Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YDR092W (UBC13)1531517911e-110
Scas_636.15*1531507261e-100
KLLA0C17622g1591497213e-99
CAGL0G08063g1491497092e-97
Kwal_56.234821491406892e-94
Sklu_1838.21631436893e-94
AGR121C1541496562e-89
YDR059C (UBC5)1481463706e-46
KLLA0E12595g1481483672e-45
CAGL0E04752g1471433644e-45
YBR082C (UBC4)1481463645e-45
AER173C1471433636e-45
Scas_635.14*1481433628e-45
Kwal_27.124012361313454e-41
YDR177W (UBC1)2151503202e-37
CAGL0E00671g2131483131e-36
Sklu_1817.22151483131e-36
Scas_682.102141483071e-35
ADR169C2111513053e-35
Kwal_23.64852151482975e-34
KLLA0C18656g2281452862e-32
CAGL0I00352g1671342735e-31
YOR339C (UBC11)1561292709e-31
Scas_563.81711342711e-30
AAR156C1701342702e-30
YGL058W (RAD6)1721342692e-30
KLLA0C05632g1641152673e-30
AEL045W2111532671e-29
Kwal_14.18281521222577e-29
Sklu_2299.51541222543e-28
Sklu_2410.41611382533e-28
Kwal_34.161742131252531e-27
CAGL0M03399g2141252522e-27
YEL012W (UBC8)2181532513e-27
KLLA0A11198g2021252478e-27
Kwal_26.70091611482448e-27
AER056C1571512361e-25
Scas_694.332311252402e-25
CAGL0M07568g1651252343e-25
YMR022W (QRI8)1651252301e-24
ABR059W1651542301e-24
Scas_709.491651512258e-24
Scas_621.41931112251e-23
CAGL0D00814g1571572212e-23
Kwal_26.82241651252204e-23
Kwal_23.42271221212164e-23
KLLA0E07711g1651252195e-23
KLLA0E04983g1571572142e-22
Sklu_2411.72331412183e-22
KLLA0C17248g184912074e-21
YLR306W (UBC12)188972041e-20
CAGL0D06468g1871212023e-20
YDL064W (UBC9)1571571995e-20
YDR054C (CDC34)2951111995e-19
ADL035C2001031946e-19
KLLA0D09196g2921111978e-19
CAGL0E04598g2951111961e-18
Sklu_1826.31611081892e-18
Scas_635.182731111933e-18
Kwal_27.104442781021933e-18
AGL203C2701111915e-18
Kwal_55.212461601011855e-18
Sklu_2136.52721111899e-18
Scas_712.591711511787e-17
AGR372W2421451765e-16
KLLA0E20493g2511211758e-16
Scas_718.342581081741e-15
CAGL0I10450g1621171648e-15
AFR314W1551011621e-14
Scas_599.162241141642e-14
YER100W (UBC6)2501141635e-14
Kwal_27.108372461121626e-14
Sklu_2425.62511141626e-14
CAGL0I05478g2461141531e-12
YGR133W (PEX4)1831361482e-12
KLLA0E03916g1581051463e-12
Scas_609.72401141451e-11
Scas_551.9153871262e-09
Kwal_27.11182101871144e-08
CAGL0H03157g1391241061e-06
KLLA0E19217g1391251052e-06
Scas_720.10*134941033e-06
YGL087C (MMS2)1371231024e-06
AFL064W138123972e-05
CAGL0H04873g45140631.7
Sklu_2369.8101575622.7
CAGL0D05764g87351604.5
KLLA0C10802g167245587.7
Kwal_23.4090205036588.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YDR092W
         (151 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YDR092W (UBC13) [944] chr4 (629870..629899,630168..630599) Ubiqu...   309   e-110
Scas_636.15*                                                          284   e-100
KLLA0C17622g join(1555873..1555902,1556004..1556453) highly simi...   282   3e-99
CAGL0G08063g 761662..762111 highly similar to sp|P52490 Saccharo...   277   2e-97
Kwal_56.23482                                                         270   2e-94
Sklu_1838.2 YDR092W, Contig c1838 1546-2037 reverse complement        270   3e-94
AGR121C [4432] [Homologous to ScYDR092W (UBC13) - SH] (977487..9...   257   2e-89
YDR059C (UBC5) [910] chr4 complement(569230..569629,569720..5697...   147   6e-46
KLLA0E12595g join(1117022..1117068,1117342..1117741) highly simi...   145   2e-45
CAGL0E04752g complement(455965..456408) highly similar to sp|P15...   144   4e-45
YBR082C (UBC4) [271] chr2 complement(406585..406984,407080..4071...   144   5e-45
AER173C [2676] [Homologous to ScYBR082C (UBC4) - SH; ScYDR059C (...   144   6e-45
Scas_635.14*                                                          144   8e-45
Kwal_27.12401                                                         137   4e-41
YDR177W (UBC1) [1019] chr4 (816872..817519) Ubiquitin conjugatin...   127   2e-37
CAGL0E00671g complement(61460..62101) highly similar to sp|P2173...   125   1e-36
Sklu_1817.2 YDR177W, Contig c1817 904-1551 reverse complement         125   1e-36
Scas_682.10                                                           122   1e-35
ADR169C [1911] [Homologous to ScYDR177W (UBC1) - NSH] (1000736.....   122   3e-35
Kwal_23.6485                                                          119   5e-34
KLLA0C18656g 1654787..1655473 similar to sp|P21734 Saccharomyces...   114   2e-32
CAGL0I00352g 26900..27403 highly similar to sp|P06104 Saccharomy...   109   5e-31
YOR339C (UBC11) [5118] chr15 complement(958357..958827) Protein ...   108   9e-31
Scas_563.8                                                            108   1e-30
AAR156C [344] [Homologous to ScYGL058W (RAD6) - SH] (626372..626...   108   2e-30
YGL058W (RAD6) [1921] chr7 (393990..394508) Ubiquitin conjugatin...   108   2e-30
KLLA0C05632g complement(503484..503978) highly similar to sp|P06...   107   3e-30
AEL045W [2461] [Homologous to ScYEL012W (UBC8) - SH] complement(...   107   1e-29
Kwal_14.1828                                                          103   7e-29
Sklu_2299.5 YGL058W, Contig c2299 10055-10519 reverse complement      102   3e-28
Sklu_2410.4 YOR339C, Contig c2410 15549-16034                         102   3e-28
Kwal_34.16174                                                         102   1e-27
CAGL0M03399g complement(389650..390294) highly similar to sp|P28...   101   2e-27
YEL012W (UBC8) [1413] chr5 (131772..131776,131900..132551) Ubiqu...   101   3e-27
KLLA0A11198g join(complement(974525..974529),complement(973755.....   100   8e-27
Kwal_26.7009                                                           99   8e-27
AER056C [2561] [Homologous to ScYDL064W (UBC9) - SH] (741224..74...    96   1e-25
Scas_694.33                                                            97   2e-25
CAGL0M07568g complement(758110..758607) highly similar to sp|Q02...    95   3e-25
YMR022W (QRI8) [3986] chr13 (318679..319176) Ubiquitin-conjugati...    93   1e-24
ABR059W [650] [Homologous to ScYMR022W (QRI8) - SH] complement(5...    93   1e-24
Scas_709.49                                                            91   8e-24
Scas_621.4                                                             91   1e-23
CAGL0D00814g 98589..99062 highly similar to sp|P50623 Saccharomy...    90   2e-23
Kwal_26.8224                                                           89   4e-23
Kwal_23.4227                                                           88   4e-23
KLLA0E07711g complement(693694..694191) highly similar to sp|Q02...    89   5e-23
KLLA0E04983g 443446..443919 highly similar to sp|P50623 Saccharo...    87   2e-22
Sklu_2411.7 YMR022W, Contig c2411 14633-15334 reverse complement       89   3e-22
KLLA0C17248g complement(1509885..1510439) similar to sp|P52491 S...    84   4e-21
YLR306W (UBC12) [3694] chr12 (744153..744155,744290..744853) Rub...    83   1e-20
CAGL0D06468g 615364..615927 similar to sp|P52491 Saccharomyces c...    82   3e-20
YDL064W (UBC9) [802] chr4 (337487..337524,337635..338070) Smt3p-...    81   5e-20
YDR054C (CDC34) [905] chr4 complement(561436..562323) Ubiquitin-...    81   5e-19
ADL035C [1707] [Homologous to ScYLR306W (UBC12) - SH] (634059..6...    79   6e-19
KLLA0D09196g 772795..773673 similar to sp|P14682 Saccharomyces c...    80   8e-19
CAGL0E04598g complement(444288..445175) highly similar to sp|P14...    80   1e-18
Sklu_1826.3 YGR133W, Contig c1826 3548-4033                            77   2e-18
Scas_635.18                                                            79   3e-18
Kwal_27.10444                                                          79   3e-18
AGL203C [4109] [Homologous to ScYDR054C (CDC34) - SH] (317749..3...    78   5e-18
Kwal_55.21246                                                          76   5e-18
Sklu_2136.5 YDR054C, Contig c2136 7737-8555                            77   9e-18
Scas_712.59                                                            73   7e-17
AGR372W [4683] [Homologous to ScYER100W (UBC6) - SH] complement(...    72   5e-16
KLLA0E20493g 1814618..1815373 similar to sp|P33296 Saccharomyces...    72   8e-16
Scas_718.34                                                            72   1e-15
CAGL0I10450g complement(1024541..1025029) similar to sp|P29340 S...    68   8e-15
AFR314W [3506] [Homologous to ScYGR133W (PEX4) - SH] complement(...    67   1e-14
Scas_599.16                                                            68   2e-14
YER100W (UBC6) [1532] chr5 (359558..360310) Ubiquitin-conjugatin...    67   5e-14
Kwal_27.10837                                                          67   6e-14
Sklu_2425.6 YER100W, Contig c2425 8506-9261 reverse complement         67   6e-14
CAGL0I05478g complement(518933..519673) highly similar to sp|P33...    64   1e-12
YGR133W (PEX4) [2090] chr7 (756899..757450) Ubiquitin-conjugatin...    62   2e-12
KLLA0E03916g complement(365119..365595) similar to sp|P29340 Sac...    61   3e-12
Scas_609.7                                                             60   1e-11
Scas_551.9                                                             53   2e-09
Kwal_27.11182                                                          49   4e-08
CAGL0H03157g join(complement(297881..297891),complement(297272.....    45   1e-06
KLLA0E19217g join(complement(1703226..1703236), highly similar t...    45   2e-06
Scas_720.10*                                                           44   3e-06
YGL087C (MMS2) [1895] chr7 complement(346407..346809,346895..346...    44   4e-06
AFL064W [3129] [Homologous to ScYGL087C (MMS2) - SH] complement(...    42   2e-05
CAGL0H04873g complement(465069..466424) some similarities with t...    29   1.7  
Sklu_2369.8 YER075C, Contig c2369 9770-12817 reverse complement        28   2.7  
CAGL0D05764g 547259..549880 weakly similar to tr|Q12369 Saccharo...    28   4.5  
KLLA0C10802g complement(926916..931934) similar to sp|P15442 Sac...    27   7.7  
Kwal_23.4090                                                           27   8.2  

>YDR092W (UBC13) [944] chr4 (629870..629899,630168..630599)
           Ubiquitin-conjugating (E2) enzyme involved in
           Rad6-dependent post-replicative repair pathway, required
           for non-proteolytic multi-ubiquitination of Pol30p
           (PCNA) [462 bp, 153 aa]
          Length = 153

 Score =  309 bits (791), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 151/151 (100%), Positives = 151/151 (100%)

Query: 1   MASLPKRIIKETEKLVSDPVPGITAEPHDDNLRYFQVTIEGPEQSPYEDGIFELELYLPD 60
           MASLPKRIIKETEKLVSDPVPGITAEPHDDNLRYFQVTIEGPEQSPYEDGIFELELYLPD
Sbjct: 1   MASLPKRIIKETEKLVSDPVPGITAEPHDDNLRYFQVTIEGPEQSPYEDGIFELELYLPD 60

Query: 61  DYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSIQALLASPNPNDP 120
           DYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSIQALLASPNPNDP
Sbjct: 61  DYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSIQALLASPNPNDP 120

Query: 121 LANDVAEDWIKNEQGAKAKAREWTKLYAKKK 151
           LANDVAEDWIKNEQGAKAKAREWTKLYAKKK
Sbjct: 121 LANDVAEDWIKNEQGAKAKAREWTKLYAKKK 151

>Scas_636.15*
          Length = 153

 Score =  284 bits (726), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 134/150 (89%), Positives = 144/150 (96%)

Query: 1   MASLPKRIIKETEKLVSDPVPGITAEPHDDNLRYFQVTIEGPEQSPYEDGIFELELYLPD 60
           MASLPKRIIKETE+L+SDPVPGITAEPH+DNLRYF VT+EGP  SPYE+GIF+LELYLPD
Sbjct: 1   MASLPKRIIKETERLISDPVPGITAEPHEDNLRYFNVTVEGPAGSPYENGIFQLELYLPD 60

Query: 61  DYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSIQALLASPNPNDP 120
           DYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLS+QALLASPNPNDP
Sbjct: 61  DYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSVQALLASPNPNDP 120

Query: 121 LANDVAEDWIKNEQGAKAKAREWTKLYAKK 150
           LANDVAE+WI+NE GAKA AREWT+ YAKK
Sbjct: 121 LANDVAEEWIQNEAGAKATAREWTQKYAKK 150

>KLLA0C17622g join(1555873..1555902,1556004..1556453) highly similar
           to sp|P52490 Saccharomyces cerevisiae YDR092w UBC13 E2
           ubiquitin-conjugating enzyme, start by similarity
          Length = 159

 Score =  282 bits (721), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 133/149 (89%), Positives = 145/149 (97%)

Query: 1   MASLPKRIIKETEKLVSDPVPGITAEPHDDNLRYFQVTIEGPEQSPYEDGIFELELYLPD 60
           MA+LPKRIIKETE+LVSDPVPGITAEPH+DNLRYFQVTIEGP+QSPYE+G+F+LEL+LPD
Sbjct: 1   MAALPKRIIKETERLVSDPVPGITAEPHEDNLRYFQVTIEGPQQSPYENGVFQLELFLPD 60

Query: 61  DYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSIQALLASPNPNDP 120
           DYPMEAPKVRFLTKIYHPNIDRLGRICLDVLK NWSPALQIRTVLLS+QALLASPNPNDP
Sbjct: 61  DYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKNNWSPALQIRTVLLSVQALLASPNPNDP 120

Query: 121 LANDVAEDWIKNEQGAKAKAREWTKLYAK 149
           LANDVAE+WIK+E  A AKA+EWTKLYAK
Sbjct: 121 LANDVAEEWIKHEDTAIAKAKEWTKLYAK 149

>CAGL0G08063g 761662..762111 highly similar to sp|P52490
           Saccharomyces cerevisiae YDR092w UBC13 E2
           ubiquitin-conjugating enzyme, start by similarity
          Length = 149

 Score =  277 bits (709), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 134/149 (89%), Positives = 140/149 (93%)

Query: 1   MASLPKRIIKETEKLVSDPVPGITAEPHDDNLRYFQVTIEGPEQSPYEDGIFELELYLPD 60
           MASLPKRIIKETE+LVSDPVPGITAEPH+DNLRYF VTIEGP QSPYE GIF+LELYLP+
Sbjct: 1   MASLPKRIIKETERLVSDPVPGITAEPHEDNLRYFDVTIEGPSQSPYEKGIFKLELYLPE 60

Query: 61  DYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSIQALLASPNPNDP 120
           DYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSIQALLASPNPNDP
Sbjct: 61  DYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSIQALLASPNPNDP 120

Query: 121 LANDVAEDWIKNEQGAKAKAREWTKLYAK 149
           LANDVAEDWIK+E  AK  A+EWT  YAK
Sbjct: 121 LANDVAEDWIKDEAKAKQTAKEWTAQYAK 149

>Kwal_56.23482
          Length = 149

 Score =  270 bits (689), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 126/140 (90%), Positives = 137/140 (97%)

Query: 10  KETEKLVSDPVPGITAEPHDDNLRYFQVTIEGPEQSPYEDGIFELELYLPDDYPMEAPKV 69
           +ETE+LVSDPVPGITAEPH++NLRYFQVTIEGP+QSPYE+G+F+LEL+LPDDYPMEAPKV
Sbjct: 10  QETERLVSDPVPGITAEPHEENLRYFQVTIEGPQQSPYENGVFKLELFLPDDYPMEAPKV 69

Query: 70  RFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSIQALLASPNPNDPLANDVAEDW 129
           RFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLS+QALLASPNPNDPLANDVAEDW
Sbjct: 70  RFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSVQALLASPNPNDPLANDVAEDW 129

Query: 130 IKNEQGAKAKAREWTKLYAK 149
           IKNE GA AKAREWT+LYA 
Sbjct: 130 IKNEDGAIAKAREWTQLYAN 149

>Sklu_1838.2 YDR092W, Contig c1838 1546-2037 reverse complement
          Length = 163

 Score =  270 bits (689), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 126/143 (88%), Positives = 138/143 (96%)

Query: 9   IKETEKLVSDPVPGITAEPHDDNLRYFQVTIEGPEQSPYEDGIFELELYLPDDYPMEAPK 68
           ++ETE+LVSDPVPGI+AEPHDDNLRYFQVTIEGP+QSPYE+G+FELEL+LP+DYPMEAPK
Sbjct: 19  LQETERLVSDPVPGISAEPHDDNLRYFQVTIEGPQQSPYENGVFELELFLPEDYPMEAPK 78

Query: 69  VRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSIQALLASPNPNDPLANDVAED 128
           VRFLTKIYHPNIDRLGRICLDVLK NWSPALQIRTVLLSIQALLASPNPNDPLANDVAED
Sbjct: 79  VRFLTKIYHPNIDRLGRICLDVLKNNWSPALQIRTVLLSIQALLASPNPNDPLANDVAED 138

Query: 129 WIKNEQGAKAKAREWTKLYAKKK 151
           WIKNE+GA A A+EWT+ YAKK 
Sbjct: 139 WIKNEEGAIATAKEWTEKYAKKS 161

>AGR121C [4432] [Homologous to ScYDR092W (UBC13) - SH]
           (977487..977921,977971..978000) [465 bp, 154 aa]
          Length = 154

 Score =  257 bits (656), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 127/149 (85%), Positives = 138/149 (92%)

Query: 1   MASLPKRIIKETEKLVSDPVPGITAEPHDDNLRYFQVTIEGPEQSPYEDGIFELELYLPD 60
           M  LPKRIIKETE+LVSDPVPGI+AEPH+DNLRYF V+IEGP+QSPYE G+F LEL+LPD
Sbjct: 1   MVPLPKRIIKETERLVSDPVPGISAEPHEDNLRYFDVSIEGPQQSPYEHGVFRLELFLPD 60

Query: 61  DYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSIQALLASPNPNDP 120
           +YPME PKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSIQALLA+PNPNDP
Sbjct: 61  EYPMEPPKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSIQALLATPNPNDP 120

Query: 121 LANDVAEDWIKNEQGAKAKAREWTKLYAK 149
           LANDVA+DWI +E  A AKAREWT LYAK
Sbjct: 121 LANDVAKDWIADEAAATAKAREWTALYAK 149

>YDR059C (UBC5) [910] chr4 complement(569230..569629,569720..569766)
           Ubiquitin-conjugating enzyme that with Ubc4p is
           responsible for most of ubiquitin-dependent protein
           degradation of short-lived and abnormal proteins [447
           bp, 148 aa]
          Length = 148

 Score =  147 bits (370), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 72/146 (49%), Positives = 94/146 (64%)

Query: 3   SLPKRIIKETEKLVSDPVPGITAEPHDDNLRYFQVTIEGPEQSPYEDGIFELELYLPDDY 62
           S  KRI KE   L  DP    +A P  D+L ++Q +I GP  SPY  G+F L ++ P DY
Sbjct: 2   SSSKRIAKELSDLGRDPPASCSAGPVGDDLYHWQASIMGPSDSPYAGGVFFLSIHFPTDY 61

Query: 63  PMEAPKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSIQALLASPNPNDPLA 122
           P + PKV F TKIYHPNI+  G ICLD+LK  WSPAL +  VLLSI +LL   NP+DPL 
Sbjct: 62  PFKPPKVNFTTKIYHPNINSSGNICLDILKDQWSPALTLSKVLLSICSLLTDANPDDPLV 121

Query: 123 NDVAEDWIKNEQGAKAKAREWTKLYA 148
            ++A+ +  ++   +A A+EWTK YA
Sbjct: 122 PEIAQIYKTDKAKYEATAKEWTKKYA 147

>KLLA0E12595g join(1117022..1117068,1117342..1117741) highly similar
           to sp|P15731 Saccharomyces cerevisiae YBR082c UBC4 E2
           ubiquitin-conjugating enzyme or sp|P15732 Saccharomyces
           cerevisiae YDR059c UBC5, start by similarity
          Length = 148

 Score =  145 bits (367), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 74/148 (50%), Positives = 95/148 (64%), Gaps = 1/148 (0%)

Query: 1   MASLPKRIIKETEKLVSDPVPGITAEPHDDNLRYFQVTIEGPEQSPYEDGIFELELYLPD 60
           M+SL KRI KE   L  DP    +A P  D++ ++Q +I GP  SPY  G+F L ++ P 
Sbjct: 1   MSSL-KRITKELNDLGRDPPTSCSAGPVGDDVYHWQASIMGPPDSPYAGGVFFLSIHFPT 59

Query: 61  DYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSIQALLASPNPNDP 120
           DYP + PK+ F TKIYHPNI+  G ICLD+LK  WSPAL I  VLLSI +LL   NP+DP
Sbjct: 60  DYPFKPPKISFTTKIYHPNINANGNICLDILKDQWSPALTISKVLLSICSLLTDANPDDP 119

Query: 121 LANDVAEDWIKNEQGAKAKAREWTKLYA 148
           L  ++A  +  +    +A AREWTK YA
Sbjct: 120 LVPEIAHLYKTDRAKYEATAREWTKKYA 147

>CAGL0E04752g complement(455965..456408) highly similar to sp|P15731
           Saccharomyces cerevisiae YBR082c UBC4 E2
           ubiquitin-conjugating enzyme or sp|P15732 Saccharomyces
           cerevisiae YDR059c UBC5, start by similarity
          Length = 147

 Score =  144 bits (364), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 71/143 (49%), Positives = 91/143 (63%)

Query: 6   KRIIKETEKLVSDPVPGITAEPHDDNLRYFQVTIEGPEQSPYEDGIFELELYLPDDYPME 65
           KRI KE   L  DP    +A P  D+L ++Q +I GP  SPY  G+F L ++ P DYP +
Sbjct: 4   KRIAKELSDLGRDPPTSCSAGPVGDDLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFK 63

Query: 66  APKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSIQALLASPNPNDPLANDV 125
            PK+ F TKIYHPNI+  G ICLD+LK  WSPAL +  VLLSI +LL   NP+DPL  ++
Sbjct: 64  PPKISFTTKIYHPNINANGNICLDILKDQWSPALTLSKVLLSICSLLTDANPDDPLVPEI 123

Query: 126 AEDWIKNEQGAKAKAREWTKLYA 148
           A  +  +    +A AREWTK YA
Sbjct: 124 AHIYKTDRAKYEATAREWTKKYA 146

>YBR082C (UBC4) [271] chr2 complement(406585..406984,407080..407126)
           Ubiquitin-conjugating (E2) enzyme, together with Ubc5p
           is responsible for the majority of ubiquitin-dependent
           protein degradation of short-lived and abnormal proteins
           [447 bp, 148 aa]
          Length = 148

 Score =  144 bits (364), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 72/146 (49%), Positives = 92/146 (63%)

Query: 3   SLPKRIIKETEKLVSDPVPGITAEPHDDNLRYFQVTIEGPEQSPYEDGIFELELYLPDDY 62
           S  KRI KE   L  DP    +A P  D+L ++Q +I GP  SPY  G+F L ++ P DY
Sbjct: 2   SSSKRIAKELSDLERDPPTSCSAGPVGDDLYHWQASIMGPADSPYAGGVFFLSIHFPTDY 61

Query: 63  PMEAPKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSIQALLASPNPNDPLA 122
           P + PK+ F TKIYHPNI+  G ICLD+LK  WSPAL +  VLLSI +LL   NP+DPL 
Sbjct: 62  PFKPPKISFTTKIYHPNINANGNICLDILKDQWSPALTLSKVLLSICSLLTDANPDDPLV 121

Query: 123 NDVAEDWIKNEQGAKAKAREWTKLYA 148
            ++A  +  +    +A AREWTK YA
Sbjct: 122 PEIAHIYKTDRPKYEATAREWTKKYA 147

>AER173C [2676] [Homologous to ScYBR082C (UBC4) - SH; ScYDR059C
           (UBC5) - SH] (960420..960863) [444 bp, 147 aa]
          Length = 147

 Score =  144 bits (363), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 71/143 (49%), Positives = 91/143 (63%)

Query: 6   KRIIKETEKLVSDPVPGITAEPHDDNLRYFQVTIEGPEQSPYEDGIFELELYLPDDYPME 65
           KRI KE   L  DP    +A P  D+L ++Q +I GP  SPY  G+F L ++ P DYP +
Sbjct: 4   KRITKELNDLGRDPPTSCSAGPVGDDLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFK 63

Query: 66  APKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSIQALLASPNPNDPLANDV 125
            PK+ F TKIYHPNI+  G ICLD+LK  WSPAL I  VLLSI +LL   NP+DPL  ++
Sbjct: 64  PPKISFTTKIYHPNINANGNICLDILKDQWSPALTISKVLLSICSLLTDANPDDPLVPEI 123

Query: 126 AEDWIKNEQGAKAKAREWTKLYA 148
           A  +  +    +A A+EWTK YA
Sbjct: 124 AHIYKTDRAKYEATAKEWTKKYA 146

>Scas_635.14*
          Length = 148

 Score =  144 bits (362), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 70/143 (48%), Positives = 91/143 (63%)

Query: 6   KRIIKETEKLVSDPVPGITAEPHDDNLRYFQVTIEGPEQSPYEDGIFELELYLPDDYPME 65
           KRI KE   +  DP    +A P  D+L ++Q +I GP  SPY  G+F L ++ P DYP +
Sbjct: 5   KRITKELSDMGRDPPTSCSAGPVGDDLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFK 64

Query: 66  APKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSIQALLASPNPNDPLANDV 125
            PK+ F TKIYHPNI+  G ICLD+LK  WSPAL +  VLLSI +LL   NP+DPL  ++
Sbjct: 65  PPKISFTTKIYHPNINANGNICLDILKDQWSPALTLSKVLLSICSLLTDANPDDPLVPEI 124

Query: 126 AEDWIKNEQGAKAKAREWTKLYA 148
           A  +  +    +A AREWTK YA
Sbjct: 125 AHIYKTDRPKYEATAREWTKKYA 147

>Kwal_27.12401
          Length = 236

 Score =  137 bits (345), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 65/131 (49%), Positives = 85/131 (64%)

Query: 18  DPVPGITAEPHDDNLRYFQVTIEGPEQSPYEDGIFELELYLPDDYPMEAPKVRFLTKIYH 77
           DP    +A P  D+L ++Q +I GP  SPY  G+F L ++ P DYP + PK+ F TKIYH
Sbjct: 105 DPPTSCSAGPVGDDLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFTTKIYH 164

Query: 78  PNIDRLGRICLDVLKTNWSPALQIRTVLLSIQALLASPNPNDPLANDVAEDWIKNEQGAK 137
           PNI+  G ICLD+LK  WSPAL I  VLLSI +LL   NP+DPL  ++A  +  +    +
Sbjct: 165 PNINANGNICLDILKDQWSPALTISKVLLSICSLLTDANPDDPLVPEIAHIYKTDRAKYE 224

Query: 138 AKAREWTKLYA 148
           A A+EWTK YA
Sbjct: 225 ATAKEWTKKYA 235

>YDR177W (UBC1) [1019] chr4 (816872..817519) Ubiquitin conjugating
           enzyme (E2) that plays a role early in spore
           germination, in degradation of mis-folded proteins in
           the ER, and degradation of Gal2p at the plasma membrane
           [648 bp, 215 aa]
          Length = 215

 Score =  127 bits (320), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 62/150 (41%), Positives = 97/150 (64%), Gaps = 2/150 (1%)

Query: 3   SLPKRIIKETEKLVSDPVPGITAE-PHDDNLRYFQVTIEGPEQSPYEDGIFELELYLPDD 61
           S  KRI+KE + +  DP   IT E   + ++ + + T  GP  +PYE G F +++ +P +
Sbjct: 2   SRAKRIMKEIQAVKDDPAAHITLEFVSESDIHHLKGTFLGPPGTPYEGGKFVVDIEVPME 61

Query: 62  YPMEAPKVRFLTKIYHPNIDRL-GRICLDVLKTNWSPALQIRTVLLSIQALLASPNPNDP 120
           YP + PK++F TK+YHPNI  + G ICLD+LK  WSP + +++ L+S+QALL SP PNDP
Sbjct: 62  YPFKPPKMQFDTKVYHPNISSVTGAICLDILKNAWSPVITLKSALISLQALLQSPEPNDP 121

Query: 121 LANDVAEDWIKNEQGAKAKAREWTKLYAKK 150
              +VA+ ++++ +     A  WT+LYA +
Sbjct: 122 QDAEVAQHYLRDRESFNKTAALWTRLYASE 151

>CAGL0E00671g complement(61460..62101) highly similar to sp|P21734
           Saccharomyces cerevisiae YDR177w E2
           ubiquitin-conjugating enzyme, start by similarity
          Length = 213

 Score =  125 bits (313), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 96/148 (64%), Gaps = 2/148 (1%)

Query: 3   SLPKRIIKETEKLVSDPVPGITAE-PHDDNLRYFQVTIEGPEQSPYEDGIFELELYLPDD 61
           S  KRI+KE + +  DP   I+ E   + ++ + + +  GP  +PYE G F +++ +P +
Sbjct: 2   SRAKRIMKELQAVKDDPEANISLEFVSESDIHHLKGSFLGPPGTPYEGGKFIVDIEVPME 61

Query: 62  YPMEAPKVRFLTKIYHPNIDRL-GRICLDVLKTNWSPALQIRTVLLSIQALLASPNPNDP 120
           YP + PK++F +K+YHPNI  + G ICLD+LK  WSP + +++ L+S+QALL SP PNDP
Sbjct: 62  YPFKPPKMKFDSKVYHPNISSVTGAICLDILKNAWSPVITLKSALISLQALLQSPEPNDP 121

Query: 121 LANDVAEDWIKNEQGAKAKAREWTKLYA 148
              +VA+ ++++ Q     A  WTKLYA
Sbjct: 122 QDAEVAQHYLRDRQSFDKTAALWTKLYA 149

>Sklu_1817.2 YDR177W, Contig c1817 904-1551 reverse complement
          Length = 215

 Score =  125 bits (313), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 63/148 (42%), Positives = 95/148 (64%), Gaps = 2/148 (1%)

Query: 3   SLPKRIIKETEKLVSDPVPGIT-AEPHDDNLRYFQVTIEGPEQSPYEDGIFELELYLPDD 61
           S  KRIIKE +    DP   IT +   + ++ + + +  GP  +PYE G F +++ +P +
Sbjct: 2   SRAKRIIKEIQAAKDDPEANITLSFVSESDIHHLKGSFYGPPGTPYEGGNFIVDIQVPLE 61

Query: 62  YPMEAPKVRFLTKIYHPNIDRL-GRICLDVLKTNWSPALQIRTVLLSIQALLASPNPNDP 120
           YP + PK++F TK+YHPNI  + G ICLD+LK  WSP + +++ L+S+QALL SP PNDP
Sbjct: 62  YPFKPPKMQFDTKVYHPNISSVTGAICLDILKNAWSPVITLKSALISLQALLQSPEPNDP 121

Query: 121 LANDVAEDWIKNEQGAKAKAREWTKLYA 148
              +VA+ +I+++      A  WTKLYA
Sbjct: 122 QDAEVAQHFIRDKSSFDKTAALWTKLYA 149

>Scas_682.10
          Length = 214

 Score =  122 bits (307), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 95/148 (64%), Gaps = 2/148 (1%)

Query: 3   SLPKRIIKETEKLVSDPVPGITAE-PHDDNLRYFQVTIEGPEQSPYEDGIFELELYLPDD 61
           S  KRI+KE + +  DP   I  E  ++ ++ + + +  GP  +PYE G F +++ +P +
Sbjct: 2   SRAKRIMKELQAVKDDPEARIELEFVNESDIHHLKGSFLGPPGTPYEGGQFIVDIEVPME 61

Query: 62  YPMEAPKVRFLTKIYHPNIDRL-GRICLDVLKTNWSPALQIRTVLLSIQALLASPNPNDP 120
           YP + P ++F TK+YHPNI  + G ICLD+LK  WSP + +++ L+S+QALL SP PNDP
Sbjct: 62  YPFKPPMMKFDTKVYHPNISSVTGAICLDILKNAWSPVITLKSALISLQALLQSPEPNDP 121

Query: 121 LANDVAEDWIKNEQGAKAKAREWTKLYA 148
              +VA+ ++K+ +     A  WTKLYA
Sbjct: 122 QDAEVAQHYLKDRESFNKTAALWTKLYA 149

>ADR169C [1911] [Homologous to ScYDR177W (UBC1) - NSH]
           (1000736..1001371) [636 bp, 211 aa]
          Length = 211

 Score =  122 bits (305), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 61/151 (40%), Positives = 94/151 (62%), Gaps = 2/151 (1%)

Query: 3   SLPKRIIKETEKLVSDPVPGIT-AEPHDDNLRYFQVTIEGPEQSPYEDGIFELELYLPDD 61
           S  KR++KE + +  DP   I+ A   + ++ + + T  GP  +PY  G F +++ +P +
Sbjct: 2   SRAKRLMKEIQSVKDDPDANISLAFVSESDIHHLKGTFLGPPGTPYHGGTFIVDIQVPLE 61

Query: 62  YPMEAPKVRFLTKIYHPNIDRL-GRICLDVLKTNWSPALQIRTVLLSIQALLASPNPNDP 120
           YP + PK++F TK+YHPNI  + G ICLD+LK +WSP L ++T L+S+QALL SP PNDP
Sbjct: 62  YPFKPPKMQFDTKVYHPNISSVTGAICLDILKNSWSPVLTLKTSLISLQALLQSPEPNDP 121

Query: 121 LANDVAEDWIKNEQGAKAKAREWTKLYAKKK 151
              +VA+ ++ +       A  WTK YA  +
Sbjct: 122 QDAEVAKHYLSDRASFDRTAALWTKTYASGQ 152

>Kwal_23.6485
          Length = 215

 Score =  119 bits (297), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 57/148 (38%), Positives = 95/148 (64%), Gaps = 2/148 (1%)

Query: 3   SLPKRIIKETEKLVSDPVPGITAEPHDDN-LRYFQVTIEGPEQSPYEDGIFELELYLPDD 61
           S  KR++KE + +  DP   +  +  ++N +   + +  GP  +PYE+G + +++ +P +
Sbjct: 2   SRAKRVMKELQAIKDDPEARVDLQLVNENDIHLLKGSFLGPPGTPYENGKYIVDIEVPME 61

Query: 62  YPMEAPKVRFLTKIYHPNIDRL-GRICLDVLKTNWSPALQIRTVLLSIQALLASPNPNDP 120
           YP + PK++F TK+YHPN+  + G ICLD+LK  WSP + +++ L+S+QALL SP PNDP
Sbjct: 62  YPFKPPKMKFQTKVYHPNVSSVTGAICLDILKNAWSPVITLKSALISLQALLQSPEPNDP 121

Query: 121 LANDVAEDWIKNEQGAKAKAREWTKLYA 148
              +VA+ +I+++      A  WTK YA
Sbjct: 122 QDAEVAQHYIRDKASFDKTAAFWTKTYA 149

>KLLA0C18656g 1654787..1655473 similar to sp|P21734 Saccharomyces
           cerevisiae YDR177w UBC1 E2 ubiquitin-conjugating enzyme,
           start by similarity
          Length = 228

 Score =  114 bits (286), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 54/145 (37%), Positives = 93/145 (64%), Gaps = 2/145 (1%)

Query: 6   KRIIKETEKLVSDPVPGITAE-PHDDNLRYFQVTIEGPEQSPYEDGIFELELYLPDDYPM 64
           KRI+KE + +  DP   I  +  ++ ++ + + +  GP  +PYE G F +++ +P +YP 
Sbjct: 5   KRILKEIQAVKEDPEAQIELKFVNESDIHHMKGSFIGPSGTPYEGGKFVVDINIPVEYPY 64

Query: 65  EAPKVRFLTKIYHPNIDRL-GRICLDVLKTNWSPALQIRTVLLSIQALLASPNPNDPLAN 123
           + P+++F TK+YHPN+  + G ICLD+LK  W+P + +++ L+S+QALL SP PNDP   
Sbjct: 65  KPPQMKFDTKVYHPNVSSVTGAICLDILKNAWTPVITLKSALISLQALLQSPEPNDPQDA 124

Query: 124 DVAEDWIKNEQGAKAKAREWTKLYA 148
            VA+ ++ +++     A  WT+ YA
Sbjct: 125 QVAKHYLTDKKSFDETAALWTRTYA 149

>CAGL0I00352g 26900..27403 highly similar to sp|P06104 Saccharomyces
           cerevisiae YGL058w RAD6 E2 ubiquitin-conjugating, start
           by similarity
          Length = 167

 Score =  109 bits (273), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 81/134 (60%), Gaps = 1/134 (0%)

Query: 6   KRIIKETEKLVSDPVPGITAEPHDDNLRYFQVTIEGPEQSPYEDGIFELELYLPDDYPME 65
           +R++++ +++  D  PG++A P  DN+  +   I GP  +PYEDG F L L   +DYP +
Sbjct: 7   RRLMRDFKRMKEDSPPGVSASPLPDNVMVWNAMIIGPADTPYEDGTFRLLLEFDEDYPNK 66

Query: 66  APKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSIQALLASPNPNDPLANDV 125
            P V+FL++++HPN+   G ICLD+L+  W+P   + ++L SIQ+L   PNP  P AN  
Sbjct: 67  PPHVKFLSEMFHPNVYANGEICLDILQNRWTPTYDVASILTSIQSLFNDPNPASP-ANVE 125

Query: 126 AEDWIKNEQGAKAK 139
           A    K+ +    K
Sbjct: 126 AATLFKDHKSQYIK 139

>YOR339C (UBC11) [5118] chr15 complement(958357..958827) Protein
           with similarity to ubiquitin-conjugating enzymes [471
           bp, 156 aa]
          Length = 156

 Score =  108 bits (270), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 76/129 (58%), Gaps = 1/129 (0%)

Query: 2   ASLPKRIIKETEKLVSDPVPGITAEPHDDN-LRYFQVTIEGPEQSPYEDGIFELELYLPD 60
             + KR+  E  +L+S     I+A P DDN L Y+   I GP+ +PY    F++ L  P 
Sbjct: 7   GCVTKRLQNELLQLLSSTTESISAFPVDDNDLTYWVGYITGPKDTPYSGLKFKVSLKFPQ 66

Query: 61  DYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSIQALLASPNPNDP 120
           +YP   P ++FL+ ++HPN+D+ G ICLD+LK  WS    + T+LLS+Q+LL  PN   P
Sbjct: 67  NYPFHPPMIKFLSPMWHPNVDKSGNICLDILKEKWSAVYNVETILLSLQSLLGEPNNRSP 126

Query: 121 LANDVAEDW 129
           L    AE W
Sbjct: 127 LNAVAAELW 135

>Scas_563.8
          Length = 171

 Score =  108 bits (271), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 50/134 (37%), Positives = 82/134 (61%), Gaps = 1/134 (0%)

Query: 6   KRIIKETEKLVSDPVPGITAEPHDDNLRYFQVTIEGPEQSPYEDGIFELELYLPDDYPME 65
           +R++++ +++  D  PG++A P  DN+  +   I GP ++PYEDG F L L   ++YP +
Sbjct: 7   RRLMRDFKRMKEDAPPGVSASPLPDNVMVWNAMIIGPAETPYEDGTFRLLLEFDEEYPNK 66

Query: 66  APKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSIQALLASPNPNDPLANDV 125
            P V+FL++++HPN+   G ICLD+L+  W+P   + ++L SIQ+L   PNP  P AN  
Sbjct: 67  PPHVKFLSEMFHPNVYANGEICLDILQNRWTPTYDVASILTSIQSLFNDPNPASP-ANVE 125

Query: 126 AEDWIKNEQGAKAK 139
           A    K+ +    K
Sbjct: 126 AATLFKDHKSQYIK 139

>AAR156C [344] [Homologous to ScYGL058W (RAD6) - SH]
           (626372..626884) [513 bp, 170 aa]
          Length = 170

 Score =  108 bits (270), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 50/134 (37%), Positives = 81/134 (60%), Gaps = 1/134 (0%)

Query: 6   KRIIKETEKLVSDPVPGITAEPHDDNLRYFQVTIEGPEQSPYEDGIFELELYLPDDYPME 65
           +R++++ +++  D  PG++A P  DN+  +   I GP  +PYEDG F L L   ++YP +
Sbjct: 7   RRLMRDFKRMKEDAPPGVSASPLPDNVMVWNAMIIGPADTPYEDGTFRLLLEFDEEYPNK 66

Query: 66  APKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSIQALLASPNPNDPLANDV 125
            P V+FL++++HPN+   G ICLD+L+  W+P   + ++L SIQ+L   PNP  P AN  
Sbjct: 67  PPHVKFLSEMFHPNVYANGEICLDILQNRWTPTYDVASILTSIQSLFNDPNPASP-ANVE 125

Query: 126 AEDWIKNEQGAKAK 139
           A    K+ +    K
Sbjct: 126 AATLFKDHKSQYVK 139

>YGL058W (RAD6) [1921] chr7 (393990..394508) Ubiquitin conjugating
           (E2) enzyme involved in error-prone and error-free
           DNA-damage recovery pathways, in the N-end rule protein
           degradation pathway, mediates methylation of histone H3
           lysines 4 and 79 by ubiquitination of histone H2B [519
           bp, 172 aa]
          Length = 172

 Score =  108 bits (269), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 50/134 (37%), Positives = 81/134 (60%), Gaps = 1/134 (0%)

Query: 6   KRIIKETEKLVSDPVPGITAEPHDDNLRYFQVTIEGPEQSPYEDGIFELELYLPDDYPME 65
           +R++++ +++  D  PG++A P  DN+  +   I GP  +PYEDG F L L   ++YP +
Sbjct: 7   RRLMRDFKRMKEDAPPGVSASPLPDNVMVWNAMIIGPADTPYEDGTFRLLLEFDEEYPNK 66

Query: 66  APKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSIQALLASPNPNDPLANDV 125
            P V+FL++++HPN+   G ICLD+L+  W+P   + ++L SIQ+L   PNP  P AN  
Sbjct: 67  PPHVKFLSEMFHPNVYANGEICLDILQNRWTPTYDVASILTSIQSLFNDPNPASP-ANVE 125

Query: 126 AEDWIKNEQGAKAK 139
           A    K+ +    K
Sbjct: 126 AATLFKDHKSQYVK 139

>KLLA0C05632g complement(503484..503978) highly similar to sp|P06104
           Saccharomyces cerevisiae YGL058w RAD6 E2
           ubiquitin-conjugating enzyme, start by similarity
          Length = 164

 Score =  107 bits (267), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 74/115 (64%)

Query: 6   KRIIKETEKLVSDPVPGITAEPHDDNLRYFQVTIEGPEQSPYEDGIFELELYLPDDYPME 65
           +R++++ +++  D  PG++A P  DN+  +   I GP  +PYEDG F L L   ++YP +
Sbjct: 7   RRLMRDFKRMKEDSPPGVSASPLPDNVMIWNAMIIGPADTPYEDGTFRLLLEFDEEYPNK 66

Query: 66  APKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSIQALLASPNPNDP 120
            P V+FL++++HPN+   G ICLD+L+  W+P   + ++L SIQ+L   PNP  P
Sbjct: 67  PPHVKFLSEMFHPNVYANGEICLDILQNRWTPTYDVASILTSIQSLFNDPNPASP 121

>AEL045W [2461] [Homologous to ScYEL012W (UBC8) - SH]
           complement(549376..549380,549444..550074) [636 bp, 211
           aa]
          Length = 211

 Score =  107 bits (267), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 59/153 (38%), Positives = 90/153 (58%), Gaps = 5/153 (3%)

Query: 1   MASLPKRIIKETEKLVSDPVPGITAEPHDDNLRYFQVTIEGPEQSPYEDGIFELELYLPD 60
           M+S  +RI  +  KL+   +     E  DDN++ F V   GP+ +PYE G++ L + LPD
Sbjct: 1   MSSSKRRIETDVMKLL---MSDHDVELVDDNMQEFHVKFHGPKGTPYERGVWRLHVELPD 57

Query: 61  DYPMEAPKVRFLTKIYHPNIDRL-GRICLDVLKTNWSPALQIRTVL-LSIQALLASPNPN 118
           +YP ++P + F+ KI+HPNID   G ICLDV+ + WSP   +  ++   I  LL  PN +
Sbjct: 58  NYPYKSPSIGFVNKIFHPNIDAASGSICLDVINSTWSPLYDLLNIVEWMIPGLLKEPNGS 117

Query: 119 DPLANDVAEDWIKNEQGAKAKAREWTKLYAKKK 151
           DPL N+ A   +KN Q  + K +E+   YA ++
Sbjct: 118 DPLNNEAATLQLKNPQMYEEKIQEYIDKYATEE 150

>Kwal_14.1828
          Length = 152

 Score =  103 bits (257), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 50/122 (40%), Positives = 73/122 (59%), Gaps = 1/122 (0%)

Query: 18  DPVPGITAEPHDDNLRYFQVTIEGPEQSPYEDGIFELELYLPDDYPMEAPKVRFLTKIYH 77
           D  PG++A P  DN+  +   I GP ++PYEDG F L L   ++YP + P V+FL++I+H
Sbjct: 4   DAPPGVSASPLPDNVMVWNAMIIGPAETPYEDGTFRLLLEFDEEYPNKPPHVKFLSEIFH 63

Query: 78  PNIDRLGRICLDVLKTNWSPALQIRTVLLSIQALLASPNPNDPLANDVAEDWIKNEQGAK 137
           PN+   G ICLD+L+  W+P   + ++L SIQ+L   PNP  P AN  A    K+ +   
Sbjct: 64  PNVYANGEICLDILQNRWTPTYDVASILTSIQSLFNDPNPASP-ANVEAATLFKDHKSQY 122

Query: 138 AK 139
            K
Sbjct: 123 IK 124

>Sklu_2299.5 YGL058W, Contig c2299 10055-10519 reverse complement
          Length = 154

 Score =  102 bits (254), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 72/122 (59%), Gaps = 1/122 (0%)

Query: 18  DPVPGITAEPHDDNLRYFQVTIEGPEQSPYEDGIFELELYLPDDYPMEAPKVRFLTKIYH 77
           D  PG++A P  DN+  +   I GP  +PYEDG F L L   ++YP + P V+FL++++H
Sbjct: 4   DAPPGVSASPLPDNVMVWNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFLSEMFH 63

Query: 78  PNIDRLGRICLDVLKTNWSPALQIRTVLLSIQALLASPNPNDPLANDVAEDWIKNEQGAK 137
           PN+   G ICLD+L+  W+P   + ++L SIQ+L   PNP  P AN  A    K+ +   
Sbjct: 64  PNVYANGEICLDILQNRWTPTYDVASILTSIQSLFNDPNPASP-ANVEAATLFKDHKSQY 122

Query: 138 AK 139
            K
Sbjct: 123 VK 124

>Sklu_2410.4 YOR339C, Contig c2410 15549-16034
          Length = 161

 Score =  102 bits (253), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 86/138 (62%), Gaps = 1/138 (0%)

Query: 3   SLPKRIIKETEKLVSDPVPGITAEP-HDDNLRYFQVTIEGPEQSPYEDGIFELELYLPDD 61
           S+ KR+  E  +L+  P PG++A P ++D+L  +   I GP+ +PYE   F++ L  P  
Sbjct: 14  SVTKRLQSELVQLMMSPSPGLSAFPENEDDLTKWSGIITGPDGTPYEGLRFKISLQFPQS 73

Query: 62  YPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSIQALLASPNPNDPL 121
           YP  AP+V F++ ++HPN+D  G ICLD+LK  WS    ++T+LLS+Q+LL  PN + PL
Sbjct: 74  YPYTAPRVTFVSPMWHPNVDMSGNICLDILKDQWSAVYNVQTILLSLQSLLEEPNNSSPL 133

Query: 122 ANDVAEDWIKNEQGAKAK 139
               AE W KN +  K K
Sbjct: 134 NAVAAELWDKNMEEYKRK 151

>Kwal_34.16174
          Length = 213

 Score =  102 bits (253), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 50/125 (40%), Positives = 79/125 (63%), Gaps = 2/125 (1%)

Query: 29  DDNLRYFQVTIEGPEQSPYEDGIFELELYLPDDYPMEAPKVRFLTKIYHPNIDRL-GRIC 87
           +DN++ F V   GP ++PYE G++ L + LPD+YP ++P + F+ KI+HPNID   G IC
Sbjct: 14  NDNMQEFHVKFHGPRETPYEGGVWRLHVELPDNYPYKSPSIGFVNKIFHPNIDAASGSIC 73

Query: 88  LDVLKTNWSPALQIRTVL-LSIQALLASPNPNDPLANDVAEDWIKNEQGAKAKAREWTKL 146
           LDV+ + WSP   +  +L   I  LL  PN +DPL N+ A   +K+++  + K RE+   
Sbjct: 74  LDVINSAWSPLYDLLNILEWMIPGLLKEPNGSDPLNNEAATLQLKSKELYERKIREFIDQ 133

Query: 147 YAKKK 151
           +A ++
Sbjct: 134 FATEE 138

>CAGL0M03399g complement(389650..390294) highly similar to sp|P28263
           Saccharomyces cerevisiae YEL012w UBC8 E2
           ubiquitin-conjugating enzyme, hypothetical start
          Length = 214

 Score =  101 bits (252), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 49/125 (39%), Positives = 79/125 (63%), Gaps = 2/125 (1%)

Query: 29  DDNLRYFQVTIEGPEQSPYEDGIFELELYLPDDYPMEAPKVRFLTKIYHPNID-RLGRIC 87
           +D+++ F V   GP+ +PYE G++ L + LPD+YP ++P + F+ KI+HPNID   G IC
Sbjct: 27  EDSMQEFHVKFYGPKDTPYEGGVWRLHVELPDNYPYKSPSIGFVNKIFHPNIDIASGSIC 86

Query: 88  LDVLKTNWSPALQIRTVL-LSIQALLASPNPNDPLANDVAEDWIKNEQGAKAKAREWTKL 146
           LDV+ + WSP   +  ++   +  LL  PN +DPL N+ A   +K+++  + K RE+   
Sbjct: 87  LDVINSTWSPLYDLLNIVEWMLPGLLKEPNGSDPLNNEAANLQLKDKKVYEEKVREYIDK 146

Query: 147 YAKKK 151
           YA K+
Sbjct: 147 YATKE 151

>YEL012W (UBC8) [1413] chr5 (131772..131776,131900..132551)
           Ubiquitin-conjugating enzyme involved in the catabolite
           degradation of fructose-1,6-bisphosphate [657 bp, 218
           aa]
          Length = 218

 Score =  101 bits (251), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 56/153 (36%), Positives = 91/153 (59%), Gaps = 5/153 (3%)

Query: 1   MASLPKRIIKETEKLVSDPVPGITAEPHDDNLRYFQVTIEGPEQSPYEDGIFELELYLPD 60
           M+S  +RI  +  KL+   +     +  +D+++ F V   GP+ +PYE+G++ L + LPD
Sbjct: 1   MSSSKRRIETDVMKLL---MSDHQVDLINDSMQEFHVKFLGPKDTPYENGVWRLHVELPD 57

Query: 61  DYPMEAPKVRFLTKIYHPNID-RLGRICLDVLKTNWSPALQ-IRTVLLSIQALLASPNPN 118
           +YP ++P + F+ KI+HPNID   G ICLDV+ + WSP    I  V   I  LL  PN +
Sbjct: 58  NYPYKSPSIGFVNKIFHPNIDIASGSICLDVINSTWSPLYDLINIVEWMIPGLLKEPNGS 117

Query: 119 DPLANDVAEDWIKNEQGAKAKAREWTKLYAKKK 151
           DPL N+ A   +++++  + K +E+   YA K+
Sbjct: 118 DPLNNEAATLQLRDKKLYEEKIKEYIDKYATKE 150

>KLLA0A11198g
           join(complement(974525..974529),
           complement(973755..974358)) similar to sp|P28263
           Saccharomyces cerevisiae YEL012w UBC8 E2
           ubiquitin-conjugating enzyme, start by similarity
          Length = 202

 Score = 99.8 bits (247), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 48/125 (38%), Positives = 76/125 (60%), Gaps = 2/125 (1%)

Query: 29  DDNLRYFQVTIEGPEQSPYEDGIFELELYLPDDYPMEAPKVRFLTKIYHPNIDRL-GRIC 87
           +D ++ F +   GP+ +PYE G++ L + LPD+YP ++P + F+ KI+HPNID   G IC
Sbjct: 27  EDKMQEFHIKFHGPKDTPYEKGVWRLHVELPDNYPYKSPSIGFVNKIFHPNIDAASGSIC 86

Query: 88  LDVLKTNWSPALQIRTVL-LSIQALLASPNPNDPLANDVAEDWIKNEQGAKAKAREWTKL 146
           LDV+ + WSP   +  ++   I  LL  PN +DPL N+ A   +K++   + K  E+   
Sbjct: 87  LDVINSTWSPLYDLLNIVEWMIPGLLKEPNGSDPLNNEAATLQLKDKDMYEQKIHEYINK 146

Query: 147 YAKKK 151
           YA K+
Sbjct: 147 YATKE 151

>Kwal_26.7009
          Length = 161

 Score = 98.6 bits (244), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 88/148 (59%), Gaps = 7/148 (4%)

Query: 3   SLPKRIIKETEKLVSDPVPGITAEPH-DDNLRYFQVTIEGPEQSPYEDGIFELELYLPDD 61
           S+ KR+  E  +L+  P PG++A P  +D+L  +   I GP+ +PYE   F++ L     
Sbjct: 14  SVTKRLQSELVQLMMSPSPGLSAFPESEDDLTKWCGIITGPDGTPYEGLRFKIALEFAQT 73

Query: 62  YPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSIQALLASPNPNDPL 121
           YP  APKVRF++ ++HPN+D  G ICLD+LK  WS    ++T+LLS+Q+LL  PN + PL
Sbjct: 74  YPYTAPKVRFVSPMWHPNVDMSGNICLDILKDQWSAVYNVQTILLSLQSLLEEPNNSSPL 133

Query: 122 ANDVAEDWIKNEQGAKAKAREWTKLYAK 149
               AE W  + Q  K       KLYA+
Sbjct: 134 NAVAAELWDTDMQEYKK------KLYAR 155

>AER056C [2561] [Homologous to ScYDL064W (UBC9) - SH]
           (741224..741659,741718..741755) [474 bp, 157 aa]
          Length = 157

 Score = 95.5 bits (236), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 53/151 (35%), Positives = 82/151 (54%), Gaps = 7/151 (4%)

Query: 6   KRIIKETEKLVSDPVPGITAEPHDD-----NLRYFQVTIEGPEQSPYEDGIFELELYLPD 60
           +R+ +E +K   D   G  A+P        NL+ ++  I G E + ++DG++ + +  PD
Sbjct: 7   QRLQEERKKWRKDHPFGFWAKPTKKEDGSMNLQKWEAGIPGREGTIWKDGVYPITIEYPD 66

Query: 61  DYPMEAPKVRFLTKIYHPNIDRLGRICLDVLK--TNWSPALQIRTVLLSIQALLASPNPN 118
           DYP + P+V+F    YHPNI   G +CL +L    +W PA+ ++ +LL +Q LL SPNPN
Sbjct: 67  DYPSKPPRVKFPAGFYHPNIYPSGTVCLSILNEDQDWKPAITMKQILLGVQDLLTSPNPN 126

Query: 119 DPLANDVAEDWIKNEQGAKAKAREWTKLYAK 149
            P        + KN Q  + K  E  + YAK
Sbjct: 127 SPAQEPAWRAYAKNLQEYEKKVLEQARRYAK 157

>Scas_694.33
          Length = 231

 Score = 97.1 bits (240), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 46/125 (36%), Positives = 79/125 (63%), Gaps = 2/125 (1%)

Query: 29  DDNLRYFQVTIEGPEQSPYEDGIFELELYLPDDYPMEAPKVRFLTKIYHPNID-RLGRIC 87
           +++++ F +   GP+ +PYE G++ L + LPD+YP ++P + F+ KI+HPNID   G IC
Sbjct: 49  NNSMQEFHIKFHGPKDTPYEKGVWRLHVELPDNYPYKSPSIGFVNKIFHPNIDIASGSIC 108

Query: 88  LDVLKTNWSPALQIRTVL-LSIQALLASPNPNDPLANDVAEDWIKNEQGAKAKAREWTKL 146
           LDV+ + WSP   +  ++   I  LL  PN +DPL N+ A   +++++  + K RE+   
Sbjct: 109 LDVINSTWSPLYDLLNIVEWMIPGLLKEPNGSDPLNNEAATLELRDKKLYEEKIREYIDK 168

Query: 147 YAKKK 151
           YA ++
Sbjct: 169 YATEE 173

>CAGL0M07568g complement(758110..758607) highly similar to sp|Q02159
           Saccharomyces cerevisiae YMR022w E2
           ubiquitin-conjugation enzyme, start by similarity
          Length = 165

 Score = 94.7 bits (234), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 47/125 (37%), Positives = 68/125 (54%), Gaps = 14/125 (11%)

Query: 6   KRIIKETEKLVSDPVPGITAEP-HDDNLRYFQVTIEGPEQSPYEDGIFELELYLPDDYPM 64
           KR+ KE ++L+ D  PGI A P  DDNL  +   I+GP  +PY  G+F  +L  P DYP+
Sbjct: 7   KRLYKELQQLIKDSPPGIVAGPKSDDNLFVWDCLIQGPPDTPYAGGVFNAQLEFPKDYPL 66

Query: 65  EAPKVRFLTKIYHPNIDRLGRICLDVLKT-------------NWSPALQIRTVLLSIQAL 111
             PK+ F   I HPNI   G +C+ +L +              WSP   +  +LLS+ ++
Sbjct: 67  SPPKLTFTPSILHPNIYPNGEVCISILHSPGDDPNMYESAEERWSPVQSVEKILLSVMSM 126

Query: 112 LASPN 116
           L+ PN
Sbjct: 127 LSEPN 131

>YMR022W (QRI8) [3986] chr13 (318679..319176) Ubiquitin-conjugating
           enzyme, associates with Ubc6p on the cytoplasmic side of
           endoplasmic reticulum [498 bp, 165 aa]
          Length = 165

 Score = 93.2 bits (230), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 45/125 (36%), Positives = 70/125 (56%), Gaps = 14/125 (11%)

Query: 6   KRIIKETEKLVSDPVPGITAEP-HDDNLRYFQVTIEGPEQSPYEDGIFELELYLPDDYPM 64
           KR++KE ++L+ D  PGI A P  ++N+  +   I+GP  +PY DG+F  +L  P DYP+
Sbjct: 7   KRLLKELQQLIKDSPPGIVAGPKSENNIFIWDCLIQGPPDTPYADGVFNAKLEFPKDYPL 66

Query: 65  EAPKVRFLTKIYHPNIDRLGRICLDVLKT-------------NWSPALQIRTVLLSIQAL 111
             PK+ F   I HPNI   G +C+ +L +              WSP   +  +LLS+ ++
Sbjct: 67  SPPKLTFTPSILHPNIYPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKILLSVMSM 126

Query: 112 LASPN 116
           L+ PN
Sbjct: 127 LSEPN 131

>ABR059W [650] [Homologous to ScYMR022W (QRI8) - SH]
           complement(503223..503720) [498 bp, 165 aa]
          Length = 165

 Score = 93.2 bits (230), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 51/154 (33%), Positives = 75/154 (48%), Gaps = 14/154 (9%)

Query: 6   KRIIKETEKLVSDPVPGITAEP-HDDNLRYFQVTIEGPEQSPYEDGIFELELYLPDDYPM 64
           KR++KE ++L+ D   GI A P  +DNL  +   IEGP  SPYE G+F   L  P DYP+
Sbjct: 7   KRLMKELQQLLRDSPDGIVAGPVSEDNLFLWDCLIEGPADSPYEGGVFNARLQFPRDYPL 66

Query: 65  EAPKVRFLTKIYHPNIDRLGRICLDVLKT-------------NWSPALQIRTVLLSIQAL 111
             PK+ F   I HPN+   G +C+ +L                WSP   +  +LLS+ ++
Sbjct: 67  SPPKLTFTPSILHPNVYPNGEVCISILHAPGEDPNMYEEASERWSPVQSVEKILLSVMSM 126

Query: 112 LASPNPNDPLANDVAEDWIKNEQGAKAKAREWTK 145
           L+ PN       D    W  N    + + +E  +
Sbjct: 127 LSEPNVESGANIDACILWRDNRADFERQVQESVR 160

>Scas_709.49
          Length = 165

 Score = 91.3 bits (225), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 49/151 (32%), Positives = 76/151 (50%), Gaps = 14/151 (9%)

Query: 6   KRIIKETEKLVSDPVPGITAEP-HDDNLRYFQVTIEGPEQSPYEDGIFELELYLPDDYPM 64
           +R++KE ++L  D  PGI A P +++NL  +   ++GP  + YE GIF   L  P DYP+
Sbjct: 7   RRLLKELQQLTKDSPPGIVACPKNENNLFIWDCLVQGPPDTAYEGGIFNARLEFPKDYPL 66

Query: 65  EAPKVRFLTKIYHPNIDRLGRICLDVLKT-------------NWSPALQIRTVLLSIQAL 111
             PK+ F   I HPNI   G +C+ +L +              WSP   I  +LLS+ ++
Sbjct: 67  SPPKLTFTPSILHPNIYPNGEVCISILHSPGDDPNMYELAEERWSPVQSIEKILLSVMSM 126

Query: 112 LASPNPNDPLANDVAEDWIKNEQGAKAKARE 142
           L+ PN       D    W  N +  + + R+
Sbjct: 127 LSEPNIESGANIDACILWRDNREEFERQVRQ 157

>Scas_621.4
          Length = 193

 Score = 91.3 bits (225), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 41/111 (36%), Positives = 65/111 (58%)

Query: 38  TIEGPEQSPYEDGIFELELYLPDDYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTNWSP 97
            I  P++  Y++G F   L   D+YPME PKV    +IYHPNID  G++CL++L+ +WSP
Sbjct: 73  VIISPDEGYYKNGHFRFSLEFNDNYPMEPPKVVCRNRIYHPNIDVQGKVCLNILREDWSP 132

Query: 98  ALQIRTVLLSIQALLASPNPNDPLANDVAEDWIKNEQGAKAKAREWTKLYA 148
           AL ++++++ +  L   PN  DPL  D A  + K+        R+  + Y+
Sbjct: 133 ALDLQSIIVGLLFLFLEPNAKDPLNTDAAAVFSKDSNAFAKFVRKTMEGYS 183

>CAGL0D00814g 98589..99062 highly similar to sp|P50623 Saccharomyces
           cerevisiae YDL064w UBC9 E2 ubiquitin-conjugating enzyme,
           start by similarity
          Length = 157

 Score = 89.7 bits (221), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 54/157 (34%), Positives = 87/157 (55%), Gaps = 12/157 (7%)

Query: 1   MASLP-KRIIKETEKLVSDPVPGITAEPHDD-----NLRYFQVTIEGPEQSPYEDGIFEL 54
           M+SL  +R+ +E +K   D   G  A+P        NL+ ++  I G E + ++DG+F +
Sbjct: 1   MSSLCLQRLQEERKKWRKDHPFGFYAKPTKGPDGTLNLQKWEAGIPGKEGTIWQDGVFPI 60

Query: 55  ELYLPDDYPMEAPKVRFLTKIYHPNIDRLGRICLDVLK--TNWSPALQIRTVLLSIQALL 112
            +  PD+YP + PKV+F    YHPNI   G +CL +L    +W PA+ ++ ++L +Q LL
Sbjct: 61  TVEYPDEYPSKPPKVKFPAGFYHPNIYPSGTVCLSILNEDQDWRPAITLKQIVLGVQDLL 120

Query: 113 ASPNPNDPLANDVAEDWIKN----EQGAKAKAREWTK 145
            SPNPN P        + KN    E+    +A+++TK
Sbjct: 121 DSPNPNSPAQEPAWRAFSKNKAEYEKKVLIQAKQYTK 157

>Kwal_26.8224
          Length = 165

 Score = 89.4 bits (220), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 46/125 (36%), Positives = 66/125 (52%), Gaps = 14/125 (11%)

Query: 6   KRIIKETEKLVSDPVPGITAEP-HDDNLRYFQVTIEGPEQSPYEDGIFELELYLPDDYPM 64
           KR+ KE ++L+ D   GI A P  +DNL  +   I GP  SPY+ G+F   L  P DYP+
Sbjct: 7   KRLFKELQQLLKDSPEGIVAGPKSEDNLFVWDCLISGPPDSPYQGGVFNATLEFPKDYPL 66

Query: 65  EAPKVRFLTKIYHPNIDRLGRICLDVLKT-------------NWSPALQIRTVLLSIQAL 111
             PK+ F   I HPNI   G +C+ +L +              WSP   +  +LLS+ ++
Sbjct: 67  SPPKLLFTPSILHPNIYPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKILLSVMSM 126

Query: 112 LASPN 116
           L+ PN
Sbjct: 127 LSEPN 131

>Kwal_23.4227
          Length = 122

 Score = 87.8 bits (216), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 68/121 (56%), Gaps = 2/121 (1%)

Query: 31  NLRYFQVTIEGPEQSPYEDGIFELELYLPDDYPMEAPKVRFLTKIYHPNIDRLGRICLDV 90
           NL+ ++  I G E + +++G+F + +  PDDYP + PKV+F    YHPNI   G +CL +
Sbjct: 2   NLQKWEAGIPGKEGTIWKEGVFPITIEYPDDYPSKPPKVKFPAGFYHPNIYPSGTVCLSI 61

Query: 91  LK--TNWSPALQIRTVLLSIQALLASPNPNDPLANDVAEDWIKNEQGAKAKAREWTKLYA 148
           L    +W PA+ ++ + L +Q LL SPNPN P        + KN +  + K  E  K Y 
Sbjct: 62  LNEDQDWRPAITLKQIALGVQDLLDSPNPNSPAQEPAWRAFSKNVKEYERKVIEQAKKYT 121

Query: 149 K 149
           K
Sbjct: 122 K 122

>KLLA0E07711g complement(693694..694191) highly similar to sp|Q02159
           Saccharomyces cerevisiae YMR022w QRI8 E2
           ubiquitin-conjugation enzyme, start by similarity
          Length = 165

 Score = 89.0 bits (219), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 49/125 (39%), Positives = 65/125 (52%), Gaps = 14/125 (11%)

Query: 6   KRIIKETEKLVSDPVPGITAEPHDD-NLRYFQVTIEGPEQSPYEDGIFELELYLPDDYPM 64
           KR++KE EKL  D   GI A P DD NL  +   I GP  S YE G+F   L  P DYP+
Sbjct: 7   KRLLKELEKLTKDSPEGILASPIDDSNLFQWDCLIMGPPDSCYEGGVFNARLDFPKDYPL 66

Query: 65  EAPKVRFLTKIYHPNIDRLGRICLDVLKT-------------NWSPALQIRTVLLSIQAL 111
             PK+ F   I HPNI   G +C+ +L +              WSP   +  +LLS+ ++
Sbjct: 67  NPPKLTFQPSILHPNIYPNGEVCISILHSPGSDPNMYEHECERWSPVQSVEMILLSVMSI 126

Query: 112 LASPN 116
           L+ PN
Sbjct: 127 LSEPN 131

>KLLA0E04983g 443446..443919 highly similar to sp|P50623
           Saccharomyces cerevisiae YDL064w UBC9 E2
           ubiquitin-conjugating enzyme, start by similarity
          Length = 157

 Score = 87.0 bits (214), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 54/157 (34%), Positives = 84/157 (53%), Gaps = 8/157 (5%)

Query: 1   MASLP-KRIIKETEKLVSDPVPGITAEPHDD-----NLRYFQVTIEGPEQSPYEDGIFEL 54
           M+SL  +R+ +E +K   D   G  A+P        NL+ ++  I G + + +++G++ L
Sbjct: 1   MSSLCLQRLQEERKKWRKDHPYGFFAKPTKKTDGSMNLQKWEAGIPGRDGTLWKNGLYPL 60

Query: 55  ELYLPDDYPMEAPKVRFLTKIYHPNIDRLGRICLDVLK--TNWSPALQIRTVLLSIQALL 112
            +  PDDYP + PKV+F    YHPN+   G ICL +L    +W PA+ ++ +LL +Q LL
Sbjct: 61  TIEYPDDYPSKPPKVKFPAGFYHPNVYPSGTICLSILNEDQDWRPAITLKQLLLGVQDLL 120

Query: 113 ASPNPNDPLANDVAEDWIKNEQGAKAKAREWTKLYAK 149
            SPNPN P        + KN +  + K  E    Y K
Sbjct: 121 DSPNPNSPAQEPAWRAFSKNIKEYERKVSEQALRYTK 157

>Sklu_2411.7 YMR022W, Contig c2411 14633-15334 reverse complement
          Length = 233

 Score = 88.6 bits (218), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 49/141 (34%), Positives = 69/141 (48%), Gaps = 14/141 (9%)

Query: 6   KRIIKETEKLVSDPVPGITAEP-HDDNLRYFQVTIEGPEQSPYEDGIFELELYLPDDYPM 64
           KR++KE ++L  D   GI A P  +DNL  +   I GP  SPYE G+F   L  P DYP+
Sbjct: 75  KRLLKELQQLARDSPEGIVAGPKSEDNLFLWDCLITGPPDSPYEGGVFNAMLEFPKDYPL 134

Query: 65  EAPKVRFLTKIYHPNIDRLGRICLDVLKT-------------NWSPALQIRTVLLSIQAL 111
             P++ F   I HPNI   G +C+ +L +              WSP   +  +LLS+ ++
Sbjct: 135 SPPRLTFTPSILHPNIYPNGEVCISILHSPGEDPNMYELAEERWSPVQSVEKILLSVTSM 194

Query: 112 LASPNPNDPLANDVAEDWIKN 132
           L+ PN       D    W  N
Sbjct: 195 LSEPNVESGANIDACILWRDN 215

>KLLA0C17248g complement(1509885..1510439) similar to sp|P52491
           Saccharomyces cerevisiae YLR306w UBC12 E2
           ubiquitin-conjugating enzyme, start by similarity
          Length = 184

 Score = 84.3 bits (207), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 36/91 (39%), Positives = 58/91 (63%)

Query: 42  PEQSPYEDGIFELELYLPDDYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQI 101
           P+   Y  G +   +++ D YPME P V+ + +IYHPNID  G +CL++L+ +W+PAL I
Sbjct: 67  PDIGYYAGGTYYFNVFIKDTYPMEPPVVKCMHRIYHPNIDIDGNVCLNLLREDWTPALDI 126

Query: 102 RTVLLSIQALLASPNPNDPLANDVAEDWIKN 132
           +++++ I  L   PN  DPL  D A+  I++
Sbjct: 127 QSIIIGILFLFHEPNGRDPLNKDAAKTLIED 157

>YLR306W (UBC12) [3694] chr12 (744153..744155,744290..744853)
           Rub1p-conjugating enzyme, with similarity to ubiquitin-
           and ubiquitin-like protein-conjugating enzymes [567 bp,
           188 aa]
          Length = 188

 Score = 83.2 bits (204), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 58/97 (59%)

Query: 38  TIEGPEQSPYEDGIFELELYLPDDYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTNWSP 97
            I  P++  Y  G     L   + YP+E PKV  L KI+HPNID  G +CL++L+ +WSP
Sbjct: 66  VIVRPDEGYYNYGSINFNLDFNEVYPIEPPKVVCLKKIFHPNIDLKGNVCLNILREDWSP 125

Query: 98  ALQIRTVLLSIQALLASPNPNDPLANDVAEDWIKNEQ 134
           AL +++++  +  L   PNPNDPL  D A+   + E+
Sbjct: 126 ALDLQSIITGLLFLFLEPNPNDPLNKDAAKLLCEGEK 162

>CAGL0D06468g 615364..615927 similar to sp|P52491 Saccharomyces
           cerevisiae YLR306w UBC12 E2 ubiquitin-conjugating
           enzyme, start by similarity
          Length = 187

 Score = 82.4 bits (202), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 43/121 (35%), Positives = 68/121 (56%)

Query: 7   RIIKETEKLVSDPVPGITAEPHDDNLRYFQVTIEGPEQSPYEDGIFELELYLPDDYPMEA 66
           R+ K+ E+L   P   +     D++       I  P++  Y+ G F       + YP++ 
Sbjct: 36  RLQKDIEELELPPTVRVNIISLDNHKEMSLNIIIIPDEGFYKGGKFRFTATFLETYPIDP 95

Query: 67  PKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSIQALLASPNPNDPLANDVA 126
           PKV    KI+HPNID  G+ICL++L+ +WSPAL ++ ++L + +L   PN NDPL  + A
Sbjct: 96  PKVICNNKIFHPNIDPHGKICLNILREDWSPALDLQCIVLGLLSLFQEPNGNDPLNKEAA 155

Query: 127 E 127
           E
Sbjct: 156 E 156

>YDL064W (UBC9) [802] chr4 (337487..337524,337635..338070)
           Smt3p-conjugating enzyme required for G2/M transition,
           conjugates Smt3p to Pol30p (PCNA) in S phase, which may
           be antagonistic to non-proteolytic ubiquitination of
           Pol30p in the Rad6-dependent DNA repair pathway [474 bp,
           157 aa]
          Length = 157

 Score = 81.3 bits (199), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 49/157 (31%), Positives = 82/157 (52%), Gaps = 8/157 (5%)

Query: 1   MASLP-KRIIKETEKLVSDPVPGITAEP-----HDDNLRYFQVTIEGPEQSPYEDGIFEL 54
           M+SL  +R+ +E +K   D   G  A+P        +L+ ++  I G E + +  G++ +
Sbjct: 1   MSSLCLQRLQEERKKWRKDHPFGFYAKPVKKADGSMDLQKWEAGIPGKEGTNWAGGVYPI 60

Query: 55  ELYLPDDYPMEAPKVRFLTKIYHPNIDRLGRICLDVLK--TNWSPALQIRTVLLSIQALL 112
            +  P++YP + PKV+F    YHPN+   G ICL +L    +W PA+ ++ ++L +Q LL
Sbjct: 61  TVEYPNEYPSKPPKVKFPAGFYHPNVYPSGTICLSILNEDQDWRPAITLKQIVLGVQDLL 120

Query: 113 ASPNPNDPLANDVAEDWIKNEQGAKAKAREWTKLYAK 149
            SPNPN P        + +N+     K     K Y+K
Sbjct: 121 DSPNPNSPAQEPAWRSFSRNKAEYDKKVLLQAKQYSK 157

>YDR054C (CDC34) [905] chr4 complement(561436..562323)
           Ubiquitin-conjugating enzyme (E2); component of the SCF
           (Skp1p-Cdc53p-F-box) complexes which act with various
           F-box proteins to direct target proteins into the
           ubiquitin-dependent degradation pathway [888 bp, 295 aa]
          Length = 295

 Score = 81.3 bits (199), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 59/111 (53%), Gaps = 12/111 (10%)

Query: 43  EQSPYEDGIFELELYLPDDYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTN-------- 94
           E S Y  G F+ ++  P+D+P   P+ RF   IYHPN+ R GR+C+ +L  +        
Sbjct: 51  EDSIYHGGFFKAQMRFPEDFPFSPPQFRFTPAIYHPNVYRDGRLCISILHQSGDPMTDEP 110

Query: 95  ----WSPALQIRTVLLSIQALLASPNPNDPLANDVAEDWIKNEQGAKAKAR 141
               WSP   + +VL+SI +LL  PN N P   D A D+ KN +  K + +
Sbjct: 111 DAETWSPVQTVESVLISIVSLLEDPNINSPANVDAAVDYRKNPEQYKQRVK 161

>ADL035C [1707] [Homologous to ScYLR306W (UBC12) - SH]
           (634059..634610,634663..634713) [603 bp, 200 aa]
          Length = 200

 Score = 79.3 bits (194), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 40/103 (38%), Positives = 61/103 (59%), Gaps = 3/103 (2%)

Query: 30  DNLRYFQVTIEGPEQSPYEDGIFELELYLPDDYPMEAPKVRFLTKIYHPNIDRLGRICLD 89
           +N  Y +++   PE+  Y  G F   +   D YP+E P V+ L  IYHPNID  G ICL+
Sbjct: 74  ENKVYLRIS---PEEGVYRGGHFRFSVVFRDTYPIEPPTVKCLNTIYHPNIDYSGNICLN 130

Query: 90  VLKTNWSPALQIRTVLLSIQALLASPNPNDPLANDVAEDWIKN 132
           VL+ +WSP + ++TV+L +  L   PN +DPL    A+  +++
Sbjct: 131 VLREDWSPVMDLQTVVLGLLFLFLEPNGSDPLNRQAADTMLRD 173

>KLLA0D09196g 772795..773673 similar to sp|P14682 Saccharomyces
           cerevisiae YDR054c CDC34 E2 ubiquitin-conjugating
           enzyme, start by similarity
          Length = 292

 Score = 80.5 bits (197), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 41/111 (36%), Positives = 58/111 (52%), Gaps = 12/111 (10%)

Query: 43  EQSPYEDGIFELELYLPDDYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTN-------- 94
           E+S Y  G F+ ++  PDD+P   P  RF   IYHPN+ R GR+C+ +L  +        
Sbjct: 50  EESIYHGGYFKAQMKFPDDFPFSPPTFRFTPAIYHPNVYRDGRLCISILHQSGNPTSDEP 109

Query: 95  ----WSPALQIRTVLLSIQALLASPNPNDPLANDVAEDWIKNEQGAKAKAR 141
               WSP   + +VL+SI +LL  PN + P   D A D+ KN    K K +
Sbjct: 110 DEETWSPVQTVESVLISIVSLLEDPNISSPANVDAAVDYKKNPDQYKQKVK 160

>CAGL0E04598g complement(444288..445175) highly similar to sp|P14682
           Saccharomyces cerevisiae YDR054c CDC34 E2
           ubiquitin-conjugating enzyme, start by similarity
          Length = 295

 Score = 80.1 bits (196), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 59/111 (53%), Gaps = 12/111 (10%)

Query: 43  EQSPYEDGIFELELYLPDDYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTN-------- 94
           E S Y  G F+ ++  PDD+P   P+ RF   IYHPN+ R GR+C+ +L  +        
Sbjct: 51  EDSIYHGGYFKAQMRFPDDFPFSPPQFRFTPAIYHPNVYRDGRLCISILHQSGDPMTDEP 110

Query: 95  ----WSPALQIRTVLLSIQALLASPNPNDPLANDVAEDWIKNEQGAKAKAR 141
               WSP   + +VL+SI +LL  PN + P   D A D+ KN +  K + +
Sbjct: 111 DAETWSPVQTVESVLISIVSLLEDPNISSPANVDAAVDFRKNPEQYKQRVK 161

>Sklu_1826.3 YGR133W, Contig c1826 3548-4033
          Length = 161

 Score = 77.4 bits (189), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 43/108 (39%), Positives = 63/108 (58%), Gaps = 7/108 (6%)

Query: 26  EPHD-DNLRYFQVTIEGPEQSPYEDGIFELELYLPDDYPMEAPKVRFL----TKIYHPNI 80
           EP D  N+ ++   I GP ++PY   +F L++ LP  YP+E P+V+FL      I H N+
Sbjct: 30  EPKDTGNMYHWIADISGPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNV 89

Query: 81  D-RLGRICLDVL-KTNWSPALQIRTVLLSIQALLASPNPNDPLANDVA 126
           D + G ICLD+L + +WSP   +  V+ +I  LL  P P  PL  D+A
Sbjct: 90  DFKTGEICLDILTREHWSPVWDLVHVIHAIWILLGEPVPESPLNVDIA 137

>Scas_635.18
          Length = 273

 Score = 79.0 bits (193), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 58/111 (52%), Gaps = 12/111 (10%)

Query: 43  EQSPYEDGIFELELYLPDDYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTN-------- 94
           E S Y  G F+ ++  P+D+P   P+ RF   IYHPN+ R GR+C+ +L           
Sbjct: 51  EDSIYHGGYFKAQMRFPEDFPFSPPQFRFTPAIYHPNVYRDGRLCISILHQGGDPMTDEP 110

Query: 95  ----WSPALQIRTVLLSIQALLASPNPNDPLANDVAEDWIKNEQGAKAKAR 141
               WSP   + +VL+SI +LL  PN + P   D A D+ KN +  K + +
Sbjct: 111 DAETWSPVQTVESVLISIVSLLEDPNISSPANVDAAVDYRKNPEQYKQRVK 161

>Kwal_27.10444
          Length = 278

 Score = 79.0 bits (193), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 55/102 (53%), Gaps = 12/102 (11%)

Query: 43  EQSPYEDGIFELELYLPDDYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTN-------- 94
           E S Y  G F+ ++  P+D+P   P  RF   IYHPN+ R GR+C+ +L T+        
Sbjct: 51  EDSIYHGGYFKAQMRFPEDFPFSPPTFRFTPAIYHPNVYRDGRLCISILHTSGDPTSEEP 110

Query: 95  ----WSPALQIRTVLLSIQALLASPNPNDPLANDVAEDWIKN 132
               WSP   + +VL+SI +LL  PN + P   D A D+ KN
Sbjct: 111 DSETWSPVQTVESVLISIVSLLEDPNISSPANVDAAVDYRKN 152

>AGL203C [4109] [Homologous to ScYDR054C (CDC34) - SH]
           (317749..318561) [813 bp, 270 aa]
          Length = 270

 Score = 78.2 bits (191), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 58/111 (52%), Gaps = 12/111 (10%)

Query: 43  EQSPYEDGIFELELYLPDDYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTN-------- 94
           E S Y  G F+ ++  P+D+P   P  RF   IYHPN+ R GR+C+ +L  +        
Sbjct: 51  EDSIYHGGYFKAQMRFPEDFPFSPPSFRFTPAIYHPNVYRDGRLCISILHQSGDPTSDEP 110

Query: 95  ----WSPALQIRTVLLSIQALLASPNPNDPLANDVAEDWIKNEQGAKAKAR 141
               WSP   + +VL+SI +LL  PN + P   D A D+ KN +  K + +
Sbjct: 111 DSETWSPVQTVESVLISIVSLLEDPNISSPANVDAAVDYRKNPEQYKQRVK 161

>Kwal_55.21246
          Length = 160

 Score = 75.9 bits (185), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 41/101 (40%), Positives = 63/101 (62%), Gaps = 3/101 (2%)

Query: 29  DDNLRYFQVTIEGPEQSPYEDGIFELELYLPDDYPMEAPKVRFLTKIY-HPNID-RLGRI 86
           DDNL  ++  I GP  +PY+   F L + +P  YP+E PKV+F  +   H N+D   GRI
Sbjct: 33  DDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRI 92

Query: 87  CLDVL-KTNWSPALQIRTVLLSIQALLASPNPNDPLANDVA 126
           C+++L + +WSPA  +  ++ +I  LLA+P P+ PL  D+A
Sbjct: 93  CINLLERAHWSPAWDLLHLVHAIWLLLANPEPDSPLDVDLA 133

>Sklu_2136.5 YDR054C, Contig c2136 7737-8555
          Length = 272

 Score = 77.4 bits (189), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 57/111 (51%), Gaps = 12/111 (10%)

Query: 43  EQSPYEDGIFELELYLPDDYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTN-------- 94
           E S Y  G F+ ++  P+D+P   P  RF   IYHPN+ R GR+C+ +L  +        
Sbjct: 51  EDSIYHGGYFKAQMKFPEDFPFSPPNFRFTPAIYHPNVYRDGRLCISILHQSGDPTSDEP 110

Query: 95  ----WSPALQIRTVLLSIQALLASPNPNDPLANDVAEDWIKNEQGAKAKAR 141
               WSP   + +VL+SI +LL  PN + P   D A D+ KN +  K +  
Sbjct: 111 DSETWSPVQTVESVLISIVSLLEDPNISSPANVDAAVDYRKNPEQYKQRVH 161

>Scas_712.59
          Length = 171

 Score = 73.2 bits (178), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 79/151 (52%), Gaps = 20/151 (13%)

Query: 6   KRIIKETEKLVSDPVPGITAEPHDDN-----------------LRYFQVTIEGPEQSPYE 48
            R++KE +K+ +   P  T   ++D+                 L ++Q  I+GP+ +PY 
Sbjct: 2   SRLLKEYKKIQTTLSPNSTHHNNNDDDEFNQIITYLHPISTSDLTHWQAQIKGPQGTPYA 61

Query: 49  DGIFELELYLPDDYPMEAPKVRFL-TKIYHPNID-RLGRICLDVL-KTNWSPALQIRTVL 105
           +  F+L++  P  YP+E P + F    + H N++ + G ICLD+L K +W+PA  + T +
Sbjct: 62  NHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDILEKQHWTPAWNLMTTM 121

Query: 106 LSIQALLASPNPNDPLANDVAEDWIKNEQGA 136
            +I  LL  P P+ PL  D+A     N+Q A
Sbjct: 122 KAIWILLKDPVPDSPLNVDIANILRVNDQSA 152

>AGR372W [4683] [Homologous to ScYER100W (UBC6) - SH]
           complement(1419828..1420556) [729 bp, 242 aa]
          Length = 242

 Score = 72.4 bits (176), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 44/145 (30%), Positives = 71/145 (48%), Gaps = 11/145 (7%)

Query: 6   KRIIKETEKLVSDPVPGITAEPHDDNLRYFQVTIEGPEQSPYEDGIFELELYLPDDYPME 65
           KR+ KE + +  +P P I A P +DN+  +   I GP ++PYEDG +   L  P+DYP  
Sbjct: 8   KRLSKEYKMMTENPPPYIVAAPKEDNILVWHYVITGPPETPYEDGQYHGTLVFPNDYPFN 67

Query: 66  APKVRFLTKIYHPN--IDRLGRICL---DVLKTNWSPALQIRTVLLSIQALLASPNPNDP 120
            P +R LT    PN       R+CL   D     W+P+  + T+L  + + + +   +  
Sbjct: 68  PPAIRMLT----PNGRFRENTRLCLSMSDYHPDTWNPSWSVATILTGLLSFMTTDESS-- 121

Query: 121 LANDVAEDWIKNEQGAKAKAREWTK 145
           +    + D  K +  AK+K    T+
Sbjct: 122 IGTMESTDSTKRKYAAKSKEHNATR 146

>KLLA0E20493g 1814618..1815373 similar to sp|P33296 Saccharomyces
           cerevisiae YER100w UBC6 E2 ubiquitin-conjugating enzyme,
           start by similarity
          Length = 251

 Score = 72.0 bits (175), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 42/121 (34%), Positives = 63/121 (52%), Gaps = 11/121 (9%)

Query: 1   MASLP--KRIIKETEKLVSDPVPGITAEPHDDNLRYFQVTIEGPEQSPYEDGIFELELYL 58
           MAS+   KR+ KE + +V++P P I A PH+DN+  +   I GP  +PYE+G +   L  
Sbjct: 1   MASIQANKRLTKEYKNIVNNPPPFIIAAPHEDNILEWHYVITGPPSTPYENGQYHGTLTF 60

Query: 59  PDDYPMEAPKVRFLTKIYHPN--IDRLGRICL---DVLKTNWSPALQIRTVLLSIQALLA 113
           P DYP   P +R +T    PN       R+CL   D     W+PA  + T+L  + + + 
Sbjct: 61  PSDYPFNPPAIRMIT----PNGRFKENTRLCLSMSDYHPEAWNPAWSVVTILNGLLSFMT 116

Query: 114 S 114
            
Sbjct: 117 G 117

>Scas_718.34
          Length = 258

 Score = 71.6 bits (174), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 56/108 (51%), Gaps = 12/108 (11%)

Query: 45  SPYEDGIFELELYLPDDYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTN---------- 94
           S Y  G F+ ++  P D+P   P+ +F+  IYHPN+ R G++C+ +L  +          
Sbjct: 60  SIYHGGYFQSQMKFPKDFPFSPPQFKFIPPIYHPNVYRDGKLCISILHQSGDAMTSEPDN 119

Query: 95  --WSPALQIRTVLLSIQALLASPNPNDPLANDVAEDWIKNEQGAKAKA 140
             WSP   + +VL+SI +LL  PN + P   D A ++ KN    K K 
Sbjct: 120 ETWSPVQSVESVLISIVSLLEDPNVSSPANVDAAVEYRKNYNEYKKKV 167

>CAGL0I10450g complement(1024541..1025029) similar to sp|P29340
           Saccharomyces cerevisiae YGR133w ubiquitin-conjugating
           enzyme - peroxin, hypothetical start
          Length = 162

 Score = 67.8 bits (164), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 42/117 (35%), Positives = 61/117 (52%), Gaps = 9/117 (7%)

Query: 29  DDNLRYFQVTIEGPEQSPYEDGIFELELYLPDDYPMEAPKVRFLTKIY-------HPNID 81
           D +L  +   I+GP ++PY    F+L + +P  YPM  P ++F++          H N+D
Sbjct: 31  DSDLSRWFAVIKGPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVPPHCNVD 90

Query: 82  -RLGRICLDVLK-TNWSPALQIRTVLLSIQALLASPNPNDPLANDVAEDWIKNEQGA 136
            R G ICLD+LK   WSP   I  V+ +I  LL  P P+ PL  D+A     N+  A
Sbjct: 91  RRTGEICLDILKPEGWSPIWDILHVVQAIHILLQEPVPDSPLDVDMANILKNNDMSA 147

>AFR314W [3506] [Homologous to ScYGR133W (PEX4) - SH]
           complement(1006421..1006888) [468 bp, 155 aa]
          Length = 155

 Score = 67.0 bits (162), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 38/101 (37%), Positives = 55/101 (54%), Gaps = 3/101 (2%)

Query: 29  DDNLRYFQVTIEGPEQSPYEDGIFELELYLPDDYPMEAPKVRF-LTKIYHPNID-RLGRI 86
           + +L  ++   +GPE +PY    F L + +P+ YP E PK  F    I HPNI    G +
Sbjct: 31  NGDLHRWEAHFQGPENTPYAGFTFTLRINVPETYPNEPPKCSFPPHHICHPNIKWSTGEV 90

Query: 87  CLDVLKTN-WSPALQIRTVLLSIQALLASPNPNDPLANDVA 126
           CLD+LK   WSP   +  V+ +I  LLA P  + PL  D++
Sbjct: 91  CLDLLKHEAWSPVYNLLQVVEAISTLLAEPGVDSPLDVDLS 131

>Scas_599.16
          Length = 224

 Score = 67.8 bits (164), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 61/114 (53%), Gaps = 9/114 (7%)

Query: 6   KRIIKETEKLVSDPVPGITAEPHDDNLRYFQVTIEGPEQSPYEDGIFELELYLPDDYPME 65
           KR+ KE + +V +P+P I A P++DN+  +   I GP  +PY+DG +   L  P DYP +
Sbjct: 110 KRLTKEYKLMVENPLPYILARPNEDNILEWHYIITGPPDTPYKDGQYHGTLTFPSDYPYK 169

Query: 66  APKVRFLTKIYHPN--IDRLGRICLDVLKTN---WSPALQIRTVLLSIQALLAS 114
            P +R +T    PN       R+CL +   +   W+P   + T+L  + +L+  
Sbjct: 170 PPAIRMIT----PNGRFKDNTRLCLSMSDYHPDLWNPGWSVNTILNGLLSLMTG 219

>YER100W (UBC6) [1532] chr5 (359558..360310) Ubiquitin-conjugating
           enzyme, anchored in the ER membrane with the
           catalytically active domain in cytoplasm [753 bp, 250
           aa]
          Length = 250

 Score = 67.4 bits (163), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 59/114 (51%), Gaps = 9/114 (7%)

Query: 6   KRIIKETEKLVSDPVPGITAEPHDDNLRYFQVTIEGPEQSPYEDGIFELELYLPDDYPME 65
           KR+ KE + +V +P P I A P++DN+  +   I GP  +PY+ G +   L  P DYP +
Sbjct: 8   KRLTKEYKLMVENPPPYILARPNEDNILEWHYIITGPADTPYKGGQYHGTLTFPSDYPYK 67

Query: 66  APKVRFLT--KIYHPNIDRLGRICL---DVLKTNWSPALQIRTVLLSIQALLAS 114
            P +R +T    + PN     R+CL   D     W+P   + T+L  + + + S
Sbjct: 68  PPAIRMITPNGRFKPNT----RLCLSMSDYHPDTWNPGWSVSTILNGLLSFMTS 117

>Kwal_27.10837
          Length = 246

 Score = 67.0 bits (162), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 58/112 (51%), Gaps = 5/112 (4%)

Query: 6   KRIIKETEKLVSDPVPGITAEPHDDNLRYFQVTIEGPEQSPYEDGIFELELYLPDDYPME 65
           KR+ KE + +V +P P I A+P++DN+  +   I GP  +PY  G +   L  P DYP +
Sbjct: 8   KRLSKEYKSMVENPPPFIIAQPNEDNVLEWHYVITGPPDTPYMGGQYHGTLVFPSDYPFK 67

Query: 66  APKVRFLTKIYHPNIDRLGRICL---DVLKTNWSPALQIRTVLLSIQALLAS 114
            P +R +T       D   R+CL   D     W+P+  + T+L  + + + S
Sbjct: 68  PPAIRMVTPSGRFKED--TRLCLSMSDYHPDTWNPSWSVSTILTGLLSFMTS 117

>Sklu_2425.6 YER100W, Contig c2425 8506-9261 reverse complement
          Length = 251

 Score = 67.0 bits (162), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 35/114 (30%), Positives = 59/114 (51%), Gaps = 9/114 (7%)

Query: 6   KRIIKETEKLVSDPVPGITAEPHDDNLRYFQVTIEGPEQSPYEDGIFELELYLPDDYPME 65
           KR+ KE + ++ +P   I A+P++DN+  +   I GP  +PY DG +   L  P DYP +
Sbjct: 8   KRLTKEYKAIIENPPQFINAQPNEDNILEWHYIITGPPDTPYTDGQYHGTLVFPADYPFK 67

Query: 66  APKVRFLTKIYHPN--IDRLGRICL---DVLKTNWSPALQIRTVLLSIQALLAS 114
            P +R +T    PN       R+C+   D     W+PA  + T+L+ + + +  
Sbjct: 68  PPAIRMIT----PNGRFKENTRLCMTMSDYHPDTWNPAWSVATILMGLLSFMTG 117

>CAGL0I05478g complement(518933..519673) highly similar to sp|P33296
           Saccharomyces cerevisiae YER100w UBC6 E2
           ubiquitin-conjugating enzyme, start by similarity
          Length = 246

 Score = 63.5 bits (153), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 35/114 (30%), Positives = 57/114 (50%), Gaps = 9/114 (7%)

Query: 6   KRIIKETEKLVSDPVPGITAEPHDDNLRYFQVTIEGPEQSPYEDGIFELELYLPDDYPME 65
           KR+ KE + +V +P P I A P+++N+  +   I GP  +PY+ G +   L  P DYP +
Sbjct: 8   KRLTKEYKMMVENPPPFIIARPNEENILEWHYVISGPPDTPYDGGQYHGTLTFPSDYPYK 67

Query: 66  APKVRFLTKIYHPN--IDRLGRICL---DVLKTNWSPALQIRTVLLSIQALLAS 114
            P +R +T    PN       R+CL   D     W+P   + T+L  + + +  
Sbjct: 68  PPAIRMIT----PNGRFKENTRLCLSMSDYHPDTWNPGWSVATILNGLLSFMTG 117

>YGR133W (PEX4) [2090] chr7 (756899..757450) Ubiquitin-conjugating
           enzyme and peroxisomal biogenesis protein (peroxin) [552
           bp, 183 aa]
          Length = 183

 Score = 61.6 bits (148), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 41/136 (30%), Positives = 69/136 (50%), Gaps = 15/136 (11%)

Query: 6   KRIIKETEKL---------VSDPVPGI--TAEPHDD-NLRYFQVTIEGPEQSPYEDGIFE 53
            RI+KE + +         +++P  GI  +  P D+ +L  ++  I GP  +PYE+  F 
Sbjct: 20  SRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQFR 79

Query: 54  LELYLPDDYPMEAPKVRFL-TKIYHPNI-DRLGRICLDVLK-TNWSPALQIRTVLLSIQA 110
           + + +P  YPM  PK+ F+   I H N+    G ICL++LK   W+P   +   + ++  
Sbjct: 80  ILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHAVWR 139

Query: 111 LLASPNPNDPLANDVA 126
           LL  P  + PL  D+ 
Sbjct: 140 LLREPVCDSPLDVDIG 155

>KLLA0E03916g complement(365119..365595) similar to sp|P29340
           Saccharomyces cerevisiae YGR133w PAS2 E2
           ubiquitin-conjugating enzyme - peroxin, start by
           similarity
          Length = 158

 Score = 60.8 bits (146), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 60/105 (57%), Gaps = 8/105 (7%)

Query: 29  DDNLRYFQVTIEGPEQSPYEDGIFELELYLPDD---YPMEA-PKVRFLTK-IYHPNID-R 82
           DD+L  +    +GP +SP+E   FEL L +  D   YP+   P+V F  + + HPN+   
Sbjct: 31  DDDLSEWVCRFQGPSESPFEG--FELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWD 88

Query: 83  LGRICLDVLKTNWSPALQIRTVLLSIQALLASPNPNDPLANDVAE 127
            G ICLD+LK  W+P   +  V+ +I+ LLA P  + PL  D+A+
Sbjct: 89  TGEICLDLLKDAWTPIYTLLDVVGAIRDLLADPGLDSPLDLDIAQ 133

>Scas_609.7
          Length = 240

 Score = 60.5 bits (145), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 33/114 (28%), Positives = 57/114 (50%), Gaps = 9/114 (7%)

Query: 6   KRIIKETEKLVSDPVPGITAEPHDDNLRYFQVTIEGPEQSPYEDGIFELELYLPDDYPME 65
           KR+ KE + ++ +P P I A P+++N+  +   I GP  +PY  G +   L  P DYP +
Sbjct: 8   KRLSKEYKLIIENPTPYILARPNENNILEWHYIITGPPDTPYVGGQYHGTLTFPSDYPFK 67

Query: 66  APKVRFLTKIYHPN--IDRLGRICLDVLKTN---WSPALQIRTVLLSIQALLAS 114
            P +R +T    PN       R+CL +   +   W+P   + T+L  + + +  
Sbjct: 68  PPAIRMIT----PNGRFKENTRLCLSMSDYHPDLWNPGWSVATILNGLLSFMTG 117

>Scas_551.9
          Length = 153

 Score = 53.1 bits (126), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 47/87 (54%), Gaps = 5/87 (5%)

Query: 10  KETEKLVSDPVPGITAEP--HDD---NLRYFQVTIEGPEQSPYEDGIFELELYLPDDYPM 64
           K  +K   D   G  A+P  H D   NL+ ++  I G E + + +G++ + +  P++YP 
Sbjct: 65  KNRKKWRKDHPFGFFAKPTRHPDGSMNLQKWEAGIPGKEGTIWAEGVYPITIEYPNEYPS 124

Query: 65  EAPKVRFLTKIYHPNIDRLGRICLDVL 91
           + PKV+     YHPN+   G ICL +L
Sbjct: 125 KPPKVKLPANFYHPNVYPSGTICLSIL 151

>Kwal_27.11182
          Length = 101

 Score = 48.5 bits (114), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 49/87 (56%), Gaps = 3/87 (3%)

Query: 32  LRYFQVTIEGPEQSPYEDGIFELELYLPDDYPMEAPKVRFLTKIYHPNIDR-LGRICLDV 90
           + Y+  TI GP  S +E+ I+ + L   + YP E PK++F++KI  P +++  G +  D 
Sbjct: 1   MTYWNGTILGPPHSNHENRIYSVALECGNAYPDEPPKIKFISKINLPCVNQTTGEVKRDQ 60

Query: 91  LKT--NWSPALQIRTVLLSIQALLASP 115
             T  +W  +  + T+LL ++  +A P
Sbjct: 61  FSTLRDWKRSYNMETLLLDLRKEMALP 87

>CAGL0H03157g
           join(complement(297881..297891),
           complement(297272..297680)) highly similar to sp|P53152
           Saccharomyces cerevisiae YGL087c MMS2 part of the
           error-free postreplication repair pathway
          Length = 139

 Score = 45.4 bits (106), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 62/124 (50%), Gaps = 9/124 (7%)

Query: 1   MASLPK--RIIKETEK----LVSDPVPGITAEPHDDNLRYFQVTIEGPEQSPYEDGIFEL 54
           M+ +P+  R+++E EK    L  +      A+  D  +  +  TI GP  S +E+ I+ +
Sbjct: 1   MSKVPRSFRLLEELEKGEKGLGPESCSYGLADADDITMTRWNGTILGPPHSNHENRIYSV 60

Query: 55  ELYLPDDYPMEAPKVRFLTKIYHPNIDR-LGRICLDVLKT--NWSPALQIRTVLLSIQAL 111
            +     YP E P + F++KI  P +D+  G +  +   T  +W     + T+LL ++  
Sbjct: 61  SIECGPKYPDEPPTITFISKINLPCVDQSTGEVNKEKFNTLKDWKRLYNMETILLDLRKE 120

Query: 112 LASP 115
           +ASP
Sbjct: 121 MASP 124

>KLLA0E19217g join(complement(1703226..1703236), highly similar to
           sp|P53152 Saccharomyces cerevisiae YGL087c MMS2 part of
           the error-free postreplication repair pathway singleton,
           start by similarity
          Length = 139

 Score = 45.1 bits (105), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 64/125 (51%), Gaps = 9/125 (7%)

Query: 1   MASLPK--RIIKETEK----LVSDPVPGITAEPHDDNLRYFQVTIEGPEQSPYEDGIFEL 54
           M+ +P+  R+++E EK    L  +      ++  D  +  +  TI GP  S +E+ I+ +
Sbjct: 1   MSKVPRSFRLLEELEKGEKGLGPESCSYGLSDSDDITMTKWNGTILGPPHSNHENRIYSV 60

Query: 55  ELYLPDDYPMEAPKVRFLTKIYHPNIDR-LGRICLDVLKT--NWSPALQIRTVLLSIQAL 111
            +     YP E PKV+F++KI  P ++   G +  +   T   W  +  + TVLL ++  
Sbjct: 61  LIECGPSYPDEPPKVKFVSKINLPCVNSTTGEVVKEKFHTLKEWKRSYTMETVLLELRKE 120

Query: 112 LASPN 116
           +A+P+
Sbjct: 121 MATPS 125

>Scas_720.10*
          Length = 134

 Score = 44.3 bits (103), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 49/94 (52%), Gaps = 3/94 (3%)

Query: 25  AEPHDDNLRYFQVTIEGPEQSPYEDGIFELELYLPDDYPMEAPKVRFLTKIYHPNID-RL 83
           A+  D  +  +  TI GP  S +E+ I+ + ++    YP   P ++F++KI  P +D + 
Sbjct: 27  ADSDDITMTKWNGTILGPPHSNHENRIYSVAIHCGPHYPDAPPTIKFVSKINLPCVDEKT 86

Query: 84  GRICLDVLKT--NWSPALQIRTVLLSIQALLASP 115
           G +      T  +W  +  + T+LL ++  +ASP
Sbjct: 87  GEVKQASFHTLRDWKRSYTMETLLLDLRKEMASP 120

>YGL087C (MMS2) [1895] chr7
           complement(346407..346809,346895..346905)
           Ubiquitin-conjugating enzyme variant (UEV) protein
           required for resistance to DNA damaging agents and
           non-proteolytic multi-ubiquitination of Pol30p (PCNA)
           [414 bp, 137 aa]
          Length = 137

 Score = 43.9 bits (102), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 61/123 (49%), Gaps = 8/123 (6%)

Query: 1   MASLPK--RIIKETEKLVSDPVPGIT----AEPHDDNLRYFQVTIEGPEQSPYEDGIFEL 54
           M+ +P+  R+++E EK      P       A+  D  +  +  TI GP  S +E+ I+ L
Sbjct: 1   MSKVPRNFRLLEELEKGEKGFGPESCSYGLADSDDITMTKWNGTILGPPHSNHENRIYSL 60

Query: 55  ELYLPDDYPMEAPKVRFLTKIYHPNID-RLGRICLDVLK-TNWSPALQIRTVLLSIQALL 112
            +    +YP   PKV F++KI  P ++   G +  D     +W  A  + T+LL ++  +
Sbjct: 61  SIDCGPNYPDSPPKVTFISKINLPCVNPTTGEVQTDFHTLRDWKRAYTMETLLLDLRKEM 120

Query: 113 ASP 115
           A+P
Sbjct: 121 ATP 123

>AFL064W [3129] [Homologous to ScYGL087C (MMS2) - SH]
           complement(314210..314220,314273..314678) [417 bp, 138
           aa]
          Length = 138

 Score = 42.0 bits (97), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 62/123 (50%), Gaps = 9/123 (7%)

Query: 1   MASLPK--RIIKETEKLVSDPVPGIT----AEPHDDNLRYFQVTIEGPEQSPYEDGIFEL 54
           M+ +P+  R+++E EK      P       A+  D ++ ++  TI GP  S +E+ I+ +
Sbjct: 1   MSKVPRSFRLLEELEKGEKGMGPESCSYGLADGDDISMTHWNGTILGPPHSSHENRIYSV 60

Query: 55  ELYLPDDYPMEAPKVRFLTKIYHPNID-RLGRICLDVLKT--NWSPALQIRTVLLSIQAL 111
            +    +YP   PKVRF+++I  P +D   G +  +      +W  +  + T+L  ++  
Sbjct: 61  VIECGAEYPDRPPKVRFISRINLPCVDPSTGEVRPEAFHALRDWKRSSNMETLLQDLRKE 120

Query: 112 LAS 114
           +AS
Sbjct: 121 MAS 123

>CAGL0H04873g complement(465069..466424) some similarities with
           tr|Q05937 Saccharomyces cerevisiae YLR375w STP3 or
           tr|Q07351 Saccharomyces cerevisiae YDL048c STP4,
           hypothetical start
          Length = 451

 Score = 28.9 bits (63), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 21/40 (52%), Gaps = 3/40 (7%)

Query: 38  TIEGPEQSPYEDGIFELELYLPDDYPMEAPKVRFLTKIYH 77
            I+G  + PY   + EL+L L   YP +  +V F+T   H
Sbjct: 350 CIKGTYECPYNSALIELDLEL---YPYKGKEVNFITTQCH 386

>Sklu_2369.8 YER075C, Contig c2369 9770-12817 reverse complement
          Length = 1015

 Score = 28.5 bits (62), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 37/75 (49%), Gaps = 2/75 (2%)

Query: 64  MEAPKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSIQALLASPNPNDPLAN 123
           M+A K++F+++     +D L +  L+   TN    L+    +     LL +P P+ P A 
Sbjct: 514 MKASKLQFISQFQR--LDLLEKKRLNQCLTNVDMVLEQPQSIPPTGNLLCNPIPSTPCAI 571

Query: 124 DVAEDWIKNEQGAKA 138
           D  ED   ++ GA A
Sbjct: 572 DDTEDPRNHQHGATA 586

>CAGL0D05764g 547259..549880 weakly similar to tr|Q12369
           Saccharomyces cerevisiae YLL003w SFI1, hypothetical
           start
          Length = 873

 Score = 27.7 bits (60), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 26/51 (50%)

Query: 101 IRTVLLSIQALLASPNPNDPLANDVAEDWIKNEQGAKAKAREWTKLYAKKK 151
           ++T+L ++ A+ A       L  +V   W+ N +  K   R+ T L AK+K
Sbjct: 628 LKTLLFAVYAIEADKTYERSLKLNVYLKWLVNSESLKENERQLTTLLAKQK 678

>KLLA0C10802g complement(926916..931934) similar to sp|P15442
          Saccharomyces cerevisiae YDR283c GCN2 ser/thr protein
          kinase, start by similarity
          Length = 1672

 Score = 26.9 bits (58), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 22/45 (48%), Gaps = 1/45 (2%)

Query: 35 FQVTIEGPEQSPYEDGIFELELYLPDDYPMEAPKVRFLTKIYHPN 79
          F++ +   E  P E  +  L + LP  YP  AP++ F   I  P+
Sbjct: 48 FEIGLRSQESDPAECSL-NLHVVLPSTYPHAAPQITFKNVINVPD 91

>Kwal_23.4090
          Length = 2050

 Score = 26.9 bits (58), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 21/36 (58%), Gaps = 3/36 (8%)

Query: 4    LPKRIIKE---TEKLVSDPVPGITAEPHDDNLRYFQ 36
            L K IIKE    ++L+   +P +TA+P +    YFQ
Sbjct: 1992 LKKNIIKENVKADRLIGKYIPNLTAKPFEITKEYFQ 2027

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.136    0.407 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 5,346,236
Number of extensions: 221015
Number of successful extensions: 683
Number of sequences better than 10.0: 97
Number of HSP's gapped: 622
Number of HSP's successfully gapped: 97
Length of query: 151
Length of database: 16,596,109
Length adjustment: 92
Effective length of query: 59
Effective length of database: 13,411,253
Effective search space: 791263927
Effective search space used: 791263927
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.5 bits)
S2: 57 (26.6 bits)