++   +E++     H +
Sbjct: 1049 RLIHDYSTVIILAPNDE--------------NMASK-------ITTITQEIEAGNVAHCV 1087

Query: 1107 PQGNFAVIIDGDALKVALNGEEMRRKFLLLCKNCKAVLCCRVSPXXXXXXXXXXXXT-LD 1165
                  V+IDG  L +      +   F+ LC    +V+CCR SP            T   
Sbjct: 1088 ------VVIDGATLTIFEGNLTLMTLFIELCTKTDSVICCRSSPSQKALMVTKIRKTDKK 1141

Query: 1166 VMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFRYVTRLVLVHGKWCYK 1225
            ++TLAIGDG+ND+AMIQSAD+GV I G+EG QA   SDY+I QFRY+ +L+LVHG++ Y 
Sbjct: 1142 LVTLAIGDGANDIAMIQSADIGVDITGKEGLQASRSSDYSIAQFRYLLKLLLVHGRYNYI 1201

Query: 1226 RLAEMIPQFFYKNVIFTLSLFWYGIYNNFDGSYLFEYTYLTFYNLAFTSVPVILLAVLDQ 1285
            R ++ +   FYK  +F L+   + I   F G+  +E   LT +N  FTS+PV+ + + ++
Sbjct: 1202 RTSKFVLCTFYKEFVFYLTQLIFQINTMFSGTSQYEPWCLTVFNTLFTSLPVLCIGMFEK 1261

Query: 1286 DVSDTVSMLVPQLYRVGILRKEWNQTKFLWYMLDGVYQSVICFFFPYLAYHKNMVVTENG 1345
            D+     + +P+LY  G   + +N   FL +M      SVI  F  +  +      ++N 
Sbjct: 1262 DLKSVTLLSIPELYTTGRQSQAFNLVIFLRWMAIAALSSVIICFTNWQCWSLT-AQSDNT 1320

Query: 1346 LGLDHRYFVGVF-VTAIAV---TSCNFYVFMEQYRWDWFCGLFI--------CLSLAVFY 1393
            L     Y +G+   TA+ V     C   + M    W  F   FI        CL L   Y
Sbjct: 1321 L-----YPIGLINYTAVVVLVNVKCQL-LEMANRNWLAFASFFISVCGWLCWCLLLPAIY 1374

Query: 1394 GWTGIWTXXXXXNEFYKGAARVFAQP-AYWAVLFVGVLFCLLPRFTIDCIRKIFYPKDIE 1452
              T ++       +  +G    F     +WA   V VL  ++        + I YP D E
Sbjct: 1375 KETLVY-------DVREGLYHQFGPDITFWATNLVLVLLPVMLDLLFKTCKVIIYPSDTE 1427

Query: 1453 IVREMWLR---------GDFDLYPQGY 1470
            I  E+  R         G F+   QG+
Sbjct: 1428 IFAELEQRDAVRKKLEFGAFNELKQGW 1454

 Score =  243 bits (619), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 182/601 (30%), Positives = 308/601 (51%), Gaps = 82/601 (13%)

Query: 398 DFGRPSLDYENLNQ---TMSQANRYNDGEN-----------LVD-RTLQPNPECRFAKDY 442
           DF R  LD E  N+    ++QA+    G+N             D  TLQ N      +  
Sbjct: 181 DFRRHKLDREENNKLVKVLAQAHDSEFGDNKDISAEARAASFTDFETLQANHGVAVVEKQ 240

Query: 443 WKNVKVGDIVRVHNNDEIPADMILLSTSDVDGACYVETKNLDGETNLKVRQSL-KCSKII 501
           WK+V+VG+ V ++ +D +PAD+ LL+T   +  CYVET  LDGETNLK +  L K +   
Sbjct: 241 WKDVEVGEFVLLNQDDWVPADLFLLATDGDNNECYVETMALDGETNLKCKHVLPKIASQT 300

Query: 502 KSSRDITRTKFWVESEGPHANLYSYQGNFKWQDTQNGNIRNEPVNINNLLLRGCTLRNTK 561
           +++  +   +     E P+ +LY+++G  +  +T +G  +   + ++N+L RG  +RNT+
Sbjct: 301 RTASGLATFRGMTTVEDPNIDLYNFEGKIE-VETDSGEQQAYSIGLDNVLFRGSIIRNTQ 359

Query: 562 WAMGMVIFTGDDTKIMINAGVTPTKKS-RISRELNFSVILNFVLLFILCFTA-GIVNGVY 619
             +GMV+FTG++TKI +NA   P  KS ++  ++N  V+   +++ I  F + G+     
Sbjct: 360 TVVGMVVFTGEETKIRMNAIKNPRIKSPKLQTQINLIVLFMILVVAIFSFLSFGLQRFFK 419

Query: 620 YKQKPRSRDYFEFGTIGGSASTNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAIFIYT 679
            ++    R ++      G A T   +SF   +I+Y +L+P+SLY+++EIIK  Q+  +  
Sbjct: 420 NREVDSDRAWYLMKVDAGLAPT--IMSF---IIMYNTLIPLSLYVTMEIIKDMQSRLMEW 474

Query: 680 DVLLYNAKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSY----G 735
           D+ +Y+ + +  CT ++  I ++LGQ+ YIFSDKTGTLT N M F+K +  G ++     
Sbjct: 475 DIDMYHLETNTGCTSRTATILEELGQVSYIFSDKTGTLTDNRMIFRKFSFCGTAWEHDVA 534

Query: 736 RAYTEALAGLRKR--QGVDVESEGRREKEEI-AKDRETMID------------------- 773
           R   E      K+  + + VES    +  E+ + D  T ++                   
Sbjct: 535 RKDQETGCSQTKKDVEVISVESNSFIKNFELNSTDTRTSVEYKGLASATYTGRPSIASQI 594

Query: 774 ---ELRSMSDNTQ--------------FCPEDLTFVSKEIVEDLKGSSGDHQQKCCEHFL 816
              +L+  S NT                 PE     S +++  ++ +      +  + F+
Sbjct: 595 ELMKLQQNSANTNKSSSPKISRLPTLDSSPEPKLKTSLDLIMHIQLNPNTVFSQRAKFFI 654

Query: 817 LALALCHSVLVE----PNKDDPKKLDIKAQSPDESALVSTARQLGYSFVGSSKSGLIV-- 870
           LALALCH+ L +     +  D   ++ ++ SPDE ALV+ AR +GY  +  +   L +  
Sbjct: 655 LALALCHTCLPKKRQGADSGDFDSVEYQSSSPDELALVTAARDMGYVVLNRNGDELTIKT 714

Query: 871 -----EIQGVQKEFQVLNVLEFNSSRKRMSCIIKIPGSTPKDEPKALLICKGADSVIYSR 925
                E   V ++++VLN ++F+S RKRMS ++++     +   K LLICKGAD+VI  R
Sbjct: 715 YPDGFEADCVLEKYEVLNTIDFSSDRKRMSVLVRM----HQHPEKVLLICKGADNVILER 770

Query: 926 L 926
           L
Sbjct: 771 L 771

 Score = 54.3 bits (129), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 32/97 (32%), Positives = 48/97 (49%), Gaps = 3/97 (3%)

Query: 223 GLPLAVYPRNKIRTTKYTPLTFFPKNILFQFHNFANIYFLILLILGAFQIFGVTNPGFAS 282
           GLP   Y  N I +++Y+  +F P+ +  QF    N YF  + IL     +  T      
Sbjct: 107 GLP---YIGNAITSSRYSVYSFLPRQLCAQFSKVVNSYFFGMAILQMVPNWSTTGQYTTI 163

Query: 283 VPLIVIVIITAIKDGIEDSRRTVLDLEVNNTRTHILS 319
           VPL + + I+  ++G ED RR  LD E NN    +L+
Sbjct: 164 VPLSIFMGISIAREGWEDFRRHKLDREENNKLVKVLA 200

>Scas_669.3
          Length = 1638

 Score =  267 bits (683), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 185/585 (31%), Positives = 297/585 (50%), Gaps = 73/585 (12%)

Query: 910  KALLICKGADSVIYSRLDRTQNDATLLEKTALHLEEYATEGLRTLCLAQRELTWSEYERW 969
            K +L   G+D ++        ND  ++EKT   ++E++TEGLRTL  + + +   EY++W
Sbjct: 973  KGMLEYIGSDDLLL-------NDGYVIEKTIQAIDEFSTEGLRTLVYSYKWVDLQEYQQW 1025

Query: 970  VKTYDVAAASVTNREEELDKVTDVIERELILLGGTAIEDRLQDGVPDSIALLAEAGIKLW 1029
               Y  A  S+TNR+ ++ +V + IE++L LLG TAIED+LQ+GV ++I  +  AGIK+W
Sbjct: 1026 EDRYHDAKISLTNRKSKIAEVGEEIEQDLQLLGATAIEDKLQEGVSEAIEKIRRAGIKIW 1085

Query: 1030 VLTGDKVETAINIGFSCNVLNNDMELLVVKASGEDVEEFGSDPIQVVNNLVTKYLREKFG 1089
            +LTGDK ETAINIG+SC ++  D   +V+ A G++             N+++K       
Sbjct: 1086 MLTGDKRETAINIGYSCKLIY-DYSTVVILAKGDE-------------NIISK------- 1124

Query: 1090 MSGSEEELKEAKREHGLPQGNFAVIIDGDALKVALNGEEMRRKFLLLCKNCKAVLCCRVS 1149
            M+   +E+      H +      +IIDG  L +      +   F+ LC    +V+CCR S
Sbjct: 1125 MNAISQEVDSGNVAHCV------IIIDGSTLAMFEGNPTLMSVFIELCTKTDSVICCRAS 1178

Query: 1150 PXXXXXXXXXXXXT-LDVMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQ 1208
            P            +  +++TLAIGDG+ND+AMIQSAD+G+GI G+EG QA   +DY+I Q
Sbjct: 1179 PSQKSLMVTNIRNSNKNLVTLAIGDGANDIAMIQSADIGIGIGGKEGLQASRTADYSIAQ 1238

Query: 1209 FRYVTRLVLVHGKWCYKRLAEMIPQFFYKNVIFTLSLFWYGIYNNFDGSYLFEYTYLTFY 1268
            FR++ +L+LVHG++ Y R A+ I   F+K + F L+   +  Y  F GS L+E   L+ +
Sbjct: 1239 FRFILKLLLVHGRYNYIRTAKFILCTFFKEITFYLTQLIFQRYTMFSGSSLYEPWSLSMF 1298

Query: 1269 NLAFTSVPVILLAVLDQDVSDTVSMLVPQLYRVGILRKEWNQTKF-LWYMLDGVYQSVIC 1327
            N  FTS+PV+ + + ++D+     + +P+LY +G L + +N   F  W +    Y  +I 
Sbjct: 1299 NTLFTSLPVLCIGMFEKDLKPMTLLTIPELYSMGRLSQGFNLIIFGEWVIQAAAYALLIT 1358

Query: 1328 FFFPYLAYHKNMVV-TENGLGLDHRYFVGVF----VTAIAVTSCNFYVFMEQYRWDWFCG 1382
            F         N+++  E  L     Y +GV     + A+    C    F+E    +W   
Sbjct: 1359 FL--------NIIIWGETALSDHTMYPLGVINFTAIVALVNVKCQ---FIEMNNRNWVVF 1407

Query: 1383 LFICLSLAVFYGWTGIWTXXXXXNEFYKGAARVFAQ----PAYWAVLFVGVLFCLLPRFT 1438
              + LS   +  W          +  Y      F        +W   FV     +LP  T
Sbjct: 1408 TSVILSCGGWLVWCCALPILNRSDVIYDVPYGFFYHFGKDITWWCSCFV---LAVLP-IT 1463

Query: 1439 IDCIRKIF----YPKDIEI---------VREMWLRGDFDLYPQGY 1470
            ID + + F    +P D +I         +R+    G ++   QG+
Sbjct: 1464 IDIVYQTFKTMIWPSDADIFSVLEQKSEIRKKLEMGAYNEMKQGW 1508

 Score =  188 bits (478), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 103/303 (33%), Positives = 183/303 (60%), Gaps = 12/303 (3%)

Query: 437 RFAKDYWKNVKVGDIVRVHNNDEIPADMILLSTSDVDGACYVETKNLDGETNLKVRQSL- 495
           R  +  W N+ VGD V +  ++ +PAD+++L++   +  C+VET  LDGETNLKV+Q   
Sbjct: 279 RIQETTWSNLHVGDFVLLKQDNWVPADILVLTSDGDNNECFVETMALDGETNLKVKQPHP 338

Query: 496 KCSKIIKSSRDITRTKFWVESEGPHANLYSYQGNFKWQDTQNGNIRNEPVNINNLLLRGC 555
           + +K+  S+  +      +  E P+++LY+++GN +  D  N +++  PV  +N+  RG 
Sbjct: 339 ELNKLACSASGLANINALITVEDPNSDLYNFEGNLELTDNNNNSLKKYPVGPDNVAYRGS 398

Query: 556 TLRNTKWAMGMVIFTGDDTKIMINAGVTP-TKKSRISRELNFSVILNFVLLFILCFTAGI 614
            +RNT   +GMVI+TG +TKI +NA   P TK  ++ + +N  +I+ F++  +   +   
Sbjct: 399 IIRNTDNVIGMVIYTGKETKIRMNALNNPRTKAPKLQKNIN--IIITFMVFVVAVISLFS 456

Query: 615 VNGVYYKQKP---RSRDYFEFGTIGGSASTNGFVSFWVAVILYQSLVPISLYISVEIIKT 671
             G   + K     ++ ++      G+A T   +SF   +I+Y +++P+SLY+++EIIK 
Sbjct: 457 YLGHVLQNKKAIDENQAWYLLTKDAGAAPT--IMSF---IIMYNTIIPLSLYVTMEIIKA 511

Query: 672 AQAIFIYTDVLLYNAKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTING 731
            Q+  +  D+ +Y+++ + PC  ++  I ++LGQ+ Y+FSDKTGTLT N M F+K +I G
Sbjct: 512 MQSKMMEWDIDMYHSETNTPCESRTATILEELGQVSYMFSDKTGTLTDNKMIFRKFSICG 571

Query: 732 VSY 734
            S+
Sbjct: 572 SSW 574

 Score = 88.6 bits (218), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 54/130 (41%), Positives = 80/130 (61%), Gaps = 20/130 (15%)

Query: 810 KCCEHFLLALALCHSVLVEPNKDD-PKK----LDIKAQSPDESALVSTARQLGYSFVGSS 864
           K  + F+L+LALCH+ L  P K + P+     ++ ++ SPDE ALV+ AR LGY  +  +
Sbjct: 697 KKAKFFILSLALCHTCL--PKKSNFPEGGEDVIEYQSSSPDELALVTAARDLGYVVLNKN 754

Query: 865 KSGLIV-------EIQGVQKEFQVLNVLEFNSSRKRMSCIIKIPGSTPKDEP-KALLICK 916
              L +       E + + +++Q+LN ++FNS RKRMS ++K P     DEP K LLICK
Sbjct: 755 ADVLTIKTYPDGFENEPIFEDYQILNYIDFNSQRKRMSVLVKTP-----DEPNKVLLICK 809

Query: 917 GADSVIYSRL 926
           GAD++I  RL
Sbjct: 810 GADNMILERL 819

 Score = 62.8 bits (151), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 50/93 (53%)

Query: 227 AVYPRNKIRTTKYTPLTFFPKNILFQFHNFANIYFLILLILGAFQIFGVTNPGFASVPLI 286
           +VY  N I +++YT  +FFPK +  QF   AN+YF ++ IL     +  T      VPL 
Sbjct: 138 SVYCNNNITSSRYTIYSFFPKQLYAQFSKVANVYFFVVAILQMIPGWSTTGTYTTIVPLC 197

Query: 287 VIVIITAIKDGIEDSRRTVLDLEVNNTRTHILS 319
           + + I+  ++  +D RR  LD E NN    IL+
Sbjct: 198 IFMGISMAREAWDDFRRHRLDKEENNKTCSILT 230

>Scas_505.4
          Length = 1025

 Score =  207 bits (527), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 127/396 (32%), Positives = 202/396 (51%), Gaps = 24/396 (6%)

Query: 1100 AKREHGLPQ---GNFAVIIDGDALKVALNGEEMRRKFLLLCKNCKAVLCCRVSPXXXXXX 1156
            A +EH L Q      A++IDG +L  AL  + +    L L K CKAV+CCRVSP      
Sbjct: 544  ALKEHKLSQHEMNTLALVIDGKSLSYALESD-LEDYLLALGKICKAVVCCRVSPLQKALV 602

Query: 1157 XXXXXXTLDVMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFRYVTRLV 1216
                      + LAIGDG+NDV+MIQ+A VGVGI+G EG QA   +D A+GQFR++ +L+
Sbjct: 603  VKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADIAVGQFRFLKKLL 662

Query: 1217 LVHGKWCYKRLAEMIPQFFYKNVIFTLSLFWYGIYNNFDGSYLFEYTYLTFYNLAFTSVP 1276
            LVHG W Y+R++  I   FYKN    ++ FW+   N F G  + E   +++YN+ FT  P
Sbjct: 663  LVHGSWSYQRISVAILYSFYKNTALYMTQFWFVFANAFSGQSIMESWTMSYYNVFFTVFP 722

Query: 1277 VILLAVLDQDVSDTVSMLVPQLYRVGILRKEWNQTKFLWYMLDGVYQSVICFFFPYLAYH 1336
              ++ V DQ VS  +    PQLY++G   K ++   F  ++++G Y S + +    L Y 
Sbjct: 723  PFVIGVFDQFVSSRLLERYPQLYKLGQQGKFFSVRIFWGWIVNGFYHSAVVYIGTMLFYR 782

Query: 1337 KNMVVTENGLGLDH-RYFVGVFVTAIAVTSCNFYVFMEQY-RWDWFC--GLFICLSLAVF 1392
              M +  +G   DH  + + V+ ++I +      +   Q+ ++  F   G FI   +  F
Sbjct: 783  YGMALNMHGEVADHWSWGIAVYTSSILIVLGKAALVTNQWTKFTLFAIPGSFI-FWMIFF 841

Query: 1393 YGWTGIWTXXXXXNEFYKGAARVFAQPAYWAVLFVGVLFCLLPRFTIDCIRKIFYPKDIE 1452
              +  ++       E++      +    +W  L V  +F L+  F     R+++ P+   
Sbjct: 842  PIYASVFPYANISREYFGVVKHTYGSGTFWLTLIVLPVFALMRDFVWKYYRRMYEPESYH 901

Query: 1453 IVREMWLRGDFDLYPQGYDPTDPSRPRI----NEIR 1484
            +V+EM          Q ++ +D +RP +    NEIR
Sbjct: 902  LVQEM----------QKFNISD-NRPHVQHFQNEIR 926

 Score =  152 bits (383), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 72/193 (37%), Positives = 120/193 (62%), Gaps = 6/193 (3%)

Query: 438 FAKDYWKNVKVGDIVRVHNNDEIPADMILLSTSDVDGACYVETKNLDGETNLKVRQSLKC 497
           F +  W +++ GD++RV + + IPAD+I++S+S+ +G CY+ET NLDGETNLK++Q+   
Sbjct: 333 FIERRWIDIRAGDVIRVKSEEAIPADLIVISSSEPEGLCYIETANLDGETNLKIKQARPE 392

Query: 498 SKIIKSSRDITRTKFWVESEGPHANLYSYQGNFKWQDTQNGNIRNEPVNINNLLLRGCTL 557
           +  +  SR +   K  V SE P+++LY+Y+G  ++      N R  P++   ++LRG TL
Sbjct: 393 TAEMMDSRKLNNFKGKVISEQPNSSLYTYEGTLEF------NNRKIPLSPEQMILRGATL 446

Query: 558 RNTKWAMGMVIFTGDDTKIMINAGVTPTKKSRISRELNFSVILNFVLLFILCFTAGIVNG 617
           RNT W  G+VIFTG +TK+M NA  TP K++ + R +N  ++  F +L +L   + + N 
Sbjct: 447 RNTSWMFGLVIFTGHETKLMRNATATPIKRTAVERVINLQIVALFGVLIVLVLISSLGNA 506

Query: 618 VYYKQKPRSRDYF 630
           +    + +   Y 
Sbjct: 507 IISSTQEKHLSYL 519

 Score = 60.5 bits (145), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 50/91 (54%)

Query: 229 YPRNKIRTTKYTPLTFFPKNILFQFHNFANIYFLILLILGAFQIFGVTNPGFASVPLIVI 288
           Y  N I TTKY   TF PK +  +F  +AN++FL    +        TN       L+V+
Sbjct: 237 YGDNHISTTKYNIATFLPKFLFQEFSKYANLFFLCTAAIQQVPHVSPTNRYTTVGTLMVV 296

Query: 289 VIITAIKDGIEDSRRTVLDLEVNNTRTHILS 319
           +I++A K+ IED +R   D E+NN++T I S
Sbjct: 297 LIVSAFKESIEDIKRANSDKELNNSKTEIYS 327

>Scas_89.1
          Length = 271

 Score =  139 bits (351), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 95/290 (32%), Positives = 151/290 (52%), Gaps = 34/290 (11%)

Query: 966  YERWVKTYDVAAASVTNREEELDKVTDV-IERELILLGGTAIEDRLQDGVPDSIALLAEA 1024
            Y+++ K Y  A+ S+ N +E +  V    +E  L LLG T +ED+LQ+ V  SI LL  A
Sbjct: 2    YDKFEKEYHDASLSMLNXDETMSSVIKKHLEHNLELLGLTGVEDKLQNDVKSSIELLRNA 61

Query: 1025 GIKLWVLTGDKVETAINIGFSCNVLNNDMELLVVKASGEDVEEFGSDPIQVVNNLVTKYL 1084
            G+K+W+LTGDKVETA  +  S  +++           G+ V            + VTK  
Sbjct: 62   GVKIWMLTGDKVETARCVSISAKLISR----------GQYV------------HTVTKLS 99

Query: 1085 REKFGMSGSEEELKEAKREHGLPQGNFAVIIDGDALKVALNGEEMRRKFLLLCKNCKAVL 1144
            R + G   + E LK  K           ++IDG++L + L     +++F  +  +  AV+
Sbjct: 100  RPE-GALNALEYLKINKSS--------CLLIDGESLGMFLT--YYKQEFFDIVVDLPAVI 148

Query: 1145 CCRVSPXXXXXXXXXXXXTLDVMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDY 1204
             CR +P                    IGDG NDV+MIQ ADVGVGI G+EG+QA + +D+
Sbjct: 149  ACRCTPQQKADVALLIREITGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADF 208

Query: 1205 AIGQFRYVTRLVLVHGKWCYKRLAEMIPQFFYKNVIFTLSLFWYGIYNNF 1254
            ++ QF ++T+L+L HG+  YKR A++     ++ +I ++    Y + +  
Sbjct: 209  SVTQFCHLTKLLLWHGRNSYKRSAKLAQFVIHRGLIISVCQAVYSVCSKL 258

>Scas_665.30
          Length = 1439

 Score = 65.9 bits (159), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 83/326 (25%), Positives = 132/326 (40%), Gaps = 55/326 (16%)

Query: 881  VLNVLEFNSSRKRMSCIIKIPGSTPKDEPKALLICKGADSVIYSRLDRTQNDATLLEKTA 940
            ++   EF S  +RMS I+K     P +E       KGA  VI     +  N ATL     
Sbjct: 704  IIRSFEFLSELRRMSVIVK-----PSNEDVYWAFTKGAPEVI----TQICNKATLPANFE 754

Query: 941  LHLEEYATEGLRTLCLAQRELTWSEYERWVKTYDVAAASVTNREEELDKVTDVIERELIL 1000
              L  Y  +G R +  A R L       W+ +  V+      REE        +E  +  
Sbjct: 755  EMLNYYTHKGYRVIACAGRVL---PRNTWLYSQKVS------REE--------VESNMEF 797

Query: 1001 LGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCNVLNNDMELLVVKA 1060
            LG    E++L+     ++  L EA I+  + TGD V TAI++G  CN++ +     V   
Sbjct: 798  LGFIIFENKLKKETAKTLQTLQEASIRTVMCTGDNVLTAISVGRQCNLIKSKK---VYVP 854

Query: 1061 SGEDVEEFGSDPI--QVVNNL-VTKYLREKFGMSGSEEELKEAKREHGLPQGNFAVIIDG 1117
            S E+++  G   I  + V+N+  T   R    ++ S                ++ + I G
Sbjct: 855  SLEEIDSTGQTSIIWRDVDNMDDTLDSRTLLPINNSSST-------------SYTLAITG 901

Query: 1118 DALKVALNGE-----EMRRKFLLLCKNCKAVLCCRVSPXXXXXXXXXXXXTLDVMTLAIG 1172
            D  ++    E     E     +LL    K  +  R+SP             L+      G
Sbjct: 902  DIFRIIFGDENNSISEDYINTVLL----KGTIYARMSPDEKHELMEQLQR-LNYTVGFCG 956

Query: 1173 DGSNDVAMIQSADVGVGIAGEEGRQA 1198
            DG+ND   +++ADVG+ ++  E   A
Sbjct: 957  DGANDCGALKAADVGISLSEAEASVA 982

>CAGL0M11308g 1110211..1114569 similar to sp|Q12697 Saccharomyces
            cerevisiae YOR291w, hypothetical start
          Length = 1452

 Score = 63.5 bits (153), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 75/324 (23%), Positives = 127/324 (39%), Gaps = 53/324 (16%)

Query: 881  VLNVLEFNSSRKRMSCIIKIPGSTPKDEPKALLICKGADSVIYSRLDRTQNDATLLEKTA 940
            ++   EF S  +RMS I+K     P +E       KGA  VI        N ATL     
Sbjct: 916  IIRSFEFLSELRRMSVIVK-----PNNENVYWAYTKGAPEVIID----ICNPATLPSDYD 966

Query: 941  LHLEEYATEGLRTLCLAQRELTWSEYERWVKTYDVAAASVTNREEELDKVTDVIERELIL 1000
              L  Y   G R +  A + L       W+ +  V       R EE       +E  +  
Sbjct: 967  DILNFYTHSGYRVIACAGKTL---PKNTWLYSQKV-------RREE-------VESNMEF 1009

Query: 1001 LGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCNVLNNDMELLVVKA 1060
            LG    +++L+D    +++ L  A I+  + TGD V TAI++G  C ++  D   +   A
Sbjct: 1010 LGFIIFQNKLKDATSPTLSKLKTANIRTVMCTGDNVLTAISVGKECQLITEDRVYVPTVA 1069

Query: 1061 SGEDVEEFGSDPIQVVNNLV-TKYLREKFGMSGSEEELKEAKREHGLPQGNFAVIIDGDA 1119
                  +    P+   N +   +++ + F +   ++             G + + I G+ 
Sbjct: 1070 ----YSDMTVQPVIHWNEISNAEHILDTFTLQPIDDY-----------SGPYTLAITGEV 1114

Query: 1120 LKVALN-----GEEMRRKFLLLCKNCKAVLCCRVSPXXXXXXXXXXXXTLDVMTLAIGDG 1174
             ++  +      EE   + LL     K  +  R+SP             +D      GDG
Sbjct: 1115 FRIIFSNQDNYSEEYVNEILL-----KGSIFARMSPDEKHELVEQLQK-MDYTVGFCGDG 1168

Query: 1175 SNDVAMIQSADVGVGIAGEEGRQA 1198
            +ND   +++ADVG+ ++  E   A
Sbjct: 1169 ANDCGALKAADVGISLSEAEASVA 1192

>Kwal_26.9207
          Length = 1469

 Score = 61.2 bits (147), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 77/326 (23%), Positives = 126/326 (38%), Gaps = 58/326 (17%)

Query: 881  VLNVLEFNSSRKRMSCIIKIPGSTPKDEPKALLICKGADSVIYSRLDRTQNDATLLEKTA 940
            V+   EF S  +RMS I+K     P  E       KGA  VI        N +TL     
Sbjct: 934  VIRSFEFVSELRRMSVIVK-----PYGENVFWGFTKGAPEVI----SEICNKSTLPANYE 984

Query: 941  LHLEEYATEGLRTLCLAQREL---TWSEYERWVKTYDVAAASVTNREEELDKVTDVIERE 997
              L++Y   G R +  A + L   TW   ++             +REE        +E  
Sbjct: 985  QILQQYTHNGYRVIACAGKTLPKRTWRFAQK------------VSREE--------VESN 1024

Query: 998  LILLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCNVLNNDMELLV 1057
            +  LG    E++L+     ++A L +AGI+  + TGD V TAI++G    ++      + 
Sbjct: 1025 MEFLGFVVFENKLKPSTTPTLASLQDAGIRSIMCTGDNVLTAISVGRESGLITESHVFVP 1084

Query: 1058 VKASGEDVEE-----FGSDPIQVVNNLVTKYLREKFGMSGSEEELKEAKREHGLPQGNFA 1112
                  D  E        D   ++ + VT        M+GS +               + 
Sbjct: 1085 QINDNMDPNEDLIIWRDVDDCDLILDGVTLE-----PMNGSSD---------------YT 1124

Query: 1113 VIIDGDALKVALNGEEMRRKFLLLCKNCKAVLCCRVSPXXXXXXXXXXXXTLDVMTLAIG 1172
            + + GD  ++     E+  +  +     K+ +  R+SP             LD +    G
Sbjct: 1125 IAVTGDVFRLLFKNNEVLPESYINMVLLKSSIYARMSPDEKHELVGQLQG-LDYVVGFCG 1183

Query: 1173 DGSNDVAMIQSADVGVGIAGEEGRQA 1198
            DG+ND   +++ADVGV ++  E   A
Sbjct: 1184 DGANDCGALKAADVGVSLSEAEASVA 1209

>KLLA0B08217g complement(724364..728683) similar to sp|Q12697
            Saccharomyces cerevisiae YOR291w, start by similarity
          Length = 1439

 Score = 60.1 bits (144), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 78/328 (23%), Positives = 128/328 (39%), Gaps = 61/328 (18%)

Query: 881  VLNVLEFNSSRKRMSCIIKIPGSTPKDEPKALLICKGADSVIYSRLDRTQNDATLLEKTA 940
            V+   EF S  +RMS I+K        E       KGA  VI        N AT+ +   
Sbjct: 903  VIRSFEFLSELRRMSVIVK-----GFKENTYWSFTKGAPEVIAD----ICNPATIPKDFH 953

Query: 941  LHLEEYATEGLRTLCLAQRELTWSEYERWVKTYDVAAASVTNREEELDKVTDVIERELIL 1000
              L  Y   G R +  A + L  S    W+ +  V+      REE        +E  L  
Sbjct: 954  ELLHHYTHNGFRIIACAGKTLPKSS---WLYSQKVS------REE--------VEDNLEF 996

Query: 1001 LGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCNV----------LN 1050
            LG    E++L+     ++  L  A I+  + TGD V TA+++G    +          LN
Sbjct: 997  LGFIVFENKLKSRTKAALKELQNANIRTVMCTGDNVLTAVSVGRDSGLISSERVFIPFLN 1056

Query: 1051 NDMELLVVKASGEDVEEFGSDPIQVVNNLVTKYLREKFGMSGSEEELKEAKREHGLPQGN 1110
            +++E      S  DV+E GS    V++ +  K L +                    P+ +
Sbjct: 1057 DNLEESRHLLSWRDVDEEGS----VLDAVTLKPLND--------------------PEKS 1092

Query: 1111 FAVIIDGDALKVALNGEEMRRKFLLLCKNCKAVLCCRVSPXXXXXXXXXXXXTLDVMTLA 1170
            + + I GD  ++    +E+     +     K  +  R+SP             LD     
Sbjct: 1093 YTLAITGDIFRILFRNDEILPDDYISTVLMKGSIYARMSPDEKHELVEQLQK-LDYNVGF 1151

Query: 1171 IGDGSNDVAMIQSADVGVGIAGEEGRQA 1198
             GDG+ND   +++A++G+ ++  E   A
Sbjct: 1152 CGDGANDCGALKAANIGISLSEAEASVA 1179

>Kwal_47.17547
          Length = 1240

 Score = 57.4 bits (137), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 140/641 (21%), Positives = 252/641 (39%), Gaps = 107/641 (16%)

Query: 445  NVKVGDIVRVHNNDEIPADMILLSTSDVDGACYVETKNLDGETNLKVRQSLKCSKIIKSS 504
            ++ VGDI+ +   D +PAD IL     V G+C  +   L GE+          + I K++
Sbjct: 203  DILVGDILSLQTGDVVPADCIL-----VKGSCECDESALTGES----------ATIKKAA 247

Query: 505  RDITRTKFWVESEGPHANLYSYQGNFKWQDTQNGNIRNEPVNINNLLLRGCTLRNTKWAM 564
             D+   K+   S    A      G  K  D         P+ I+   L     R    ++
Sbjct: 248  IDVCYEKYKQLSATDAAIDIGTPGAEKVPD---------PMLISGSKLLSGLGRAVVTSV 298

Query: 565  GMVIFTGDD-TKIMINAGVTPTKKSRISRELNFSVI--LNFVLLFILCFTAGIVN----G 617
            G+    G     + + A  TP ++   S   + SV      +LLF + F   + N    G
Sbjct: 299  GVNSMHGRTLMALKVEAETTPLQERLDSLANSISVYGSAAALLLFFILFMRFLANLKKGG 358

Query: 618  VYYKQKPRSRDYFEFGTIGGSASTNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAIFI 677
              +   P  +         GS   N F+   V + +    VP  L ++V +     A+  
Sbjct: 359  ELHDLTPAQK---------GSRFMNIFI---VGITVIVVAVPEGLPLAVTL-----ALAF 401

Query: 678  YTDVLLYNAKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRA 737
             T  +  +  L      +     + +G    + SDKTGTLT+N M   K  +    +  A
Sbjct: 402  ATTRMAKDGNL-----VRVLRACETMGSATAVCSDKTGTLTENRMTVVKGFLGSTFFDEA 456

Query: 738  YTEALAGLRKRQGVDVESEGRREKEEIAKDRETMIDELRSMSDNTQFCPEDLTFVSKEIV 797
              E++        VD+ +      EE+ KD  T I  L S +           F +KE  
Sbjct: 457  --ESVGPSDSETDVDL-AIANECSEELKKDVLTNI-TLNSTA-----------FENKENE 501

Query: 798  EDLKGSSGDHQQKCCEHFLLAL-------ALCHSVLVEPNKDDPKKLDIKAQSPDESALV 850
            ED   +     +     F  +        A    ++     D PK+  + +++  E+AL+
Sbjct: 502  EDKVSNENPFHKPRKSLFPWSRNNKSKKPATAKELVENAAADQPKEPFLGSKT--ETALL 559

Query: 851  STARQ-LGYSFVGSSKSGLIVEIQGVQKEFQVLNVLEFNSSRKRMSCIIKIPGSTPKDEP 909
            + A++ LG   +   +     +  G++K   ++ ++ F SSRK    ++K      +   
Sbjct: 560  AFAQKNLGMQNLHHYRDE--PDCLGIEK---IVQIIPFESSRKWGGIVVKYKNGLHR--- 611

Query: 910  KALLICKGADSVIYSR-LDRTQNDATL-------LEKTALHLEEYATEGLRTLCLAQREL 961
                  KGA  ++  R + +  +D+ L        ++ +  +   A E LR + LA R+ 
Sbjct: 612  ---FYIKGAAELLLRRCMQKRASDSKLTLISQKDFDEESQTITNLAAEALRAISLAHRDY 668

Query: 962  ----TW------SEYERWVKTYDVAAASVTNREEELDKVTDVIERELILLGGTAIEDRLQ 1011
                 W       E E    + D+      +R + + +    +   ++L G   I+D L+
Sbjct: 669  PNCPNWPPSELQDEVEPEAASPDLLFGDEVSRSDSVSEPAQELVSPMVLDGIVGIQDPLR 728

Query: 1012 DGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCNVLNND 1052
             GV  S+    +AG+ + ++TGD + TA  I   C++L+ +
Sbjct: 729  KGVRKSVEQCQKAGVTVRMVTGDNILTATAIAKKCSILSEE 769

>YOR291W (YOR291W) [5075] chr15 (861172..865590) Member of the
            cation-translocating P-type ATPase superfamily of
            membrane transporters [4419 bp, 1472 aa]
          Length = 1472

 Score = 57.0 bits (136), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 84/329 (25%), Positives = 133/329 (40%), Gaps = 55/329 (16%)

Query: 881  VLNVLEFNSSRKRMSCIIKIPGSTPKDEPKALLICKGADSVIYSRLDRTQNDATLLEKTA 940
            V+   EF S  +RMS I+K       ++       KGA  VI        N +TL     
Sbjct: 928  VVRSFEFLSELRRMSVIVKT-----NNDDVYWSFTKGAPEVI----SEICNKSTLPADFE 978

Query: 941  LHLEEYATEGLRTLCLAQRELTWSEYERWVKTYDVAAASVTNREEELDKVTDVIERELIL 1000
              L  Y   G R +  A + L       W+ +  V+      REE        +E  L  
Sbjct: 979  EVLRCYTHNGYRVIACAGKTLP---KRTWLYSQKVS------REE--------VESNLEF 1021

Query: 1001 LGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCNVLNNDMELLVVKA 1060
            LG    +++L+    +++  L +A I+  + TGD + TAI++G    ++       V   
Sbjct: 1022 LGFIIFQNKLKKETSETLKSLQDANIRTIMCTGDNILTAISVGREAGLIQCSR---VYVP 1078

Query: 1061 SGEDVEEFGSDPIQV---VNN----LVTKYLREKFGMSGSEEELKEAKREHGLPQGNFAV 1113
            S  D    G +P+ V   VN     L TK L+     + S E L+E          N+ +
Sbjct: 1079 SINDTPLHG-EPVIVWRDVNEPDKILDTKTLKPVKLGNNSVESLREC---------NYTL 1128

Query: 1114 IIDGDALKVALNGE-EMRRKFL---LLCKNCKAVLCCRVSPXXXXXXXXXXXXTLDVMTL 1169
             + GD  ++    E E+  ++L   LL  +  A    R+SP             LD    
Sbjct: 1129 AVSGDVFRLLFRDENEIPEEYLNEILLNSSIYA----RMSPDEKHELMIQLQK-LDYTVG 1183

Query: 1170 AIGDGSNDVAMIQSADVGVGIAGEEGRQA 1198
              GDG+ND   +++ADVG+ ++  E   A
Sbjct: 1184 FCGDGANDCGALKAADVGISLSEAEASVA 1212

>AFL011W [3182] [Homologous to ScYGL006W (PMC1) - SH]
            complement(415265..418993) [3729 bp, 1242 aa]
          Length = 1242

 Score = 55.1 bits (131), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 138/642 (21%), Positives = 253/642 (39%), Gaps = 127/642 (19%)

Query: 448  VGDIVRVHNNDEIPADMILLSTSDVDGACYVETKNLDGETNLKVRQSLKCSKIIKSSRDI 507
            VGD++ +   D +P D IL     V+G C  +   + GE++   + SL  S        +
Sbjct: 203  VGDLLSLQTGDVVPVDCIL-----VEGKCECDESGITGESDTIKKVSLAMS------LQV 251

Query: 508  TRTKFWVESEGPHANLYSYQGNFKWQDTQNGN-IRNEPVNINNLLLRGCTLRNTKWAMGM 566
             RT   V ++ P A++ S         + NG+ +  +P+ I+   L          A+G 
Sbjct: 252  YRT---VAADNPSADIGS---------SDNGHSLVPDPMLISGSKLLSGIGHAVVTAVGP 299

Query: 567  VIFTGDDTKIMINAGVTP----------TKKSRISRELNFSVILNFVLLFILCFTAGIVN 616
                G   K+M+     P          T    IS   + +  L FV+LF L F + +  
Sbjct: 300  HSVHG---KMMLALKSEPETTPLQERLNTLADDISIYGSVAAFLLFVVLF-LRFLSYLPK 355

Query: 617  GVYYKQKPRSRDYFEFGTIGGSASTNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAIF 676
            G  Y   P +R    F  I           F  AV +    VP  L ++V +     A+ 
Sbjct: 356  GRLYHDLPSARKGSRFMDI-----------FITAVTVIVVAVPEGLPLAVTL-----ALA 399

Query: 677  IYTDVLLYNAKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGR 736
              T  +  +  L      +     + +G    + SDKTGTLTQN M   K  +     G 
Sbjct: 400  FATTRMTKDGNL-----VRVLRACETMGSATTVCSDKTGTLTQNKMVVVKGFL-----GS 449

Query: 737  AYTEALAGLRKRQGVDVESEGRREKEEIAKD--RETMIDELRSMSDNTQFCPEDLTFVSK 794
            ++ + ++          E     + + + +D  + T+ D L +++ N+        F +K
Sbjct: 450  SHFDDIS----------EDSNCAQSDALRQDMSQHTLNDILANIALNST------AFENK 493

Query: 795  EIVEDLKGSSGDHQQKCCEHFLLALALCHSVLVEPNKDDPKKLDIKAQSPDESALVSTAR 854
            ++ + +   +  H+ +               L   ++++  K      S  +SA      
Sbjct: 494  QVADPVITENPYHKPR-------------RSLFPWSRNNKPKYPAPKDSSVQSAEFFIGS 540

Query: 855  QLGYSFVGSSKSGLIVE-IQGVQKE------FQVLNVLEFNSSRKRMSCIIKIPGSTPKD 907
            +   + +  +K  L +E +Q ++ +        ++ ++ F SSRK    ++++     + 
Sbjct: 541  KTEAALLSLAKGSLGLESLQALRDDPHHIGIASIVQMIPFESSRKWAGLVVRLVDGNYR- 599

Query: 908  EPKALLICKGADSVIYSRLD--RTQNDATLLEKTALHLEEY------ATEGLRTLCLAQR 959
                    KGA   I+      R+ ND  +      H E +      A++ LRT+ LA +
Sbjct: 600  -----FFIKGASETIFKSCHYMRSSNDDVIKLSPQKHGEIFGLINNLASDALRTISLAHK 654

Query: 960  ELT----WSEYE-RWVKTYDVAAASVTNREEELDKVTD---VIERE---LILLGGTAIED 1008
            + T    W   E R       A+  +   +E +   TD   +I      LIL G   I D
Sbjct: 655  DFTDISSWPPAELRDASDPSTASPDLLLGDEYVPTATDRPSIITNNNSGLILDGVVGIHD 714

Query: 1009 RLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCNVLN 1050
             L+ GV +S+    ++G+ + ++TGD + T   I  +C +L+
Sbjct: 715  PLRPGVKESVKNCQQSGVTVRMITGDNITTGRAIARACGILS 756

>AFR567W [3759] [Homologous to ScYOR291W - SH]
            complement(1455295..1459644) [4350 bp, 1449 aa]
          Length = 1449

 Score = 55.1 bits (131), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 73/322 (22%), Positives = 133/322 (41%), Gaps = 48/322 (14%)

Query: 881  VLNVLEFNSSRKRMSCIIKIPGSTPKDEPKALLICKGADSVIYSRLDRTQNDATLLEKTA 940
            ++   EF S+ +RMS I+K     P  E   +   KGA  VI+   +        L+  A
Sbjct: 912  IVRSFEFLSNLRRMSVIVK-----PFSENVFMSFTKGAPEVIF---ELCSKQTLPLDYEA 963

Query: 941  LHLEEYATEGLRTLCLAQRELTWSEYERWVKTYDVAAASVTNREEELDKVTDVIERELIL 1000
            L L  Y   G R +  A ++LT    + W+ +  V+      REE        IE  L  
Sbjct: 964  L-LHHYTHNGYRVIACAGKKLT---RQSWLYSQKVS------REE--------IESNLEF 1005

Query: 1001 LGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCNVLNNDMELLVVKA 1060
            LG    E++L+    +++  L  A I+  + TGD V TAI++G    ++ +    + V  
Sbjct: 1006 LGFIIFENKLKGTTKETLESLHRADIRTIMCTGDNVLTAISVGREAGLVESPRVFVSVIN 1065

Query: 1061 SGEDVEEFGSDPIQVVNN----LVTKYLREKFGMSGSEEELKEAKREHGLPQGNFAVIID 1116
              +  +E      Q V N    L +  LR    +SG  ++              + + + 
Sbjct: 1066 DIDTSQEGDIITWQNVANSSDTLDSVTLRP---LSGDTDD--------------YTLAVT 1108

Query: 1117 GDALKVALNGEEMRRKFLLLCKNCKAVLCCRVSPXXXXXXXXXXXXTLDVMTLAIGDGSN 1176
            G+  ++    ++ + + ++     K  +  R+SP            ++       GDG+N
Sbjct: 1109 GEVFRLLFKTDKSQIEEVINNILLKTSIYARMSP-DEKHELVERLQSIGYQVGFCGDGAN 1167

Query: 1177 DVAMIQSADVGVGIAGEEGRQA 1198
            D   +++AD+G+ ++  E   A
Sbjct: 1168 DCGALKAADIGISLSEAEASVA 1189

>CAGL0I04312g complement(382354..385209) highly similar to sp|P13586
            Saccharomyces cerevisiae YGL167c PMR1 Ca2+-transporting
            P-type ATPase, start by similarity
          Length = 951

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 61/223 (27%), Positives = 95/223 (42%), Gaps = 38/223 (17%)

Query: 871  EIQGVQKEFQVLNVLEFNSSRKRMSCIIKIPGSTPKDEPKALLICKGADSVIYSRLDRTQ 930
            E+  V+ E+  +  L FNS RK M+  I+       +E K  L  KGA   I  +     
Sbjct: 464  ELADVRSEYTKVKELSFNSKRKMMATKIQ------DNEKKTTLFIKGAFERILDKSSSYL 517

Query: 931  NDATLLEK-TALHLEE-------YATEGLRTLCLAQRELTWSEYERWVKTYDVAAASVTN 982
             +   +EK TA H E         A+EGLR L  A+R +T S   + V+           
Sbjct: 518  TEKGKIEKLTAGHRETIIDCANTLASEGLRVLAFAKRAMTDSS-SKLVE----------- 565

Query: 983  REEELDKVTDVIERELILLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINI 1042
                 D ++D     L+  G   + D  +  V  +I    + GI + ++TGD   TA+NI
Sbjct: 566  -----DDISD-----LVFTGLIGMNDPPRSSVKFAIDQFLQGGIHIIMITGDSENTAVNI 615

Query: 1043 GFSCNVLNNDMELLVVKASGEDVEEFGSDPIQVVNNLVTKYLR 1085
                 +   D +L V+  SG+ + E   D +  V + V  + R
Sbjct: 616  ARQIGIPVIDPKLSVL--SGDKLNEMTDDQLANVIDHVNIFAR 656

>YGL006W (PMC1) [1966] chr7 (485923..489444) Vacuolar
            Ca2+-transporting P-type ATPase, member of the cation
            transporting (E1-E2) P-type ATPase superfamily, functions
            to pump Ca2+ into the vacuole [3522 bp, 1173 aa]
          Length = 1173

 Score = 50.8 bits (120), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 44/185 (23%), Positives = 85/185 (45%), Gaps = 20/185 (10%)

Query: 880  QVLNVLEFNSSRKRMSCIIKIPGSTPKDEPKALLICKGADSVIYSRLDRTQNDATLLEK- 938
            +V+  + F SSRK    ++K      K +P      KGA  ++       +N    LE+ 
Sbjct: 608  KVVQTIPFESSRKWAGLVVKYKEGKNK-KPFYRFFIKGAAEIVSKNCSYKRNSDDTLEEI 666

Query: 939  -------TALHLEEYATEGLRTLCLAQRELTWSEYERWVKTYDVAAASVTNREEELDKVT 991
                   T   ++  A++ LR + +A ++  + E + W          + +++       
Sbjct: 667  NEDNKKETDDEIKNLASDALRAISVAHKD--FCECDSW------PPEQLRDKDSPNIAAL 718

Query: 992  DVI---ERELILLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCNV 1048
            D++   ++ LIL G   I+D L+ GV +S+     AG+ + ++TGD + TA  I  +C +
Sbjct: 719  DLLFNSQKGLILDGLLGIQDPLRAGVRESVQQCQRAGVTVRMVTGDNILTAKAIARNCAI 778

Query: 1049 LNNDM 1053
            L+ D+
Sbjct: 779  LSTDI 783

 Score = 38.1 bits (87), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 61/302 (20%), Positives = 125/302 (41%), Gaps = 79/302 (26%)

Query: 445 NVKVGDIVRVHNNDEIPADMILLSTSDVDGACYVETKNLDGETNLKVRQSLKCSKIIKSS 504
           +V VGD++ +   D +PAD +++S     G C  +  ++ GE+N                
Sbjct: 209 HVLVGDVISLQTGDVVPADCVMIS-----GKCEADESSITGESN---------------- 247

Query: 505 RDITRTKFWVESEGPHANLYSYQGNFKWQDTQNGNIRNEPVNINNLLLRGCTLRNTKWAM 564
              T  KF V++     +L  ++  F   D+ N    ++P++I ++   G  + +     
Sbjct: 248 ---TIQKFPVDN-----SLRDFK-KFNSIDSHN---HSKPLDIGDVNEDGNKIADCMLIS 295

Query: 565 GMVIFTGDDTKIMINAGV-----------------TPTK--KSRISRELNFSVILNFVLL 605
           G  I +G    ++ + G+                 TP +   S+++  ++    ++ ++L
Sbjct: 296 GSRILSGLGRGVITSVGINSVYGQTMTSLNAEPESTPLQLHLSQLADNISVYGCVSAIIL 355

Query: 606 FILCFTAGIV-----NGVYYKQKPRSRDYFEFGTIGGSASTNGFVSFWVAVILYQSLVPI 660
           F++ FT  +      +G ++   P  +         GS   N F++    +++    VP 
Sbjct: 356 FLVLFTRYLFYIIPEDGRFHDLDPAQK---------GSKFMNIFITSITVIVVA---VPE 403

Query: 661 SLYISVEIIKTAQAIFIYTDVLLYNAKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQN 720
            L ++V +     A+   T  +  +  L      +     + +G    + SDKTGTLT+N
Sbjct: 404 GLPLAVTL-----ALAFATTRMTKDGNL-----VRVLRSCETMGSATAVCSDKTGTLTEN 453

Query: 721 VM 722
           VM
Sbjct: 454 VM 455

>KLLA0A08910g complement(779526..783368) similar to sp|P38929
            Saccharomyces cerevisiae YGL006w PMC1 Ca2+-transporting
            P-type ATPase, start by similarity
          Length = 1280

 Score = 48.9 bits (115), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 43/182 (23%), Positives = 82/182 (45%), Gaps = 15/182 (8%)

Query: 880  QVLNVLEFNSSRKRMSCIIKIPGSTPKDEPKALLICKGADSVIYSRLDRTQN-------- 931
            +V+ V+ F SSRK  +  +++      D        KGA  ++       +N        
Sbjct: 631  KVVQVIPFESSRKWGAIAVQL-----ADNKGYRFYAKGAAEILLKVCSNQRNSDNSIVPM 685

Query: 932  DATLLEKTALHLEEYATEGLRTLCLAQRELT-WSEYERWVKTYDVAAASVTNREEELDKV 990
            +  L +++   +++ A+  LRT+ L  R+   W   E    T    A+       ELD  
Sbjct: 686  NQDLYDESFKKIQDMASHALRTISLVHRDFKEWPPKEFADSTDPSIASPDLVMGHELDH- 744

Query: 991  TDVIERELILLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCNVLN 1050
             ++    + L     ++D L++GV +S+     AG+ + ++TGD + TA  I  +CN+L+
Sbjct: 745  KNLSSEGMTLDAMVGLQDPLREGVKESVEQCQRAGVTVRMVTGDNILTARAISRNCNILS 804

Query: 1051 ND 1052
             +
Sbjct: 805  EE 806

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 28/49 (57%), Gaps = 5/49 (10%)

Query: 448 VGDIVRVHNNDEIPADMILLSTSDVDGACYVETKNLDGETNLKVRQSLK 496
           VGD++ +   D +PAD +L+S     G+C  +   L GE++   + +LK
Sbjct: 259 VGDVISLQTGDVVPADAVLIS-----GSCECDESALTGESDTIKKVALK 302

>KLLA0E14630g complement(1297636..1300884) similar to sp|Q01896
            Saccharomyces cerevisiae YDR039c ENA2 P-type ATPase
            involved in Na+ efflux, hypothetical start
          Length = 1082

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 143/644 (22%), Positives = 240/644 (37%), Gaps = 140/644 (21%)

Query: 444  KNVKVGDIVRVHNNDEIPADMILLSTSDVDGACYVETKNLDGETNLKVRQSLKCSKIIKS 503
            K +  GDI  +   D +PAD+ L            E  NL+ +  L   +SL  +K    
Sbjct: 146  KELVPGDICIIRVGDTVPADLRLF-----------EAINLETDEALLTGESLPVAK---- 190

Query: 504  SRDITRTKFWVESEGPHANLYSYQGNFKWQDTQNGNIRNEPVNINNLLLRGCTLRNTKWA 563
                            H  +Y        QDT  G+  N       L     T+   + A
Sbjct: 191  ---------------SHGEVYE-------QDTPVGDRLN-------LAFAASTVTKGR-A 220

Query: 564  MGMVIFTGDDTKIMINAGVTPTKKSRISRELNFSVILNFVLLF---ILCFTAGIVNGVYY 620
             G+VI T  +T+I   A    ++ S ISR+ + S   N  +     I  F    V    +
Sbjct: 221  TGIVIKTALNTEIGKIAKSLKSEASLISRDKSKSFGRNLWITLRESIGTFLGTSVGTPLH 280

Query: 621  KQKPRSRDYFEFGTIGGSASTNGFVSFWV-------AVILYQSLVPISLYISVEIIKTAQ 673
            ++  +         +  +    G   F V       A+ +  S++P SL + + I  +A 
Sbjct: 281  RKLSQLAILLFVVAVIFAIVVMGTQKFKVNKQVAIYAICVALSMIPSSLVVVLTITMSAG 340

Query: 674  AIFIYTDVLLYNAKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKC------ 727
            A  + T  ++   KLD           + LG +  I SDKTGTLTQ  M  K+       
Sbjct: 341  AKVMATRHVIIR-KLDS---------LEALGAVNDICSDKTGTLTQGKMIAKQVWIPQFG 390

Query: 728  TINGVSYGRAYTEALAGLRKRQGVDVESEGRREKEEIAKDRETMIDELRSMSDNTQFCPE 787
            TIN  +    +   +  ++             ++E++      MI + +S     +  P 
Sbjct: 391  TINVQNSNEPFNPTIGEIQLIPKFSPYQYKHDDEEDVG-----MITDFKSKYYADELGPL 445

Query: 788  DLTFVSKEIVEDLKGSSGDHQQKCCEHFLLALALCHSVLVEPNKDDPKKLDIKAQS-PDE 846
            +++  ++ +                  +   LA   +V       DP+  D KA   P E
Sbjct: 446  NVSLFTQWL------------------YTATLANIATVF-----RDPETQDWKAHGDPTE 482

Query: 847  SALVSTARQLGYS---FVGSSKSGLIVEIQGVQKEFQVLNVLE--FNSSRKRMSCIIKIP 901
             A+   A ++        G        + + +  +    +V E  F+SS KRMS I K  
Sbjct: 483  IAIQVFATRMDLPRRVLTGEDND----DEKNIHNDITFEHVAEYPFDSSVKRMSAIYK-- 536

Query: 902  GSTPKDEPKALL---ICKGADSVI-------YSRLDRTQNDATL--LEKTALHLEEYATE 949
                 +EPKA +     KGA   +       Y+  D +    T   LE    +++  ++E
Sbjct: 537  ---NVEEPKAPIYEVFTKGAFERVLQCCNSWYTTPDGSPQPLTEEDLETVQKNVDTLSSE 593

Query: 950  GLRTLCLAQRELTWSEYERWVKTYDVAAASVTNREEELDKVTDVIERELILLGGTAIEDR 1009
            GLR L  A++    S++              T  +++L K  D +E  L  LG   I D 
Sbjct: 594  GLRVLAFAKKTFNESQF--------------TINKDKLLKERDFVENNLTFLGLVGIYDP 639

Query: 1010 LQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCNVLNNDM 1053
             +     ++     AGI + +LTGD   TA +I     +L +++
Sbjct: 640  PRRESLAAVKKCHLAGINVHMLTGDFPGTAKSIAQEVGILPHNL 683

>CAGL0A00517g 58830..62198 similar to sp|P38929 Saccharomyces
            cerevisiae YGL006w PMC1, hypothetical start
          Length = 1122

 Score = 45.1 bits (105), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 57/226 (25%), Positives = 104/226 (46%), Gaps = 29/226 (12%)

Query: 843  SPDESALVSTARQ-LGYSFVGSSKSGLIVEIQGVQKEF----QVLNVLEFNSSRKRMSCI 897
            S  E+AL+S AR+  G  F      G +   +G  ++      ++ ++ F SSRK  + +
Sbjct: 523  SKTETALLSLARKSFGLKF------GALQSFRGHPEKLPTVETIVQIIPFESSRKWSAIV 576

Query: 898  IKIPGSTPKDEPKALLICKGADSVIYSR--LDRTQND--ATLLEKTALHLEE----YATE 949
            +K+  +   +  K  L  KGA  ++     L    N+  + + +K+   +EE     A +
Sbjct: 577  VKLNSNKENEGKKFRLYVKGAAEIVAKACTLKNVCNEGISEIDQKSKDDIEEQIFSLAKD 636

Query: 950  GLRTLCLAQRELTWSEYERWVKTYDVAAASVTNREEELD-KVTDVIEREL---ILLGGTA 1005
             LR + LA  +   +E+           A   N  E L  K+ D  +  L    L     
Sbjct: 637  ALRAISLAHMDFDVNEWP------PKELADPENSHEALAVKLIDPKKPHLEGLTLDAIVG 690

Query: 1006 IEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCNVLNN 1051
            I+D L++ V +S+A   +AG+ + ++TGD + TA  I  +C +L++
Sbjct: 691  IQDPLRENVKNSVAQCQKAGVTVRMVTGDNLLTAKAIARNCGILSS 736

 Score = 37.4 bits (85), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 66/313 (21%), Positives = 110/313 (35%), Gaps = 79/313 (25%)

Query: 445 NVKVGDIVRVHNNDEIPADMILLSTSDVDGACYVETKNLDGETNLKVRQSLKCSKIIKSS 504
           N+ VGD++++   D +PAD +L     V G C  +   L GE+N                
Sbjct: 174 NLLVGDLLKLQTGDVVPADCVL-----VRGECETDESALTGESN---------------- 212

Query: 505 RDITRTKFWVESEGPHANLYSYQGNFKWQDTQNGNIRNEPVNINNLLLRGCTLRNTKWAM 564
              T  K       P A+   Y      +D  + +        ++     C L +     
Sbjct: 213 ---TIKKL------PLADALEYHSAHGGRDIGDTSASGASGAADDSRCPDCMLIS----- 258

Query: 565 GMVIFTGDDTKIMINAGV-----------------TPTKKSRISRELNFSV------ILN 601
           G  + +G  + I+ N GV                 TP +        N SV      I  
Sbjct: 259 GSRVLSGLASAIVTNVGVNSVHGKTMASLKEDSEDTPLQMRLSQLTDNISVYGCVAAITL 318

Query: 602 FVLLFILCFTAGIVNGVYYKQKPRSRDYFEFGTIGGSASTNGFVSFWVAVILYQSLVPIS 661
           FV+LF    +  + +G  Y   P +    +F  I           F  A+ +    VP  
Sbjct: 319 FVVLFARYLSYILPSGGKYHDLPPAEKGSKFMDI-----------FITAITVIVVAVPEG 367

Query: 662 LYISVEIIKTAQAIFIYTDVLLYNAKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNV 721
           L ++V +     A+   T  +  +  L      +     + +G    + SDKTGTLT+N+
Sbjct: 368 LPLAVTL-----ALAFATTRMTKDGNL-----VRVLRSCETMGSATAVCSDKTGTLTENI 417

Query: 722 MEFKKCTINGVSY 734
           M   + T+    +
Sbjct: 418 MTVVRGTLGRAGF 430

>AEL301W [2204] [Homologous to ScYGL167C (PMR1) - SH]
            complement(75104..77977) [2874 bp, 957 aa]
          Length = 957

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 53/211 (25%), Positives = 91/211 (43%), Gaps = 41/211 (19%)

Query: 885  LEFNSSRKRMSCIIKIPGSTPKDEPKALLICKGADSVIYSRLDRTQNDATLLEKTALH-- 942
            L FNS RK M+  +K+   +P +  K ++  KGA   I  R       A  +EK +    
Sbjct: 483  LTFNSKRKYMA--VKV--DSPANSGKHIIYVKGAFERILERSASFIGGAGKVEKLSDSHK 538

Query: 943  ------LEEYATEGLRTLCLAQRELTWSEYERWVKTYDVAAASVTNREEELDKVTDVIER 996
                   +  A+EGLRTL  AQ E +                  TN+      + D   +
Sbjct: 539  SLINDCAKSLASEGLRTLAFAQLECS------------------TNK-----PMNDSTIQ 575

Query: 997  ELILLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIG--FSCNVLNNDME 1054
             L  +G   ++D  +  V  +I  L + G+ + ++TGD   TA+NI       V+N ++ 
Sbjct: 576  NLTFVGLIGMKDPPRSTVRPAIEELLQGGVHVIMITGDAENTAVNIARQIGIPVINPEIS 635

Query: 1055 LLVVKASGEDVEEFGSDPIQVVNNLVTKYLR 1085
            +L    +G+ +++   D +  V + V  + R
Sbjct: 636  VL----TGDRLDQMTDDQLAGVIDHVNIFAR 662

>CAGL0L01419g 156123..159767 highly similar to sp|P39986 Saccharomyces
            cerevisiae YEL031w SPF1 P-type ATPase, hypothetical start
          Length = 1214

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 78/324 (24%), Positives = 136/324 (41%), Gaps = 54/324 (16%)

Query: 878  EFQVLNVLEFNSSRKRMSCIIKIPGSTPKDEPKALLICKGADSVIYSRLDRTQNDATLLE 937
            +  +L   +F+S+ KR S +    G       K     KGA   I  RL     +   + 
Sbjct: 571  QVTILRRFQFSSALKRSSSVATHDG-------KLYSAVKGAPETIRERLFTIPANYDEIY 623

Query: 938  KTALHLEEYATEGLRTLCLAQRELTWSEYERWVKTYDVAAASVTNREEELDKVTDVIERE 997
            K+      +   G R L LA ++L     E+  ++          + E+ D+  +  ER+
Sbjct: 624  KS------FTRSGSRVLALASKKL-----EKMSQS----------QIEDADR--EHFERD 660

Query: 998  LILLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCNVLNNDMELLV 1057
            L   G       L+    ++I +L E+  +  ++TGD   TA+++     ++    E L+
Sbjct: 661  LEFNGFLIFHCPLKHDAIETIQMLNESAHRCVMITGDNPLTAVHVAKEVGIVKG--ETLI 718

Query: 1058 VKASGEDVEEFGSDPIQVVNNLVTKYLREKFGMSGSEEELKEAKREHGLPQGNFAVIIDG 1117
            V     D+ + G+D   V  N V + L  +F +S      K++  ++G+    + + + G
Sbjct: 719  V-----DMVDNGNDDKLVFRN-VEETLSFEFVVS------KDSFEKYGIFD-KYDLAVTG 765

Query: 1118 DALKVALNGEEMRRKFLLLCKNCKAVLCCRVSPXXXXXXXXXXXXTLDVMTLAIGDGSND 1177
             AL+ AL G    +  +       A +  RVSP             +   TL  GDG+ND
Sbjct: 766  HALE-ALKGHHQLQDLIR-----HAWIYARVSPAQKEFILNNLKD-MGYQTLMCGDGTND 818

Query: 1178 VAMIQSADVGVGI--AGEEGRQAV 1199
            V  ++ A VGV +    EEG + V
Sbjct: 819  VGALKQAHVGVALLNGTEEGLKKV 842

>KLLA0E22352g 1984522..1988142 highly similar to sp|P39986
            Saccharomyces cerevisiae YEL031w SPF1 P-type ATPase,
            start by similarity
          Length = 1206

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 71/312 (22%), Positives = 127/312 (40%), Gaps = 54/312 (17%)

Query: 880  QVLNVLEFNSSRKRMSCIIKIPGSTPKDEPKALLICKGADSVIYSRLDRTQNDATLLEKT 939
            ++L   +F+SS KR + I            +     KGA   I  RL+   +D   + K+
Sbjct: 573  RILRRFQFSSSLKRSASI-------ASQSNRFFAAVKGAPETIRERLNSVPSDYDDIYKS 625

Query: 940  ALHLEEYATEGLRTLCLAQRELTWSEYERWVKTYDVAAASVTNRE-EELDKVTDVIEREL 998
                  +   G R L LA ++L                  ++N + + +D+  D IE  L
Sbjct: 626  ------FTRSGSRVLALAYKDL----------------PKMSNSQIDNIDR--DEIETGL 661

Query: 999  ILLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCNVLNNDMELLVV 1058
                       L+D   ++I +L E+  +  ++TGD   TA+++     ++  D E L++
Sbjct: 662  TFGAFLVFHCPLKDDAIETIKMLNESSHRSIMITGDNPLTAVHVAKEVGIV--DRETLIL 719

Query: 1059 KASGEDVEEFGSDPIQVVNNLVTKYLREKFGMSGSEEELKEAKREHGLPQGNFAVIIDGD 1118
                E ++  GS    V+ + V + + + F       + KE  +++ L        + G 
Sbjct: 720  D---EPID--GSSHALVMRD-VNETIVKPFNPDADTFDEKEIFQKYDLA-------VTGH 766

Query: 1119 ALKVALNGEEMRRKFLLLCKNCKAVLCCRVSPXXXXXXXXXXXXTLDVMTLAIGDGSNDV 1178
            ALK+ L G +  R  +         +  RVSP             +   TL  GDG+NDV
Sbjct: 767  ALKL-LQGHKQLRDVIR-----HTWIYARVSPSQKEFILITLKD-MGYQTLMCGDGTNDV 819

Query: 1179 AMIQSADVGVGI 1190
              ++ A VG+ +
Sbjct: 820  GALKQAHVGIAL 831

>AFR354C [3546] [Homologous to ScYEL031W (SPF1) - SH]
            (1078275..1081907) [3633 bp, 1210 aa]
          Length = 1210

 Score = 40.4 bits (93), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 69/320 (21%), Positives = 124/320 (38%), Gaps = 54/320 (16%)

Query: 878  EFQVLNVLEFNSSRKRMSCIIKIPGSTPKDEPKALLICKGADSVIYSRLDRTQNDATLLE 937
            +  +L   +F+S+ KR S I        K    A+   KGA   I  RL +   D   + 
Sbjct: 574  DISILRRFQFSSALKRSSTI----AVHNKQHYSAV---KGAPETIRERLSQVPTDYDQVY 626

Query: 938  KTALHLEEYATEGLRTLCLAQRELTWSEYERWVKTYDVAAASVTNREEELDKVTDVIERE 997
            K+      +   G R L LA ++L                +    + E+L++  + +E +
Sbjct: 627  KS------FTRAGSRVLALASKKL---------------PSMSIKQIEKLER--EAVESD 663

Query: 998  LILLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCNVLNNDMELLV 1057
            L   G       L+D   ++I +L E+  +  ++TGD   TA+++     ++  +  +L 
Sbjct: 664  LEFKGFLVFHCPLKDDAIETIKMLNESSHRCIMITGDNPLTAVHVAKEVAIVERETLILD 723

Query: 1058 VKASGEDVEEFGSDPIQVVNNLVTKYLREKFGMSGSEEELKEAKREHGLPQGNFAVIIDG 1117
                G              + LV + + E      + E+      EH      + + + G
Sbjct: 724  EPIDGSS------------HALVFRNIEETIVNPFNPEK---DTFEHSKLFAKYDIAVTG 768

Query: 1118 DALKVALNGEEMRRKFLLLCKNCKAVLCCRVSPXXXXXXXXXXXXTLDVMTLAIGDGSND 1177
             AL++ L+G     + +         +  RVSP             +   TL  GDG+ND
Sbjct: 769  HALQL-LSGHSQLNELIR-----HTWVYARVSPAQKEFIMNSLK-DMGYQTLMCGDGTND 821

Query: 1178 VAMIQSADVGVGI--AGEEG 1195
            V  ++ A VG+ +    EEG
Sbjct: 822  VGALKQAHVGIALLNGTEEG 841

>KLLA0F20658g 1919851..1923099 similar to sp|Q12691 Saccharomyces
            cerevisiae YDR038c ENA5 P-type ATPase involved in Na+
            efflux, start by similarity
          Length = 1082

 Score = 40.4 bits (93), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 47/184 (25%), Positives = 77/184 (41%), Gaps = 25/184 (13%)

Query: 879  FQVLNVLEFNSSRKRMSCIIKIPGSTPKDEPKALLICKGADSVIYSRLDR--TQNDATL- 935
            F+ +    F+SS KRMS I K   +     P   +  KGA   +    D   T  D    
Sbjct: 516  FEHVAEFPFDSSVKRMSAIYK--NTEDPATPIYEVFTKGAFERVLQCCDSWYTTPDGKPS 573

Query: 936  ------LEKTALHLEEYATEGLRTLCLAQRELTWSEYERWVKTYDVAAASVTNREEELDK 989
                  LE    +++  ++EGLR L  A++    SE+                 +++L K
Sbjct: 574  PLSKEDLETIQKNVDTLSSEGLRVLAFAKKSFNESEFNA--------------NKDKLLK 619

Query: 990  VTDVIERELILLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCNVL 1049
              D +E +L  LG   I D  +     ++    +AGI + +LTGD   TA +I     +L
Sbjct: 620  ERDFVECKLTFLGLIGIYDPPRQESLAAVKKCHQAGINVHMLTGDFPGTAKSIAQEVGIL 679

Query: 1050 NNDM 1053
             +++
Sbjct: 680  PHNL 683

 Score = 31.6 bits (70), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 40/80 (50%), Gaps = 10/80 (12%)

Query: 650 AVILYQSLVPISLYISVEIIKTAQAIFIYTDVLLYNAKLDYPCTPKSWNISDDLGQIEYI 709
           A+ +  S++P SL + + I  +A A  + T  ++   KLD           + LG +  I
Sbjct: 317 AICVAISMIPSSLVVVLTITMSAGAKVMATRNVIVR-KLDS---------LEALGAVNDI 366

Query: 710 FSDKTGTLTQNVMEFKKCTI 729
            SDKTGTLTQ  M  K+  I
Sbjct: 367 CSDKTGTLTQGKMIAKQVWI 386

>KLLA0A03157g complement(281313..284129) gi|3288523|emb|CAA04476.1
            Kluyveromyces lactis Ca++ ATPase, start by similarity
          Length = 938

 Score = 40.0 bits (92), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 55/217 (25%), Positives = 94/217 (43%), Gaps = 46/217 (21%)

Query: 882  LNVLEFNSSRKRMSCIIKIPGSTPKDEPKALLICKGA------DSVIYSRLD-----RTQ 930
            +N + FNS RK M+        T     K ++  KGA       S+ Y   D        
Sbjct: 460  INEIPFNSKRKFMAV------KTIDANDKVVVYVKGAFEKIVEKSINYIGRDGKVHKLKP 513

Query: 931  NDATLLEKTALHLEEYATEGLRTLCLAQRELTWSEYERWVKTYDVAAASVTNREEELDKV 990
            ND  ++   A+ L   A+EGLRTL  A+ E+                 S T+ ++E ++ 
Sbjct: 514  NDKAIINDAAVAL---ASEGLRTLAFAELEV-----------------SATHGDKEFNE- 552

Query: 991  TDVIERELILLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIG--FSCNV 1048
             D++E  L   G  A+ D  +  V  +I  L +  + + ++TGD   TA++I       V
Sbjct: 553  -DMVEG-LTFTGLIAMNDPPRPTVRSAIEELLQGSVHVIMITGDAENTAVSIARQIGIPV 610

Query: 1049 LNNDMELLVVKASGEDVEEFGSDPIQVVNNLVTKYLR 1085
            +N +  +L    SG+ +++   D +  V + V  + R
Sbjct: 611  INPEYSVL----SGDKLDQMTDDQLASVIDHVNVFAR 643

 Score = 31.6 bits (70), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 25/48 (52%)

Query: 701 DDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKR 748
           + LG +  I SDKTGTLT N M   K    G    +    AL+ +++R
Sbjct: 355 ETLGSVNVICSDKTGTLTANHMTVSKIWCLGSMENKTNCLALSKVKER 402

>Kwal_23.3160
          Length = 1100

 Score = 39.7 bits (91), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 98/428 (22%), Positives = 164/428 (38%), Gaps = 74/428 (17%)

Query: 650  AVILYQSLVPISLYISVEIIKTAQAIFIYTDVLLYNAKLDYPCTPKSWNISDDLGQIEYI 709
            A+ +  S++P SL + + I  +  A  + T  ++   KLD           + LG +  +
Sbjct: 323  AICVAVSMIPSSLVVVLTITMSVGAKIMATRNVVVR-KLDS---------LEALGAVNDV 372

Query: 710  FSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQGVDVESEGRREKEEIAKDRE 769
             SDKTGTLTQ  M  K+  +   S+G       +         +E   R    +   D  
Sbjct: 373  CSDKTGTLTQGKMIVKQAWVP--SFGTITVSNSSNPFDPTDGGIELIPRFSPHQYKHDST 430

Query: 770  TMIDELRSMSDNTQFCPEDLTFVSKEIVEDLKGSSGDHQQKCCEHFLLALALCHSVLVEP 829
              +  + S  +          F + ++   L         K   ++L   AL +   V  
Sbjct: 431  EDVGIITSFKNK---------FYNDKLPAGL-------NSKLFLNWLKTAALANIAHV-- 472

Query: 830  NKDDPKKLDIKAQS-PDESALVSTARQLGY---SFVGSSKS--------GLIVEIQGVQK 877
               DP+  + KA   P E A+   A +L     +     KS         L  +   V+ 
Sbjct: 473  -YQDPETEEWKAHGDPTEIAIQVFAHKLDMPRNALTAEDKSDSESDEDAALGEKTSSVEP 531

Query: 878  EFQVLNVLEFNSSRKRMSCIIKIPGSTPKDEPKA-LLICKGADSVIYSRLDR------TQ 930
             ++ +    F+SS KRMS +         DE  A  +  KGA   +     +       +
Sbjct: 532  HYKHIAEFPFDSSIKRMSAVY-----VSLDEDNAHRVFTKGAFERVLDCCTKWLPDGCNE 586

Query: 931  NDATLL-----EKTALHLEEYATEGLRTLCLAQRELTWSEYERWVKTYDVAAASVTNREE 985
            +DA  +     E+   ++E  ++EGLR L  A +  T S+           A  V+   E
Sbjct: 587  SDAKPMTEEDKEEVFKNVETLSSEGLRVLAFATKSFTESQ-----------ALKVS---E 632

Query: 986  ELDKVTDVIERELILLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFS 1045
            +L K  D +E +LI  G   I D  +     ++    +AGI + +LTGD   TA  I   
Sbjct: 633  DLRKNRDFVESDLIFQGLVGIYDPPRQETAGAVKQFHKAGINVHMLTGDFPGTAKAIAQE 692

Query: 1046 CNVLNNDM 1053
              +L  ++
Sbjct: 693  VGILPRNL 700

>Scas_707.48*
          Length = 741

 Score = 38.9 bits (89), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 54/215 (25%), Positives = 91/215 (42%), Gaps = 22/215 (10%)

Query: 871  EIQGVQKEFQVLNVLEFNSSRKRMSCIIKIPGSTPKDEPKALLICKGADSVIYSRLDRTQ 930
            ++  ++  F+ +  + FNS RK M+  +KI  S    E K  L  KGA   + S+     
Sbjct: 456  DLSDIRPTFKKVQEIPFNSKRKFMA--VKIVNS----EGKYSLCVKGAFEKVLSQCSHYL 509

Query: 931  NDATLLEKTALHLEEYATEGLRTLCLAQRELTWSEYERWVKTYDVAAASVTNREEELDKV 990
            N     EK         T+G R + +       SE  R +      A + T   +    +
Sbjct: 510  NQKGKTEKL--------TQGQRDVIIETANSLASEGLRML------AFAKTTLPDSPTLL 555

Query: 991  TDVIERELILLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCNVLN 1050
            T+    +LI  G   + D  +  V  +I  L + G+ + ++TGD   TA+NI     +  
Sbjct: 556  TEESVGDLIFTGLIGMNDPPRPTVKPAIEQLLQGGVHIIMITGDSENTAVNIARQIGIPV 615

Query: 1051 NDMELLVVKASGEDVEEFGSDPIQVVNNLVTKYLR 1085
             D +L V+  SG+ + E   D +  V + V  + R
Sbjct: 616  LDPKLSVL--SGDKLNEMSDDQLANVIDHVNIFAR 648

>YDR039C (ENA2) [892] chr4 complement(531302..534577) Member of the
            Na[+]-transporting ATPases family in the superfamily of
            P-type ATPases [3276 bp, 1091 aa]
          Length = 1091

 Score = 38.5 bits (88), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 95/440 (21%), Positives = 168/440 (38%), Gaps = 98/440 (22%)

Query: 650  AVILYQSLVPISLYISVEI-IKTAQAIFIYTDVLLYNAKLDYPCTPKSWNISDDLGQIEY 708
            A+ +  S++P SL + + I +    A+ +  +V++   KLD           + LG +  
Sbjct: 317  AICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVR--KLDS---------LEALGAVND 365

Query: 709  IFSDKTGTLTQNVMEFKKCTINGVSYGR-AYTEALAGLRKRQGVDVESEGRREKEEIAKD 767
            I SDKTGTLTQ  M  ++  I    +G    + +       +G +V    R    E + +
Sbjct: 366  ICSDKTGTLTQGKMLARQIWIP--RFGTITISNSDDPFNPNEG-NVSLIPRFSPYEYSHN 422

Query: 768  RETMIDELRSMSDN--TQFCPEDLTF-----------------VSKEIVEDLKGSSGDHQ 808
             +  +  L++  D    +  PED+                   V K+   D   + GD  
Sbjct: 423  EDGDVGILQNFKDRLYEKDLPEDIDMDLFQKWLETATLANIATVFKDDATDCWKAHGDPT 482

Query: 809  QKCCEHFLLALALCHSVLVEPNKDDPKKLDIKAQSPDESALVSTARQLGYSFVGSSKSGL 868
            +   + F   + L H+ L        +K   ++   D+S+L     + G +         
Sbjct: 483  EIAIQVFATKMDLPHNALT------GEKSTNQSNENDQSSLSQHNEKPGSA--------- 527

Query: 869  IVEIQGVQKEFQVLNVLEFNSSRKRMSCII--------KIPGSTPKDEPKALLIC----K 916
                     +F+ +    F+S+ KRMS +          I G   K   ++++ C     
Sbjct: 528  ---------QFEHIAEFPFDSTVKRMSSVYYNNHNETYNIYG---KGAFESIISCCSSWY 575

Query: 917  GADSVIYSRLDRTQNDATLLEKTALHLEEYATEGLRTLCLAQRELTWSEYERWVKTYDVA 976
            G D V  + L  T  D   + K    L   + EGLR L  A +  T  +           
Sbjct: 576  GKDGVKITPL--TDCDVETIRKNVYSL---SNEGLRVLGFASKSFTKDQV---------- 620

Query: 977  AASVTNREEELDKVTD---VIERELILLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTG 1033
                   +++L  +T      E +L+ LG   I D  ++    ++    +AGI + +LTG
Sbjct: 621  ------NDDQLKNITSNRATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTG 674

Query: 1034 DKVETAINIGFSCNVLNNDM 1053
            D V TA  I     +L  ++
Sbjct: 675  DFVGTAKAIAQEVGILPTNL 694

 Score = 32.7 bits (73), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 28/56 (50%), Gaps = 11/56 (19%)

Query: 444 KNVKVGDIVRVHNNDEIPADMILLSTSDVDGACYVETKNLDGETNLKVRQSLKCSK 499
           K+V  GDI  V   D IPAD+ L           +ETKN D + +L   +SL  SK
Sbjct: 144 KDVVPGDICLVKVGDTIPADLRL-----------IETKNFDTDESLLTGESLPVSK 188

>YDR040C (ENA1) [893] chr4 complement(535187..538462) P-type ATPase
            involved in Na+ and Li+ efflux, required for Na+
            tolerance [3276 bp, 1091 aa]
          Length = 1091

 Score = 38.1 bits (87), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 95/440 (21%), Positives = 168/440 (38%), Gaps = 98/440 (22%)

Query: 650  AVILYQSLVPISLYISVEI-IKTAQAIFIYTDVLLYNAKLDYPCTPKSWNISDDLGQIEY 708
            A+ +  S++P SL + + I +    A+ +  +V++   KLD           + LG +  
Sbjct: 317  AICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVR--KLDS---------LEALGAVND 365

Query: 709  IFSDKTGTLTQNVMEFKKCTINGVSYGR-AYTEALAGLRKRQGVDVESEGRREKEEIAKD 767
            I SDKTGTLTQ  M  ++  I    +G    + +       +G +V    R    E + +
Sbjct: 366  ICSDKTGTLTQGKMLARQIWIP--RFGTITISNSDDPFNPNEG-NVSLIPRFSPYEYSHN 422

Query: 768  RETMIDELRSMSDN--TQFCPEDLTF-----------------VSKEIVEDLKGSSGDHQ 808
             +  +  L++  D    +  PED+                   V K+   D   + GD  
Sbjct: 423  EDGDVGILQNFKDRLYEKDLPEDIDMDLFQKWLETATLANIATVFKDDATDCWKAHGDPT 482

Query: 809  QKCCEHFLLALALCHSVLVEPNKDDPKKLDIKAQSPDESALVSTARQLGYSFVGSSKSGL 868
            +   + F   + L H+ L        +K   ++   D+S+L     + G +         
Sbjct: 483  EIAIQVFATKMDLPHNALT------GEKSTNQSNENDQSSLSQHNEKPGSA--------- 527

Query: 869  IVEIQGVQKEFQVLNVLEFNSSRKRMSCII--------KIPGSTPKDEPKALLIC----K 916
                     +F+ +    F+S+ KRMS +          I G   K   ++++ C     
Sbjct: 528  ---------QFEHIAEFPFDSTVKRMSSVYYNNHNETYNIYG---KGAFESIISCCSSWY 575

Query: 917  GADSVIYSRLDRTQNDATLLEKTALHLEEYATEGLRTLCLAQRELTWSEYERWVKTYDVA 976
            G D V  + L  T  D   + K    L   + EGLR L  A +  T  +           
Sbjct: 576  GKDGVKITPL--TDCDVETIRKNVYSL---SNEGLRVLGFASKSFTKDQV---------- 620

Query: 977  AASVTNREEELDKVTD---VIERELILLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTG 1033
                   +++L  +T      E +L+ LG   I D  ++    ++    +AGI + +LTG
Sbjct: 621  ------NDDQLKNITSNRATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTG 674

Query: 1034 DKVETAINIGFSCNVLNNDM 1053
            D V TA  I     +L  ++
Sbjct: 675  DFVGTAKAIAQEVGILPTNL 694

 Score = 32.7 bits (73), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 28/56 (50%), Gaps = 11/56 (19%)

Query: 444 KNVKVGDIVRVHNNDEIPADMILLSTSDVDGACYVETKNLDGETNLKVRQSLKCSK 499
           K+V  GDI  V   D IPAD+ L           +ETKN D + +L   +SL  SK
Sbjct: 144 KDVVPGDICLVKVGDTIPADLRL-----------IETKNFDTDESLLTGESLPVSK 188

>YDR038C (ENA5) [891] chr4 complement(527417..530692) Member of the
            Na[+]-transporting ATPases family in the superfamily of
            P-type ATPases [3276 bp, 1091 aa]
          Length = 1091

 Score = 37.7 bits (86), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 95/440 (21%), Positives = 168/440 (38%), Gaps = 98/440 (22%)

Query: 650  AVILYQSLVPISLYISVEI-IKTAQAIFIYTDVLLYNAKLDYPCTPKSWNISDDLGQIEY 708
            A+ +  S++P SL + + I +    A+ +  +V++   KLD           + LG +  
Sbjct: 317  AICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVR--KLDSL---------EALGAVND 365

Query: 709  IFSDKTGTLTQNVMEFKKCTINGVSYGR-AYTEALAGLRKRQGVDVESEGRREKEEIAKD 767
            I SDKTGTLTQ  M  ++  I    +G    + +       +G +V    R    E + +
Sbjct: 366  ICSDKTGTLTQGKMLARQIWIP--RFGTITISNSDDPFNPNEG-NVSLIPRFSPYEYSHN 422

Query: 768  RETMIDELRSMSDN--TQFCPEDLTF-----------------VSKEIVEDLKGSSGDHQ 808
             +  +  L++  D    +  PED+                   V K+   D   + GD  
Sbjct: 423  EDGDVGILQNFKDRLYEKDLPEDIDMDLFQKWLETATLANIATVFKDDATDCWKAHGDPT 482

Query: 809  QKCCEHFLLALALCHSVLVEPNKDDPKKLDIKAQSPDESALVSTARQLGYSFVGSSKSGL 868
            +   + F   + L H+ L        +K   ++   D+S+L     + G +         
Sbjct: 483  EIAIQVFATKMDLPHNALT------GEKSTNQSNENDQSSLSQHNEKPGSA--------- 527

Query: 869  IVEIQGVQKEFQVLNVLEFNSSRKRMSCII--------KIPGSTPKDEPKALLIC----K 916
                     +F+ +    F+S+ KRMS +          I G   K   ++++ C     
Sbjct: 528  ---------QFEHIAEFPFDSTVKRMSSVYYNNHNETYNIYG---KGAFESIISCCSSWY 575

Query: 917  GADSVIYSRLDRTQNDATLLEKTALHLEEYATEGLRTLCLAQRELTWSEYERWVKTYDVA 976
            G D V  + L  T  D   + K    L   + EGLR L  A +  T  +           
Sbjct: 576  GKDGVKITPL--TDCDVETIRKNVYSL---SNEGLRVLGFASKSFTKDQV---------- 620

Query: 977  AASVTNREEELDKVTD---VIERELILLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTG 1033
                   +++L  +T      E +L+ LG   I D  ++    ++    +AGI + +LTG
Sbjct: 621  ------NDDQLKNITSNRATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTG 674

Query: 1034 DKVETAINIGFSCNVLNNDM 1053
            D V TA  I     +L  ++
Sbjct: 675  DFVGTAKAIAQEVGILPTNL 694

 Score = 32.7 bits (73), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 28/56 (50%), Gaps = 11/56 (19%)

Query: 444 KNVKVGDIVRVHNNDEIPADMILLSTSDVDGACYVETKNLDGETNLKVRQSLKCSK 499
           K+V  GDI  V   D IPAD+ L           +ETKN D + +L   +SL  SK
Sbjct: 144 KDVVPGDICLVKVGDTIPADLRL-----------IETKNFDTDESLLTGESLPVSK 188

>Scas_297.1
          Length = 800

 Score = 37.4 bits (85), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 36/65 (55%), Gaps = 9/65 (13%)

Query: 445 NVKVGDIVRVHNNDEIPADMILLSTSDVDGACYVETKNLDGETN----LKVRQSLKCSKI 500
           N+ VGDI+ +   D IPAD +L     V+G C V+  ++ GE++    +KV  +LK   +
Sbjct: 615 NLLVGDIITLQTGDVIPADGVL-----VEGQCEVDESSITGESDTIKKVKVFNALKTFDV 669

Query: 501 IKSSR 505
           I   +
Sbjct: 670 INEGK 674

>YEL031W (SPF1) [1394] chr5 (90258..93905) Putative Ca2+-transporting
            ATPase, member of the P-type ATPase superfamily of
            membrane transporters [3648 bp, 1215 aa]
          Length = 1215

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 69/307 (22%), Positives = 116/307 (37%), Gaps = 47/307 (15%)

Query: 891  RKRMSCIIKIPGSTPKDEPKALLICKGADSVIYSRLDRTQNDATLLEKTALHLEEYATEG 950
            R + S  +K   S            KGA   I  RL     +   + K+      +   G
Sbjct: 579  RFQFSSALKRSASIASHNDALFAAVKGAPETIRERLSDIPKNYDEIYKS------FTRSG 632

Query: 951  LRTLCLAQRELTWSEYERWVKTYDVAAASVTNREEELDKVTDVIERELILLGGTAIEDRL 1010
             R L LA + L                    ++ ++L++  D +E EL   G       L
Sbjct: 633  SRVLALASKSL---------------PKMSQSKIDDLNR--DDVESELTFNGFLIFHCPL 675

Query: 1011 QDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCNVLNNDMELLVVKASGEDVEEFGS 1070
            +D   ++I +L E+  +  ++TGD   TA+++     ++    E L++  +G+      S
Sbjct: 676  KDDAIETIKMLNESSHRSIMITGDNPLTAVHVAKEVGIVFG--ETLILDRAGK------S 727

Query: 1071 DPIQVVNNLVTKYLREKFGMSGSEEELKEAKREHGLPQGNFAVIIDGDALKVALNGEEMR 1130
            D  Q++   V + +   F  S       +   +H      + + + G AL  AL G    
Sbjct: 728  DDNQLLFRDVEETVSIPFDPS-------KDTFDHSKLFDRYDIAVTGYALN-ALEGHSQL 779

Query: 1131 RKFLLLCKNCKAVLCCRVSPXXXXXXXXXXXXTLDVMTLAIGDGSNDVAMIQSADVGVGI 1190
            R  L         +  RVSP             +   TL  GDG+NDV  ++ A VG+ +
Sbjct: 780  RDLLR-----HTWVYARVSPSQKEFLLNTLK-DMGYQTLMCGDGTNDVGALKQAHVGIAL 833

Query: 1191 --AGEEG 1195
                EEG
Sbjct: 834  LNGTEEG 840

>YGL167C (PMR1) [1823] chr7 complement(187620..190472)
            Ca2+-transporting P-type ATPase of Golgi membrane
            involved in Ca2+ and Mn2+ import into Golgi [2853 bp, 950
            aa]
          Length = 950

 Score = 37.4 bits (85), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 58/225 (25%), Positives = 95/225 (42%), Gaps = 40/225 (17%)

Query: 871  EIQGVQKEFQVLNVLEFNSSRKRMSCIIKIPGSTPKDEPKALLICKGA--------DSVI 922
            E+  ++   Q +  L FNS RK M+  I  P      + K  +  KGA         S +
Sbjct: 461  EMPDIRNTVQKVQELPFNSKRKLMATKILNPV-----DNKCTVYVKGAFERILEYSTSYL 515

Query: 923  YSRLDRTQNDATLLEKTALH--LEEYATEGLRTLCLAQRELTWSEYERWVKTYDVAAASV 980
             S+  +T+   T  +K  ++      A+EGLR    A+  LT S+             S 
Sbjct: 516  KSKGKKTEK-LTEAQKATINECANSMASEGLRVFGFAK--LTLSD-------------SS 559

Query: 981  TNREEELDKVTDVIERELILLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAI 1040
            T   E+L K       +L   G   + D  +  V  +I  L + G+ + ++TGD   TA+
Sbjct: 560  TPLTEDLIK-------DLTFTGLIGMNDPPRPNVKFAIEQLLQGGVHIIMITGDSENTAV 612

Query: 1041 NIGFSCNVLNNDMELLVVKASGEDVEEFGSDPIQVVNNLVTKYLR 1085
            NI     +   D +L V+  SG+ ++E   D +  V + V  + R
Sbjct: 613  NIAKQIGIPVIDPKLSVL--SGDKLDEMSDDQLANVIDHVNIFAR 655

>Scas_583.14*
          Length = 875

 Score = 36.6 bits (83), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 69/314 (21%), Positives = 128/314 (40%), Gaps = 54/314 (17%)

Query: 878  EFQVLNVLEFNSSRKRMSCIIKIPGSTPKDEPKALLICKGADSVIYSRLDRTQNDATLLE 937
            + Q+L   +F+S+ KR S +     ++ KD  K     KGA   I  RL     +   + 
Sbjct: 227  KLQILRRFQFSSALKRSSSV-----ASHKD--KLFTAVKGAPETIRERLAVVPKNYDEIY 279

Query: 938  KTALHLEEYATEGLRTLCLAQRELTWSEYERWVKTYDVAAASVTNRE-EELDKVTDVIER 996
            K+      +   G R L LA + L                 ++++++ ++LD+  D IE 
Sbjct: 280  KS------FTRSGSRVLALASKSL----------------PNLSSKQLDDLDR--DEIET 315

Query: 997  ELILLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCNVLNNDMELL 1056
             L   G       L+    ++I +L E+  +  ++TGD   TA+++     ++    E L
Sbjct: 316  GLTFNGFLVFHCPLKPDAVETIKMLNESAHRSIMITGDNPLTAVHVAKEVAIVTG--ETL 373

Query: 1057 VVKASGEDVEEFGSDPIQVVNNLVTKYLREKFGMSGSEEELKEAKREHGLPQGNFAVIID 1116
            ++  S    E  G   +   N  V + ++  F  +         K +H      + + + 
Sbjct: 374  ILDKS----ETVGDGKLLFFN--VEETIKIPFDPASD-------KFDHRELFDKYDIAVT 420

Query: 1117 GDALKVALNGEEMRRKFLLLCKNCKAVLCCRVSPXXXXXXXXXXXXTLDVMTLAIGDGSN 1176
            G AL +  +  +++     L ++    +  RVSP             +   TL  GDG+N
Sbjct: 421  GYALNLLEDHSQLKD----LIRH--TWVYARVSPSQKEFILNNLKE-MGYQTLMCGDGTN 473

Query: 1177 DVAMIQSADVGVGI 1190
            DV  ++ A VGV +
Sbjct: 474  DVGALKQAHVGVAL 487

>Scas_710.41
          Length = 904

 Score = 36.6 bits (83), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 32/54 (59%), Gaps = 2/54 (3%)

Query: 701 DDLGQIEYIFSDKTGTLTQNVMEFKK-CTINGVSYGR-AYTEALAGLRKRQGVD 752
           + L  +E + SDKTGTLT+N +   +  T+ GVS      T  LA  RK++G+D
Sbjct: 354 ESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVSADDLMLTACLAATRKKKGLD 407

>AGL097C [4215] [Homologous to ScYDR039C (ENA2 ) - NSH]
            (520915..524205) [3291 bp, 1096 aa]
          Length = 1096

 Score = 36.6 bits (83), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 45/181 (24%), Positives = 75/181 (41%), Gaps = 36/181 (19%)

Query: 887  FNSSRKRMSCI-IKIPGSTPKDEPKALLICKGADSVIYSRLDR-------------TQND 932
            F+SS KRMS + I +     +D+    +  KGA   +     R             T++D
Sbjct: 531  FDSSIKRMSAVYINL-----RDKNTRHVFTKGAFERVLKCCTRWKLDPGTGVTHPLTEDD 585

Query: 933  ATLLEKTALHLEEYATEGLRTLCLAQRELTWSEYERWVKTYDVAAASVTNREEELDKVTD 992
              +++K   +++  + EGLR L  A + +   E E              +  E L K  D
Sbjct: 586  LEIIQK---NVDTLSNEGLRVLAFATKTIPAEEAE--------------SLGERLTKDRD 628

Query: 993  VIERELILLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCNVLNND 1052
             +E +LI  G   I D  +     ++     AGI + +LTGD   TA  I     +L ++
Sbjct: 629  FVESDLIFQGLVGIYDPPRVETAGAVKKCHRAGINVHMLTGDFPGTAKAIAQEVGILPHN 688

Query: 1053 M 1053
            +
Sbjct: 689  L 689

 Score = 35.8 bits (81), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 74/292 (25%), Positives = 113/292 (38%), Gaps = 73/292 (25%)

Query: 449 GDIVRVHNNDEIPADMILLSTSDVDGACYVETKNLDGETNLKVRQSLKCSKIIKSSRDIT 508
           GDIV+V   D +PAD+ L           VE  NL+ +  L   ++L  +K         
Sbjct: 153 GDIVQVRVGDTVPADLRL-----------VEALNLETDEALLTGEALPVAK--------- 192

Query: 509 RTKFWVESEGPHANLYSYQGNFKWQDTQNGNIRNEPVNINNLLLRGCTLRNTKWAMGMVI 568
                     P A           QDT  G+  N       L     T+   + A G+V+
Sbjct: 193 ---------DPAAVFE--------QDTPVGDRLN-------LAFASSTVSKGR-ATGIVV 227

Query: 569 FTGDDTKIMINAGVTPTKKSRISRELNFSVILNFVLLFILCFTAGIVNGVYYKQKPRSRD 628
            TG  ++I   A     K+S ISR+ N S + N VL       + +   V     P  R 
Sbjct: 228 RTGLRSEIGKIAESLQGKQSLISRDENKSGLQNTVLTVKASVGSFLGTNV---GTPLHRK 284

Query: 629 YFEFGTIGGSAST--------------NGFVSFWVAVILYQSLVPISLYISVEIIKTAQA 674
             +   I  + +               N  V+ + A+ +  S++P SL + + I  +A A
Sbjct: 285 LAKLALILFAIAVLFALIVMATQKFIVNREVAIY-AICVALSMIPSSLVVVLTITMSAGA 343

Query: 675 IFIYTDVLLYNAKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKK 726
             + T  ++   +LD           + LG +  I SDKTGTLTQ  M  K+
Sbjct: 344 KVMSTRNVIVR-RLDS---------LEALGAVNDICSDKTGTLTQGKMILKQ 385

>CAGL0A00495g complement(55014..57722) highly similar to sp|P05030
           Saccharomyces cerevisiae YGL008c PMA1 or sp|P19657
           Saccharomyces cerevisiae YPL036w PMA2, hypothetical
           start
          Length = 902

 Score = 36.2 bits (82), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 32/54 (59%), Gaps = 2/54 (3%)

Query: 701 DDLGQIEYIFSDKTGTLTQNVMEFKK-CTINGVSY-GRAYTEALAGLRKRQGVD 752
           + L  +E + SDKTGTLT+N +   +  T+ GVS      T  LA  RK++G+D
Sbjct: 351 ESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVSADDLMLTACLAASRKKKGLD 404

>Scas_688.1
          Length = 913

 Score = 36.2 bits (82), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 32/54 (59%), Gaps = 2/54 (3%)

Query: 701 DDLGQIEYIFSDKTGTLTQNVMEFKK-CTINGVSYGR-AYTEALAGLRKRQGVD 752
           + L  +E + SDKTGTLT+N +   +  T+ GVS      T  LA  RK++G+D
Sbjct: 362 ESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVSADDLMLTACLAASRKKKGLD 415

>YPL036W (PMA2) [5403] chr16 (482839..485682) H[+]-transporting
           P-type ATPase of the plasma membrane, expression not
           detected under normal growth conditions [2844 bp, 947
           aa]
          Length = 947

 Score = 35.8 bits (81), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 32/54 (59%), Gaps = 2/54 (3%)

Query: 701 DDLGQIEYIFSDKTGTLTQNVMEFKK-CTINGVSY-GRAYTEALAGLRKRQGVD 752
           + L  +E + SDKTGTLT+N +   +  T+ GVS      T  LA  RK++G+D
Sbjct: 396 ESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVSPDDLMLTACLAASRKKKGLD 449

>YJL103C (YJL103C) [2812] chr10 complement(228942..230798) Protein
           with similarity to transcription factors, contains a
           Zn[2]-Cys[6] fungal-type binuclear cluster domain in the
           N-terminal region [1857 bp, 618 aa]
          Length = 618

 Score = 35.8 bits (81), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 58/128 (45%), Gaps = 16/128 (12%)

Query: 684 YNAKLDYPCTPKSWNISD-DLGQIEYIFSDKTGTLTQNVMEF--KKCTINGVSYGRAYTE 740
           +NAKL+  C   S + +D +    ++I   K   L +   +    KC I   +Y  AYT+
Sbjct: 333 HNAKLESECDSSSHSDADLEKHDTDFISPSKFRELVKTPQDLYDNKCLIKPHNYKLAYTK 392

Query: 741 ALAGLRKR--------QGVDVESEGRREKEEIAKDRETMIDELRSMSDNTQFCPEDLTFV 792
            L  LRK+        +   V+ E   +K  +  D E +I   RS+ +  ++ P  ++  
Sbjct: 393 LLTTLRKKFLEGAEIDKSASVKDEHSTQKHNLRYDLEVII---RSILE--RYAPIFISLT 447

Query: 793 SKEIVEDL 800
           S  I EDL
Sbjct: 448 SNMIEEDL 455

>YGL008C (PMA1) [1965] chr7 complement(479913..482669)
           H+-transporting P-type ATPase of the plasma membrane
           required for nutrient uptake and pH homeostasis,
           activity is rate limiting for growth at low pH [2757 bp,
           918 aa]
          Length = 918

 Score = 35.4 bits (80), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 32/54 (59%), Gaps = 2/54 (3%)

Query: 701 DDLGQIEYIFSDKTGTLTQNVMEFKK-CTINGVSYGR-AYTEALAGLRKRQGVD 752
           + L  +E + SDKTGTLT+N +   +  T+ GVS      T  LA  RK++G+D
Sbjct: 367 ESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVSPDDLMLTACLAASRKKKGLD 420

>CAGL0K12034g complement(1161299..1164562) highly similar to sp|P13587
            Saccharomyces cerevisiae YDR040c ENA1 or sp|Q01896
            Saccharomyces cerevisiae YDR039c ENA2 or sp|Q12691
            Saccharomyces cerevisiae YDR038c ENA5, hypothetical start
          Length = 1087

 Score = 35.0 bits (79), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 45/179 (25%), Positives = 75/179 (41%), Gaps = 33/179 (18%)

Query: 887  FNSSRKRMSCIIKIPGSTPKDEPKALLICKGA-DSVI---YSRLDRTQNDATLLEKTAL- 941
            F+S+ KRMS + +      +D     +  KGA +SV+        R  N AT++    + 
Sbjct: 532  FDSTIKRMSSVYE-----SRDYKTYEIYTKGAFESVLNCCTHWYGRDPNTATVMTDADVD 586

Query: 942  ----HLEEYATEGLRTLCLAQRELTWSEYERWVKTYDVAAASVTNREEELDKVT---DVI 994
                +++  ++EGLR L  A +    S+                  EE+L K+    D  
Sbjct: 587  TIKENIDSMSSEGLRVLAFANKSYPKSDV----------------NEEKLQKILKERDYA 630

Query: 995  ERELILLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCNVLNNDM 1053
            E  L  LG   I D  ++    ++    +AGI + +LTGD   TA  I     +L  ++
Sbjct: 631  ETGLTFLGLIGIYDPPREETAGAVKKFHQAGINVRMLTGDFPGTAKAIAQEVGILPTNL 689

>Kwal_14.1498
          Length = 939

 Score = 35.0 bits (79), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 45/211 (21%), Positives = 87/211 (41%), Gaps = 41/211 (19%)

Query: 885  LEFNSSRKRMSCIIKIPGSTPKDEPKALLICKGADSVIYSRLDRTQN--------DATLL 936
            + FNS RK M+  +K      +   K ++  KGA   I  +     N        D+ L 
Sbjct: 465  ISFNSKRKFMAVKVK------EANGKFVVHVKGAYEKILEKSTHFINAENKVVKLDSNLR 518

Query: 937  EKTALHLEEYATEGLRTLCLAQRELTWSEYERWVKTYDVAAASVTNREEELDKVTDVIER 996
            +      +  A++GLRTL  AQ EL+    ++               E++++ +T     
Sbjct: 519  QAITDSADALASDGLRTLAFAQLELSNGNSKKLT-------------EDDINGLT----- 560

Query: 997  ELILLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIG--FSCNVLNNDME 1054
                 G   + D  +  V  ++  L+E  + + ++TGD   TA++I       V+N +  
Sbjct: 561  ---FAGLLGMNDPPRPSVKAAVERLSEGSVHIIMITGDAENTAVSIARQIGIPVVNPETA 617

Query: 1055 LLVVKASGEDVEEFGSDPIQVVNNLVTKYLR 1085
            +L    +G+ ++    D +  + + V  + R
Sbjct: 618  VL----TGDKLDHMSEDQLASIIDHVNIFAR 644

>AGL085C [4226] [Homologous to ScYGL008C (PMA1) - SH; ScYPL036W
           (PMA2) - NSH] (546285..549014) [2730 bp, 909 aa]
          Length = 909

 Score = 34.7 bits (78), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 31/54 (57%), Gaps = 2/54 (3%)

Query: 701 DDLGQIEYIFSDKTGTLTQNVMEFKK-CTINGVSY-GRAYTEALAGLRKRQGVD 752
           + L  +E + SDKTGTLT+N +   +  T+ GV       T  LA  RK++G+D
Sbjct: 348 ESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVEADDLMLTACLAASRKKKGLD 401

>Scas_704.24*
          Length = 769

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 36/135 (26%), Positives = 62/135 (45%), Gaps = 10/135 (7%)

Query: 839 IKAQSPDESALVSTARQLGYSFVGSSKSGLIVEIQGVQKEFQVLNVLEFNSSRKRMSCII 898
           ++  SPDE+A+ + A     +F+ +S+ G        +K  ++  V+  N +R   +   
Sbjct: 432 VEYSSPDETAVCNLASVALPAFIETSEDGK-TSTYNFEKLHEITKVVTRNLNRVIDNNYY 490

Query: 899 KIPG---STPKDEPKALLICKGADSVIYSRLDRTQNDATLLEKTALHLEEYATEGLRTLC 955
            +P    S  +  P AL +   AD+ +  RL     +AT+L K       +A+  L + C
Sbjct: 491 PVPEAERSNVRHRPIALGVQGLADTYMMLRLPFESEEATILNKQIFETMYHAS--LESSC 548

Query: 956 -LAQRELTWSEYERW 969
            LAQ+E     YE W
Sbjct: 549 ELAQKE---GPYETW 560

>Kwal_47.17522
          Length = 899

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 31/54 (57%), Gaps = 2/54 (3%)

Query: 701 DDLGQIEYIFSDKTGTLTQNVMEFKK-CTINGVSYGR-AYTEALAGLRKRQGVD 752
           + L  +E + SDKTGTLT+N +   +  T+ GV       T  LA  RK++G+D
Sbjct: 348 ESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVEPDDLMLTACLAASRKKKGLD 401

>KLLA0A09031g 787768..790467 gi|1346734|sp|P49380|PMA1_KLULA
           Kluyveromyces lactis Plasma membrane ATPase (Proton
           pump), start by similarity
          Length = 899

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 31/54 (57%), Gaps = 2/54 (3%)

Query: 701 DDLGQIEYIFSDKTGTLTQNVMEFKK-CTINGVSYGR-AYTEALAGLRKRQGVD 752
           + L  +E + SDKTGTLT+N +   +  T+ GV       T  LA  RK++G+D
Sbjct: 348 ESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVDPDDLMLTACLAASRKKKGLD 401

>CAGL0J01870g 181666..184506 highly similar to sp|P13586 Saccharomyces
            cerevisiae YGL167c PMR1, hypothetical start
          Length = 946

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 49/209 (23%), Positives = 84/209 (40%), Gaps = 39/209 (18%)

Query: 885  LEFNSSRKRMSCIIKIPGSTPKDEPKALLICKGADSVIYSR----LDRTQNDATLLEKTA 940
            L FNS RK M+        + K+  + +L  KGA   I  +    LD+        E + 
Sbjct: 474  LSFNSKRKYMAI------KSSKESGEHVLYIKGAFERILDKSSYYLDKAGEVREFDEHSK 527

Query: 941  LHLEEYA----TEGLRTLCLAQRELTWSEYERWVKTYDVAAASVTNREEELDKVTDVIER 996
            + + E A    ++GLRT+  A +    ++ +  +   D+   + T               
Sbjct: 528  VMVLEAAHSCASDGLRTIACAFKP---TDSDNVISEDDINGLTFT--------------- 569

Query: 997  ELILLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCNVLNNDMELL 1056
                 G   + D  +  V  SI  L   G+ + ++TGD V TA++I     +   D E  
Sbjct: 570  -----GLFGLADPPRPNVKASIEKLHRGGVHIIMITGDSVNTAVSIAEKIGLSVQDRESS 624

Query: 1057 VVKASGEDVEEFGSDPIQVVNNLVTKYLR 1085
            V+  +G+ V E   D +  V + V  + R
Sbjct: 625  VM--TGDKVSELTEDELSKVIDKVNIFAR 651

>CAGL0I05786g complement(547982..550024) some similarities with
            sp|P40345 Saccharomyces cerevisiae YNR008w LRO1,
            hypothetical start
          Length = 680

 Score = 31.6 bits (70), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 26/41 (63%), Gaps = 6/41 (14%)

Query: 1070 SDPIQVVNNLVTKYLREK------FGMSGSEEELKEAKREH 1104
            +D I++V  L  K+L+E+      FG S +E+ELKE ++ H
Sbjct: 482  NDSIELVRRLSPKWLKERIDEQYSFGYSKTEDELKENEKNH 522

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.136    0.406 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 51,243,780
Number of extensions: 2311157
Number of successful extensions: 7084
Number of sequences better than 10.0: 88
Number of HSP's gapped: 7119
Number of HSP's successfully gapped: 146
Length of query: 1583
Length of database: 16,596,109
Length adjustment: 115
Effective length of query: 1468
Effective length of database: 12,615,039
Effective search space: 18518877252
Effective search space used: 18518877252
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)