Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YDR091C60859831680.0
KLLA0C17556g60759828930.0
AGR125W60759828830.0
CAGL0G08041g60759828660.0
Scas_636.1460859928630.0
Kwal_56.2342953953925760.0
YPL226W (NEW1)11963461453e-09
AEL032W7531891425e-09
Sklu_2403.511793461426e-09
KLLA0C16115g11833591427e-09
CAGL0B03487g10453091401e-08
Sklu_2187.27521891401e-08
Scas_720.3611903231391e-08
Kwal_0.32710192121382e-08
Scas_618.37931901382e-08
YNL014W (HEF3)10443141382e-08
Kwal_0.16710441921354e-08
AFL131W11893331346e-08
Kwal_33.1556112971991338e-08
Kwal_34.162407521811311e-07
AFR432W12842121311e-07
KLLA0A10857g7521921302e-07
AAL028W10441921302e-07
YFR009W (GCN20)7521811292e-07
Sklu_2442.2010441991292e-07
CAGL0D03674g11863271293e-07
YKL209C (STE6)12901821274e-07
YLR249W (YEF3)10442011274e-07
CAGL0M13739g7271851265e-07
Scas_703.1710461951256e-07
KLLA0A01452g6071821231e-06
KLLA0D04554g10222681231e-06
CAGL0K10472g7521811221e-06
KLLA0F12210g10441931231e-06
AGR047W14921841222e-06
Kwal_33.156235621941202e-06
CAGL0L07744g10551981168e-06
CAGL0K00363g12271721168e-06
Scas_716.8115651991169e-06
YER036C6101791132e-05
AER190W10111841132e-05
Scas_566.14662261122e-05
Scas_288.14942141103e-05
CAGL0I08019g12852031104e-05
Kwal_27.1271112462061096e-05
KLLA0D03432g14832141087e-05
CAGL0M07293g15151931088e-05
AFR232C6071801079e-05
Sklu_2152.56082151061e-04
Scas_574.87022171061e-04
Kwal_47.191166071791051e-04
Kwal_26.94807192231051e-04
ABR126W15122131052e-04
Kwal_56.2274715382471052e-04
YMR301C (ATM1)6901961042e-04
Scas_712.296101801042e-04
YPL058C (PDR12)15111941042e-04
CAGL0I04862g15072141042e-04
KLLA0D00748g7891981042e-04
YOL075C12941721042e-04
Scas_628.1310601671042e-04
AGL142C14971931042e-04
AGL335W6911821033e-04
Scas_695.2412881721033e-04
YDR011W (SNQ2)15012131033e-04
Sklu_2316.113102411023e-04
Scas_710.506021801006e-04
KLLA0A10131g7202171007e-04
KLLA0D04059g15681621007e-04
AFR683C677208997e-04
YCR011C (ADP1)10492691007e-04
KLLA0C04477g1253158990.001
CAGL0L06402g1535188990.001
Scas_573.1168973980.001
CAGL0C02343g610167970.001
CAGL0E03355g1535180970.002
KLLA0B14256g1271272950.002
Scas_108.1335131940.002
KLLA0C01991g706202950.003
KLLA0F20075g1516338950.003
CAGL0E00385g608213930.003
Kwal_56.22329776196930.004
YPL270W (MDL2)773173930.004
Scas_693.421512132930.005
KLLA0B09702g1518193930.005
KLLA0F08833g273188900.005
Scas_468.1691175910.006
KLLA0D03476g1560198920.007
ABR125C1488217910.007
Scas_40.1203201870.009
KLLA0C14234g1454240900.009
Kwal_56.238441494185890.013
CAGL0C03289g1648201890.015
Sklu_2343.3774176880.015
YFL028C (CAF16)289241860.018
KLLA0A00286g128053870.022
YLR188W (MDL1)695231870.023
Kwal_27.96661474193860.030
YDR135C (YCF1)1515128860.032
KLLA0F21692g1525228860.032
YLL015W (BPT1)1559179850.038
Scas_622.91657207850.039
Scas_587.8715188850.040
ACR022W754202840.044
CAGL0A01133g801258840.046
Kwal_23.51611489191840.050
YDR406W (PDR15)1529194840.050
Kwal_14.2435124780840.051
Scas_455.1925206840.054
Scas_643.11289193840.055
Scas_711.39122776840.057
YOR328W (PDR10)1564194840.059
CAGL0F02717g1542197830.062
AGL346W1400148830.067
YKR104W (NFT1)306239810.085
YGR281W (YOR1)1477176820.091
Scas_714.421520178820.093
CAGL0H02805g1219112810.11
YLL048C (YBT1)1661214810.11
KLLA0E00462g1650211810.11
Sklu_1870.3265158790.13
YJL074C (SMC3)123063800.15
Scas_567.1810179800.15
KLLA0E19074g32679780.19
YOR153W (PDR5)1511207790.21
YNR070W133383790.23
AAL182W123180780.27
Scas_552.4720195770.30
CAGL0M01760g1499204770.34
Scas_716.8267589760.37
Scas_472.1*39351760.38
Kwal_26.670261788760.41
YIL013C (PDR11)141157760.41
YHL035C1592196760.44
CAGL0E03982g165981760.48
Scas_469.160976750.49
Scas_707.829432740.49
YGL091C (NBP35)32881740.57
Scas_586.31531170750.61
YOR011W (AUS1)139465740.74
Scas_717.6*1400122740.77
CAGL0K12474g294210720.89
CAGL0L07150g14061690.94
Kwal_27.1114732384711.2
Sklu_2062.2328101711.3
YFR031C (SMC2)117074721.4
CAGL0F01419g1398198721.5
AAR180C76674711.6
Kwal_14.124226920701.7
Scas_612.11*1506153711.8
CAGL0D05258g117074711.9
AFR152C27020692.0
Kwal_34.157701436211712.0
Kwal_56.2271034887702.1
KLLA0E14410g59672702.1
Kwal_56.23638492243702.7
CAGL0G00242g147766692.9
Sklu_2140.267229683.9
Scas_565.6117074684.4
Scas_720.733279664.9
KLLA0B00561g76767675.0
CAGL0F07139g76844675.5
ACL072C1627195675.7
YNR011C (PRP2)87651667.0
YER013W (PRP22)1145136667.0
Sklu_2035.3474104657.1
Kwal_14.159164066667.1
YLR106C (MDN1)491043659.2
Kwal_33.1330870673659.4
Kwal_26.9532147134659.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YDR091C
         (598 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YDR091C (YDR091C) [943] chr4 complement(626702..628528) Putative...  1224   0.0  
KLLA0C17556g complement(1544404..1546227) highly similar to sgd|...  1118   0.0  
AGR125W [4436] [Homologous to ScYDR091C (RLI1) - SH] complement(...  1115   0.0  
CAGL0G08041g complement(758811..760634) highly similar to tr|Q03...  1108   0.0  
Scas_636.14                                                          1107   0.0  
Kwal_56.23429                                                         996   0.0  
YPL226W (NEW1) [5223] chr16 (121767..125357) Member of the non-t...    60   3e-09
AEL032W [2474] [Homologous to ScYFR009W (GCN20) - SH] complement...    59   5e-09
Sklu_2403.5 YPL226W, Contig c2403 12436-15975 reverse complement       59   6e-09
KLLA0C16115g 1405766..1409317 similar to sgd|S0006147 Saccharomy...    59   7e-09
CAGL0B03487g complement(345399..348536) highly similar to sp|P16...    59   1e-08
Sklu_2187.2 YFR009W, Contig c2187 2884-5142 reverse complement         59   1e-08
Scas_720.36                                                            58   1e-08
Kwal_0.327                                                             58   2e-08
Scas_618.3                                                             58   2e-08
YNL014W (HEF3) [4572] chr14 (606317..609451) Translation elongat...    58   2e-08
Kwal_0.167                                                             57   4e-08
AFL131W [3064] [Homologous to ScYPL226W (NEW1) - SH] complement(...    56   6e-08
Kwal_33.15561                                                          56   8e-08
Kwal_34.16240                                                          55   1e-07
AFR432W [3624] [Homologous to ScYKL209C (STE6) - SH] complement(...    55   1e-07
KLLA0A10857g complement(941784..944042) highly similar to sp|P43...    55   2e-07
AAL028W [159] [Homologous to ScYLR249W (YEF3) - SH; ScYNL014W (H...    55   2e-07
YFR009W (GCN20) [1689] chr6 (162482..164740) Component of a prot...    54   2e-07
Sklu_2442.20 YLR249W, Contig c2442 35272-38406 reverse complement      54   2e-07
CAGL0D03674g 370066..373626 highly similar to tr|Q08972 Saccharo...    54   3e-07
YKL209C (STE6) [3066] chr11 complement(42424..46296) Membrane tr...    54   4e-07
YLR249W (YEF3) [3645] chr12 (636782..639916) Translation elongat...    54   4e-07
CAGL0M13739g complement(1346231..1348414) similar to sp|P40416 S...    53   5e-07
Scas_703.17                                                            53   6e-07
KLLA0A01452g 130078..131901 highly similar to sp|P40024 Saccharo...    52   1e-06
KLLA0D04554g complement(385733..388801) similar to sp|P25371 Sac...    52   1e-06
CAGL0K10472g 1020016..1022274 highly similar to sp|P43535 Saccha...    52   1e-06
KLLA0F12210g 1125630..1128764 highly similar to sp|P16521 Saccha...    52   1e-06
AGR047W [4357] [Homologous to ScYDR135C (YCF1) - SH] complement(...    52   2e-06
Kwal_33.15623                                                          51   2e-06
CAGL0L07744g 849961..853128 similar to sp|P25371 Saccharomyces c...    49   8e-06
CAGL0K00363g complement(37452..41135) similar to sp|P12866 Sacch...    49   8e-06
Scas_716.81                                                            49   9e-06
YER036C (YER036C) [1461] chr5 complement(223366..225198) Member ...    48   2e-05
AER190W [2692] [Homologous to ScYCR011C (ADP1) - SH; ScYOL075C -...    48   2e-05
Scas_566.1                                                             48   2e-05
Scas_288.1                                                             47   3e-05
CAGL0I08019g complement(782863..786720) highly similar to sp|Q08...    47   4e-05
Kwal_27.12711                                                          47   6e-05
KLLA0D03432g 287805..292256 similar to sp|P32568 Saccharomyces c...    46   7e-05
CAGL0M07293g complement(733072..737619) similar to sp|Q02785 Sac...    46   8e-05
AFR232C [3424] [Homologous to ScYER036C (KRE30) - SH] (859615..8...    46   9e-05
Sklu_2152.5 YER036C, Contig c2152 6647-8473 reverse complement         45   1e-04
Scas_574.8                                                             45   1e-04
Kwal_47.19116                                                          45   1e-04
Kwal_26.9480                                                           45   1e-04
ABR126W [718] [Homologous to ScYOR153W (PDR5) - NSH; ScYDR406W (...    45   2e-04
Kwal_56.22747                                                          45   2e-04
YMR301C (ATM1) [4255] chr13 complement(867554..869626) Member of...    45   2e-04
Scas_712.29                                                            45   2e-04
YPL058C (PDR12) [5383] chr16 complement(445837..450372) Protein ...    45   2e-04
CAGL0I04862g complement(438338..442861) highly similar to sp|P32...    45   2e-04
KLLA0D00748g complement(69839..72208) similar to sp|P33311 Sacch...    45   2e-04
YOL075C (YOL075C) [4745] chr15 complement(189657..193541) Member...    45   2e-04
Scas_628.13                                                            45   2e-04
AGL142C [4170] [Homologous to ScYPL058C (PDR12) - NSH] (434247.....    45   2e-04
AGL335W [3977] [Homologous to ScYMR301C (ATM1) - SH] complement(...    44   3e-04
Scas_695.24                                                            44   3e-04
YDR011W (SNQ2) [865] chr4 (465916..470421) Drug-efflux pump invo...    44   3e-04
Sklu_2316.1 YKL209C, Contig c2316 84-4016 reverse complement           44   3e-04
Scas_710.50                                                            43   6e-04
KLLA0A10131g complement(889688..891850) similar to sp|P40416 Sac...    43   7e-04
KLLA0D04059g complement(338422..343128) similar to sp|P14772 Sac...    43   7e-04
AFR683C [3876] [Homologous to ScYLR188W (MDL1) - SH] (1697345..1...    43   7e-04
YCR011C (ADP1) [545] chr3 complement(133721..136870) Member of t...    43   7e-04
KLLA0C04477g complement(409543..413304) similar to sp|Q08234 Sac...    43   0.001
CAGL0L06402g 718726..723333 highly similar to sp|P39109 Saccharo...    43   0.001
Scas_573.11                                                            42   0.001
CAGL0C02343g 236840..238672 highly similar to sp|P40024 Saccharo...    42   0.001
CAGL0E03355g complement(307242..311849) similar to sp|P14772 Sac...    42   0.002
KLLA0B14256g 1248654..1252469 similar to sp|P12866 Saccharomyces...    41   0.002
Scas_108.1                                                             41   0.002
KLLA0C01991g 160778..162898 similar to sp|P33310 Saccharomyces c...    41   0.003
KLLA0F20075g complement(1868786..1873336) similar to sp|P39109 S...    41   0.003
CAGL0E00385g 31723..33549 similar to sp|P33310 Saccharomyces cer...    40   0.003
Kwal_56.22329                                                          40   0.004
YPL270W (MDL2) [5181] chr16 (30482..32803) Member of the ATP-bin...    40   0.004
Scas_693.42                                                            40   0.005
KLLA0B09702g complement(842245..846801) highly similar to sp|Q02...    40   0.005
KLLA0F08833g 822039..822860 similar to sp|P43569 Saccharomyces c...    39   0.005
Scas_468.1                                                             40   0.006
KLLA0D03476g 296287..300969 similar to sp|P33302 Saccharomyces c...    40   0.007
ABR125C [717] [Homologous to ScYDR011W (SNQ2 ) - NSH; ScYNR070W ...    40   0.007
Scas_40.1                                                              38   0.009
KLLA0C14234g 1234598..1238962 similar to sp|P53049 Saccharomyces...    39   0.009
Kwal_56.23844                                                          39   0.013
CAGL0C03289g 328799..333745 similar to sp|P32386 Saccharomyces c...    39   0.015
Sklu_2343.3 YPL270W, Contig c2343 2058-4382                            39   0.015
YFL028C (CAF16) [1655] chr6 complement(79342..80211) Protein tha...    38   0.018
KLLA0A00286g complement(22024..25866) similar to sp|P47037 Sacch...    38   0.022
YLR188W (MDL1) [3591] chr12 (528302..530389) Member of the ATP-b...    38   0.023
Kwal_27.9666                                                           38   0.030
YDR135C (YCF1) [981] chr4 complement(722998..727545) Vacuolar gl...    38   0.032
KLLA0F21692g complement(2014152..2018729) gi|14571818|gb|AAK6729...    38   0.032
YLL015W (BPT1) [3404] chr12 (116431..121110) Membrane transporte...    37   0.038
Scas_622.9                                                             37   0.039
Scas_587.8                                                             37   0.040
ACR022W [1070] [Homologous to ScYPL270W (MDL2) - SH] complement(...    37   0.044
CAGL0A01133g 112037..114442 similar to sp|P33311 Saccharomyces c...    37   0.046
Kwal_23.5161                                                           37   0.050
YDR406W (PDR15) [1232] chr4 (1279198..1283787) Member of ATP-bin...    37   0.050
Kwal_14.2435                                                           37   0.051
Scas_455.1                                                             37   0.054
Scas_643.1                                                             37   0.055
Scas_711.39                                                            37   0.057
YOR328W (PDR10) [5109] chr15 (931798..936492) Member of ATP-bind...    37   0.059
CAGL0F02717g 261361..265989 tr|O74208 Candida glabrata ATP-bindi...    37   0.062
AGL346W [3966] [Homologous to ScYGR281W (YOR1) - SH] complement(...    37   0.067
YKR104W (NFT1) [3355] chr11 (656472..657392) Member of the ATP-b...    36   0.085
YGR281W (YOR1) [2226] chr7 (1052829..1057262) Oligomycin-resista...    36   0.091
Scas_714.42                                                            36   0.093
CAGL0H02805g complement(256682..260341) similar to sp|P47037 Sac...    36   0.11 
YLL048C (YBT1) [3375] chr12 complement(41279..46264) Protein wit...    36   0.11 
KLLA0E00462g complement(39173..44125) similar to sp|P32386 Sacch...    36   0.11 
Sklu_1870.3 YFL028C, Contig c1870 3336-4133                            35   0.13 
YJL074C (SMC3) [2838] chr10 complement(299073..302765) Cohesin, ...    35   0.15 
Scas_567.1                                                             35   0.15 
KLLA0E19074g complement(1691643..1692623) highly similar to sp|P...    35   0.19 
YOR153W (PDR5) [4952] chr15 (619840..624375) Drug-efflux pump in...    35   0.21 
YNR070W (YNR070W) [4653] chr14 (765372..769373) Probable multidr...    35   0.23 
AAL182W [5] [Homologous to ScYJL074C (SMC3) - SH] complement(161...    35   0.27 
Scas_552.4                                                             34   0.30 
CAGL0M01760g 203616..208115 highly similar to sp|P33302 Saccharo...    34   0.34 
Scas_716.82                                                            34   0.37 
Scas_472.1*                                                            34   0.38 
Kwal_26.6702                                                           34   0.41 
YIL013C (PDR11) [2652] chr9 complement(328205..332440) Membrane ...    34   0.41 
YHL035C (YHL035C) [2251] chr8 complement(27976..32754) Member of...    34   0.44 
CAGL0E03982g 378205..383184 similar to sp|P32386 Saccharomyces c...    34   0.48 
Scas_469.1                                                             33   0.49 
Scas_707.8                                                             33   0.49 
YGL091C (NBP35) [1892] chr7 complement(342057..343043) Putative ...    33   0.57 
Scas_586.3                                                             33   0.61 
YOR011W (AUS1) [4826] chr15 (349678..353862) Protein involved in...    33   0.74 
Scas_717.6*                                                            33   0.77 
CAGL0K12474g 1217183..1218067 similar to sp|P43569 Saccharomyces...    32   0.89 
CAGL0L07150g complement(795321..795743) similar to sp|P38985 Sac...    31   0.94 
Kwal_27.11147                                                          32   1.2  
Sklu_2062.2 YGL091C, Contig c2062 3197-4183                            32   1.3  
YFR031C (SMC2) [1711] chr6 complement(216582..220094) Subunit of...    32   1.4  
CAGL0F01419g complement(142623..146819) highly similar to tr|Q08...    32   1.5  
AAR180C [368] [Homologous to ScYGL120C (PRP43) - SH] (665711..66...    32   1.6  
Kwal_14.1242                                                           32   1.7  
Scas_612.11*                                                           32   1.8  
CAGL0D05258g 500858..504370 similar to sp|P38989 Saccharomyces c...    32   1.9  
AFR152C [3344] [Homologous to ScYFL028C (CAF16) - SH] (710017..7...    31   2.0  
Kwal_34.15770                                                          32   2.0  
Kwal_56.22710                                                          32   2.1  
KLLA0E14410g 1268901..1270691 similar to sp|P25808 Saccharomyces...    32   2.1  
Kwal_56.23638                                                          32   2.7  
CAGL0G00242g complement(20428..24861) highly similar to sp|P5304...    31   2.9  
Sklu_2140.2 YER173W, Contig c2140 1850-3868                            31   3.9  
Scas_565.6                                                             31   4.4  
Scas_720.7                                                             30   4.9  
KLLA0B00561g 42284..44587 highly similar to sp|P53131 Saccharomy...    30   5.0  
CAGL0F07139g complement(698363..700669) highly similar to sp|P53...    30   5.5  
ACL072C [977] [Homologous to ScYLL048C (YBT1) - SH; ScYHL035C - ...    30   5.7  
YNR011C (PRP2) [4594] chr14 complement(644319..646949) Pre-mRNA ...    30   7.0  
YER013W (PRP22) [1436] chr5 (178840..182277) Pre-mRNA splicing f...    30   7.0  
Sklu_2035.3 YBR186W, Contig c2035 2344-3764 reverse complement         30   7.1  
Kwal_14.1591                                                           30   7.1  
YLR106C (MDN1) [3521] chr12 complement(349007..363739) Nuclear p...    30   9.2  
Kwal_33.13308                                                          30   9.4  
Kwal_26.9532                                                           30   9.5  

>YDR091C (YDR091C) [943] chr4 complement(626702..628528) Putative
           ortholog of human Rnase L inhibitor (RLI) of the
           interferon-regulated 2-5A pathway, putative ortholog of
           C. elegans Y39E4B.1, member of the non-transporter group
           in the ATP-binding cassette (ABC) superfamily [1827 bp,
           608 aa]
          Length = 608

 Score = 1224 bits (3168), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 598/598 (100%), Positives = 598/598 (100%)

Query: 1   MSDKNSRIAIVSADKCKPKKCRQECKRSCPVVKTGKLCIEVTPTSKIAFISEILCIGCGI 60
           MSDKNSRIAIVSADKCKPKKCRQECKRSCPVVKTGKLCIEVTPTSKIAFISEILCIGCGI
Sbjct: 1   MSDKNSRIAIVSADKCKPKKCRQECKRSCPVVKTGKLCIEVTPTSKIAFISEILCIGCGI 60

Query: 61  CVKKCPFDAIQIINLPTNLEAHVTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL 120
           CVKKCPFDAIQIINLPTNLEAHVTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL
Sbjct: 61  CVKKCPFDAIQIINLPTNLEAHVTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL 120

Query: 121 KILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLEDDIKAIIKPQYVDNIPRAI 180
           KILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLEDDIKAIIKPQYVDNIPRAI
Sbjct: 121 KILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLEDDIKAIIKPQYVDNIPRAI 180

Query: 181 KGPVQKVGELLKLRMEKSPEDVKRYIKILQLENVLKRDIEKLSGGELQRFAIGMSCVQEA 240
           KGPVQKVGELLKLRMEKSPEDVKRYIKILQLENVLKRDIEKLSGGELQRFAIGMSCVQEA
Sbjct: 181 KGPVQKVGELLKLRMEKSPEDVKRYIKILQLENVLKRDIEKLSGGELQRFAIGMSCVQEA 240

Query: 241 DVYMFDEPSSYLDVKQRLNAAQIIRSLLAPTKYVICVEHDLSVLDYLSDFVCIIYGVPSV 300
           DVYMFDEPSSYLDVKQRLNAAQIIRSLLAPTKYVICVEHDLSVLDYLSDFVCIIYGVPSV
Sbjct: 241 DVYMFDEPSSYLDVKQRLNAAQIIRSLLAPTKYVICVEHDLSVLDYLSDFVCIIYGVPSV 300

Query: 301 YGVVTLPASVREGINIFLDGHIPAENLRFRTEALQFRIADATEDLQNDSASRAFSYPSLK 360
           YGVVTLPASVREGINIFLDGHIPAENLRFRTEALQFRIADATEDLQNDSASRAFSYPSLK
Sbjct: 301 YGVVTLPASVREGINIFLDGHIPAENLRFRTEALQFRIADATEDLQNDSASRAFSYPSLK 360

Query: 361 KTQGDFVLNVEEGEFSDSEILVMMGENGTGKTTLIKLLAGALKPDEGQDIPKLNVSMKPQ 420
           KTQGDFVLNVEEGEFSDSEILVMMGENGTGKTTLIKLLAGALKPDEGQDIPKLNVSMKPQ
Sbjct: 361 KTQGDFVLNVEEGEFSDSEILVMMGENGTGKTTLIKLLAGALKPDEGQDIPKLNVSMKPQ 420

Query: 421 KIAPKFPGTVRQLFFKKIRGQFLNPQFQTDVVKPLRIDDIIDQEVQHLSGGELQRVAIVL 480
           KIAPKFPGTVRQLFFKKIRGQFLNPQFQTDVVKPLRIDDIIDQEVQHLSGGELQRVAIVL
Sbjct: 421 KIAPKFPGTVRQLFFKKIRGQFLNPQFQTDVVKPLRIDDIIDQEVQHLSGGELQRVAIVL 480

Query: 481 ALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIV 540
           ALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIV
Sbjct: 481 ALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIV 540

Query: 541 FEGIPSKNAHARAPESLLTGCNRFLKNLNVTFRRDPNSFRPRINKLDSQMDKEQKSSG 598
           FEGIPSKNAHARAPESLLTGCNRFLKNLNVTFRRDPNSFRPRINKLDSQMDKEQKSSG
Sbjct: 541 FEGIPSKNAHARAPESLLTGCNRFLKNLNVTFRRDPNSFRPRINKLDSQMDKEQKSSG 598

>KLLA0C17556g complement(1544404..1546227) highly similar to
           sgd|S0002498 Saccharomyces cerevisiae YDR091c RLI1,
           start by similarity
          Length = 607

 Score = 1118 bits (2893), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 542/598 (90%), Positives = 569/598 (95%), Gaps = 1/598 (0%)

Query: 1   MSDKNSRIAIVSADKCKPKKCRQECKRSCPVVKTGKLCIEVTPTSKIAFISEILCIGCGI 60
           MS KN+RIAIVS DKCKPKKCRQECKRSCPVVKTGKLCIEV PTSKIAFISE LCIGCGI
Sbjct: 1   MSSKNTRIAIVSEDKCKPKKCRQECKRSCPVVKTGKLCIEVMPTSKIAFISENLCIGCGI 60

Query: 61  CVKKCPFDAIQIINLPTNLEAHVTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL 120
           CVKKCPFDAIQIINLPTNL++ VTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL
Sbjct: 61  CVKKCPFDAIQIINLPTNLDSQVTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL 120

Query: 121 KILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLEDDIKAIIKPQYVDNIPRAI 180
           KILAGKQKPNLGRF+DPPEWQEIIKYFRGSELQNYFTKMLEDDIKAIIKPQYVDNIPRAI
Sbjct: 121 KILAGKQKPNLGRFEDPPEWQEIIKYFRGSELQNYFTKMLEDDIKAIIKPQYVDNIPRAI 180

Query: 181 KGPVQKVGELLKLRMEKSPEDVKRYIKILQLENVLKRDIEKLSGGELQRFAIGMSCVQEA 240
           KGPVQKVGELLKLR+EKS +D KRYI ILQL+NVL R++  LSGGELQRFAIGMSCVQEA
Sbjct: 181 KGPVQKVGELLKLRLEKSKDDAKRYIDILQLKNVLNREVSALSGGELQRFAIGMSCVQEA 240

Query: 241 DVYMFDEPSSYLDVKQRLNAAQIIRSLLAPTKYVICVEHDLSVLDYLSDFVCIIYGVPSV 300
           DVYMFDEPSSYLDVKQRLNAA IIRSLL PT YVICVEHDLSVLDYLSDFVCIIYGVPSV
Sbjct: 241 DVYMFDEPSSYLDVKQRLNAALIIRSLLNPTTYVICVEHDLSVLDYLSDFVCIIYGVPSV 300

Query: 301 YGVVTLPASVREGINIFLDGHIPAENLRFRTEALQFRIADATEDLQNDSASRAFSYPSLK 360
           YGVVTLP+SVREGINIFLDGHIP+ENLRFRTEALQFR+ADA ++L+ D ASRAF+YP +K
Sbjct: 301 YGVVTLPSSVREGINIFLDGHIPSENLRFRTEALQFRMADAGDELEAD-ASRAFTYPDMK 359

Query: 361 KTQGDFVLNVEEGEFSDSEILVMMGENGTGKTTLIKLLAGALKPDEGQDIPKLNVSMKPQ 420
           +TQGDF L VE GEFSDS+ILVMMGENGTGKTTLIKLLAGA+  D+GQDIPKLNVSMKPQ
Sbjct: 360 RTQGDFSLTVEAGEFSDSQILVMMGENGTGKTTLIKLLAGAIPADDGQDIPKLNVSMKPQ 419

Query: 421 KIAPKFPGTVRQLFFKKIRGQFLNPQFQTDVVKPLRIDDIIDQEVQHLSGGELQRVAIVL 480
           KIAPKF GTVRQLFFK+IR QFLNPQFQTDVVKPL+IDDIIDQEVQHLSGGELQRVAIVL
Sbjct: 420 KIAPKFTGTVRQLFFKRIRAQFLNPQFQTDVVKPLKIDDIIDQEVQHLSGGELQRVAIVL 479

Query: 481 ALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIV 540
           +LG+ ADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIV
Sbjct: 480 SLGMNADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIV 539

Query: 541 FEGIPSKNAHARAPESLLTGCNRFLKNLNVTFRRDPNSFRPRINKLDSQMDKEQKSSG 598
           F+GIPSK A ARAPESLLTGCN+FLKNLNVTFRRDP SFRPRINKLDSQMDKEQKSSG
Sbjct: 540 FDGIPSKQAFARAPESLLTGCNKFLKNLNVTFRRDPTSFRPRINKLDSQMDKEQKSSG 597

>AGR125W [4436] [Homologous to ScYDR091C (RLI1) - SH]
           complement(987083..988906) [1824 bp, 607 aa]
          Length = 607

 Score = 1115 bits (2883), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 538/598 (89%), Positives = 567/598 (94%), Gaps = 1/598 (0%)

Query: 1   MSDKNSRIAIVSADKCKPKKCRQECKRSCPVVKTGKLCIEVTPTSKIAFISEILCIGCGI 60
           MSDKN+RIAIVS DKCKPKKCRQECKRSCPVVKTGKLCIEV PTSK+AFISE LCIGCGI
Sbjct: 1   MSDKNTRIAIVSDDKCKPKKCRQECKRSCPVVKTGKLCIEVAPTSKVAFISENLCIGCGI 60

Query: 61  CVKKCPFDAIQIINLPTNLEAHVTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL 120
           CVKKCPF AI IINLPTNL++ VTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL
Sbjct: 61  CVKKCPFGAITIINLPTNLDSQVTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL 120

Query: 121 KILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLEDDIKAIIKPQYVDNIPRAI 180
           KILAGKQKPNLGR+DDPPEW +IIKYFRGSELQNYFTKMLEDDIKAIIKPQYVDNIPRAI
Sbjct: 121 KILAGKQKPNLGRYDDPPEWSDIIKYFRGSELQNYFTKMLEDDIKAIIKPQYVDNIPRAI 180

Query: 181 KGPVQKVGELLKLRMEKSPEDVKRYIKILQLENVLKRDIEKLSGGELQRFAIGMSCVQEA 240
           KGP+QKVGELLK RMEK   DVK YIKIL+L+NVLKRD+  LSGGELQRFAIGMSCVQ+A
Sbjct: 181 KGPLQKVGELLKARMEKPEADVKMYIKILELQNVLKRDVSALSGGELQRFAIGMSCVQQA 240

Query: 241 DVYMFDEPSSYLDVKQRLNAAQIIRSLLAPTKYVICVEHDLSVLDYLSDFVCIIYGVPSV 300
           +VYMFDEPSSYLDVKQRLNAA IIRSLL PT YVICVEHDLSVLDYLSDF+CI+YGVPSV
Sbjct: 241 NVYMFDEPSSYLDVKQRLNAALIIRSLLDPTTYVICVEHDLSVLDYLSDFICILYGVPSV 300

Query: 301 YGVVTLPASVREGINIFLDGHIPAENLRFRTEALQFRIADATEDLQNDSASRAFSYPSLK 360
           YGVVTLP+SVREGINIFLDGHIP+ENLRFRTEALQFR+A+A E+L +D A RAF YP +K
Sbjct: 301 YGVVTLPSSVREGINIFLDGHIPSENLRFRTEALQFRLAEAGEELHSD-AMRAFQYPPMK 359

Query: 361 KTQGDFVLNVEEGEFSDSEILVMMGENGTGKTTLIKLLAGALKPDEGQDIPKLNVSMKPQ 420
           +TQGDFVLNVE GEFSDSEILVMMGENGTGKTTLIKLLAGA+  D+G+DIPKLNVSMKPQ
Sbjct: 360 RTQGDFVLNVEPGEFSDSEILVMMGENGTGKTTLIKLLAGAIAADDGKDIPKLNVSMKPQ 419

Query: 421 KIAPKFPGTVRQLFFKKIRGQFLNPQFQTDVVKPLRIDDIIDQEVQHLSGGELQRVAIVL 480
           KIAPKFPGTVRQLFFK+IR QFLNPQFQTDV KPLRIDDIIDQEVQHLSGGELQRVAIVL
Sbjct: 420 KIAPKFPGTVRQLFFKRIRAQFLNPQFQTDVCKPLRIDDIIDQEVQHLSGGELQRVAIVL 479

Query: 481 ALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIV 540
           ALG+PADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIV
Sbjct: 480 ALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIV 539

Query: 541 FEGIPSKNAHARAPESLLTGCNRFLKNLNVTFRRDPNSFRPRINKLDSQMDKEQKSSG 598
           FEG PSKNA+AR PESLLTGCN+FLKNLNVTFRRDPNSFRPRINKLDSQMDKEQK SG
Sbjct: 540 FEGTPSKNAYARTPESLLTGCNKFLKNLNVTFRRDPNSFRPRINKLDSQMDKEQKLSG 597

>CAGL0G08041g complement(758811..760634) highly similar to tr|Q03195
           Saccharomyces cerevisiae YDR091c, start by similarity
          Length = 607

 Score = 1108 bits (2866), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 533/598 (89%), Positives = 566/598 (94%), Gaps = 1/598 (0%)

Query: 1   MSDKNSRIAIVSADKCKPKKCRQECKRSCPVVKTGKLCIEVTPTSKIAFISEILCIGCGI 60
           MSDK SRIA+V+AD+CKPKKCRQECKRSCPVVKTGKLCIEVTPTSKIAFISE+LCIGCGI
Sbjct: 1   MSDKGSRIAVVNADRCKPKKCRQECKRSCPVVKTGKLCIEVTPTSKIAFISEVLCIGCGI 60

Query: 61  CVKKCPFDAIQIINLPTNLEAHVTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL 120
           CVKKCPFDAI IINLPTNLE+HVTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL
Sbjct: 61  CVKKCPFDAITIINLPTNLESHVTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL 120

Query: 121 KILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLEDDIKAIIKPQYVDNIPRAI 180
           KILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLEDDIKAIIKPQYVDN+PRAI
Sbjct: 121 KILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLEDDIKAIIKPQYVDNLPRAI 180

Query: 181 KGPVQKVGELLKLRMEKSPEDVKRYIKILQLENVLKRDIEKLSGGELQRFAIGMSCVQEA 240
           KGPVQKVGELLKLRMEK  + VK+YIK LQL+++L R+I  LSGGELQRFAI MSCVQ+A
Sbjct: 181 KGPVQKVGELLKLRMEKPQDTVKQYIKTLQLDHLLNREIGLLSGGELQRFAIAMSCVQDA 240

Query: 241 DVYMFDEPSSYLDVKQRLNAAQIIRSLLAPTKYVICVEHDLSVLDYLSDFVCIIYGVPSV 300
           DVYMFDEPSSYLDVKQRLNAA IIRSLL P+KYVI VEHDLSVLDYLSDFVCI+YGVPSV
Sbjct: 241 DVYMFDEPSSYLDVKQRLNAALIIRSLLEPSKYVIAVEHDLSVLDYLSDFVCILYGVPSV 300

Query: 301 YGVVTLPASVREGINIFLDGHIPAENLRFRTEALQFRIADATEDLQNDSASRAFSYPSLK 360
           YGVVTLP+SVREGINIFLDGHIP+EN+RFRTEALQFRIAD+  D+  D A+RA+SYP +K
Sbjct: 301 YGVVTLPSSVREGINIFLDGHIPSENMRFRTEALQFRIADSAADIIVD-ATRAYSYPDMK 359

Query: 361 KTQGDFVLNVEEGEFSDSEILVMMGENGTGKTTLIKLLAGALKPDEGQDIPKLNVSMKPQ 420
           +TQGDF LNV+ GEFSDSEILVMMGENGTGKTTLIKLLAGA+  D+G  +PKLNVSMKPQ
Sbjct: 360 RTQGDFTLNVQSGEFSDSEILVMMGENGTGKTTLIKLLAGAIPADDGTSVPKLNVSMKPQ 419

Query: 421 KIAPKFPGTVRQLFFKKIRGQFLNPQFQTDVVKPLRIDDIIDQEVQHLSGGELQRVAIVL 480
            IAPKFPGTVRQLFFKKIR QFLNPQFQTDVVKPL+IDDIIDQEV+HLSGGELQRVAIVL
Sbjct: 420 TIAPKFPGTVRQLFFKKIRAQFLNPQFQTDVVKPLKIDDIIDQEVKHLSGGELQRVAIVL 479

Query: 481 ALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIV 540
           +LGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIV
Sbjct: 480 SLGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIV 539

Query: 541 FEGIPSKNAHARAPESLLTGCNRFLKNLNVTFRRDPNSFRPRINKLDSQMDKEQKSSG 598
           F+G PS+N  A APESLLTGCNRFLKNLNVTFRRDPNSFRPRINKLDSQMDKEQK SG
Sbjct: 540 FDGTPSQNTTATAPESLLTGCNRFLKNLNVTFRRDPNSFRPRINKLDSQMDKEQKLSG 597

>Scas_636.14
          Length = 608

 Score = 1107 bits (2863), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 537/599 (89%), Positives = 566/599 (94%), Gaps = 2/599 (0%)

Query: 1   MSDKNSRIAIVSADKCKPKKCRQECKRSCPVVKTGKLCIEVTPTSKIAFISEILCIGCGI 60
           MS+KNSRIAIVSAD+CKPKKCRQECKRSCPVVKTGKLCIEVTPTSKIAFISEILCIGCGI
Sbjct: 1   MSEKNSRIAIVSADRCKPKKCRQECKRSCPVVKTGKLCIEVTPTSKIAFISEILCIGCGI 60

Query: 61  CVKKCPFDAIQIINLPTNLEAHVTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL 120
           CVKKCPFDAI IINLPTNLE HVTHRYS NSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL
Sbjct: 61  CVKKCPFDAITIINLPTNLEQHVTHRYSVNSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL 120

Query: 121 KILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLEDDIKAIIKPQYVDNIPRAI 180
           KILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLED+IKAIIKPQYVDNIPRAI
Sbjct: 121 KILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLEDNIKAIIKPQYVDNIPRAI 180

Query: 181 KGPVQKVGELLKLRMEKSPEDVKRYIKILQLENVLKRDIEKLSGGELQRFAIGMSCVQEA 240
           KGPVQKVGELLKLRMEK  E VK YIK LQLE+VL R+I KLSGGELQRFAIG+SCVQ+A
Sbjct: 181 KGPVQKVGELLKLRMEKDSETVKGYIKTLQLEHVLNREIGKLSGGELQRFAIGLSCVQDA 240

Query: 241 DVYMFDEPSSYLDVKQRLNAAQIIRSLLAPTKYVICVEHDLSVLDYLSDFVCIIYGVPSV 300
           DVYMFDEPSSYLDVKQRLNAAQIIR LL PTKYVI VEHDLSVLDYLSDFVCIIYGVPSV
Sbjct: 241 DVYMFDEPSSYLDVKQRLNAAQIIRDLLTPTKYVIAVEHDLSVLDYLSDFVCIIYGVPSV 300

Query: 301 YGVVTLPASVREGINIFLDGHIPAENLRFRTEALQFRIADATEDLQNDSASRAFSYPSLK 360
           YGVVTLP+SVREGINIFLDGHIPAEN+RFR+EALQFR+ DATED + + A++ F YP++K
Sbjct: 301 YGVVTLPSSVREGINIFLDGHIPAENIRFRSEALQFRLHDATEDTKGE-ANKTFEYPAMK 359

Query: 361 KTQGDFVLNVEEGEFSDSEILVMMGENGTGKTTLIKLLAGALKPDEGQD-IPKLNVSMKP 419
           +TQGDF L VE G+FSDSEILVMMGENGTGKTTLIKLLAG ++ DE  + + KLNVSMKP
Sbjct: 360 RTQGDFSLTVESGDFSDSEILVMMGENGTGKTTLIKLLAGVIQSDENSEKVQKLNVSMKP 419

Query: 420 QKIAPKFPGTVRQLFFKKIRGQFLNPQFQTDVVKPLRIDDIIDQEVQHLSGGELQRVAIV 479
           Q IAPKFPGTVRQLFFKKIRGQFL+PQFQTDVVKPL+IDDIIDQEVQHLSGGELQRVAIV
Sbjct: 420 QTIAPKFPGTVRQLFFKKIRGQFLSPQFQTDVVKPLKIDDIIDQEVQHLSGGELQRVAIV 479

Query: 480 LALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVI 539
           LALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAF+VEHDFIMATYLADKVI
Sbjct: 480 LALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFVVEHDFIMATYLADKVI 539

Query: 540 VFEGIPSKNAHARAPESLLTGCNRFLKNLNVTFRRDPNSFRPRINKLDSQMDKEQKSSG 598
           VFEG PSK+A+ARAPESLLTGCNRFLKNLNVTFRRD  SFRPRINKLDSQMD+EQK SG
Sbjct: 540 VFEGTPSKHANARAPESLLTGCNRFLKNLNVTFRRDTTSFRPRINKLDSQMDREQKLSG 598

>Kwal_56.23429
          Length = 539

 Score =  996 bits (2576), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 476/539 (88%), Positives = 510/539 (94%)

Query: 1   MSDKNSRIAIVSADKCKPKKCRQECKRSCPVVKTGKLCIEVTPTSKIAFISEILCIGCGI 60
           MS KN+RIAIV+ DKCKPKKCRQECKRSCPVVKTGKLCIEVTPT+KIAFISE LCIGCGI
Sbjct: 1   MSTKNARIAIVNEDKCKPKKCRQECKRSCPVVKTGKLCIEVTPTNKIAFISETLCIGCGI 60

Query: 61  CVKKCPFDAIQIINLPTNLEAHVTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL 120
           CVKKCPFDAIQIINLPTNLE  VTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL
Sbjct: 61  CVKKCPFDAIQIINLPTNLEGEVTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL 120

Query: 121 KILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLEDDIKAIIKPQYVDNIPRAI 180
           KILAGKQKPNLGR+DDPPEWQ+II+YFRGSELQNYFTKMLED+IKAIIKPQYVDNIPRAI
Sbjct: 121 KILAGKQKPNLGRYDDPPEWQDIIRYFRGSELQNYFTKMLEDNIKAIIKPQYVDNIPRAI 180

Query: 181 KGPVQKVGELLKLRMEKSPEDVKRYIKILQLENVLKRDIEKLSGGELQRFAIGMSCVQEA 240
           KGPVQKVGELLKLR+E+S +D K  IK L L++VLKRD+  LSGGELQRFAIGMSCVQEA
Sbjct: 181 KGPVQKVGELLKLRLERSQDDAKYVIKALDLQHVLKRDVGALSGGELQRFAIGMSCVQEA 240

Query: 241 DVYMFDEPSSYLDVKQRLNAAQIIRSLLAPTKYVICVEHDLSVLDYLSDFVCIIYGVPSV 300
           DVYMFDEPSSYLDVKQRLNAA +IRSLL  T YVI VEHDLSVLDYLSDFVCI+YGVPSV
Sbjct: 241 DVYMFDEPSSYLDVKQRLNAALVIRSLLNATTYVISVEHDLSVLDYLSDFVCILYGVPSV 300

Query: 301 YGVVTLPASVREGINIFLDGHIPAENLRFRTEALQFRIADATEDLQNDSASRAFSYPSLK 360
           YGVVTLP+SVREGINIFL+GHIP+EN+RFR EALQFR+ DA E L+ + A+R+F+YPS+K
Sbjct: 301 YGVVTLPSSVREGINIFLEGHIPSENMRFRQEALQFRMVDAQEQLEAEDATRSFAYPSMK 360

Query: 361 KTQGDFVLNVEEGEFSDSEILVMMGENGTGKTTLIKLLAGALKPDEGQDIPKLNVSMKPQ 420
           +TQGDFVLNVE G FSDSEILVMMGENGTGKTTLIKLLAGAL PD+GQ +PKLNVSMKPQ
Sbjct: 361 RTQGDFVLNVESGSFSDSEILVMMGENGTGKTTLIKLLAGALSPDDGQKVPKLNVSMKPQ 420

Query: 421 KIAPKFPGTVRQLFFKKIRGQFLNPQFQTDVVKPLRIDDIIDQEVQHLSGGELQRVAIVL 480
           KIAPKFPGTVRQLFFK+IRGQFLNPQFQTDVVKPL+I+ IIDQEVQHLSGGELQRVAIVL
Sbjct: 421 KIAPKFPGTVRQLFFKRIRGQFLNPQFQTDVVKPLKIESIIDQEVQHLSGGELQRVAIVL 480

Query: 481 ALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVI 539
           ALG+PADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAF+VEHDFIMATYLADKVI
Sbjct: 481 ALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFLVEHDFIMATYLADKVI 539

 Score =  105 bits (263), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 81/242 (33%), Positives = 121/242 (50%), Gaps = 48/242 (19%)

Query: 379 EILVMMGENGTGKTTLIKLLAGALKPDEGQ--DIPKLNVSMKPQKIAPKFPGTVRQLFFK 436
           ++L ++G NG GK+T +K+LAG  KP+ G+  D P+       Q I   F G+  Q +F 
Sbjct: 104 QVLGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEW------QDIIRYFRGSELQNYFT 157

Query: 437 KIR----GQFLNPQF--------------------------QTD---VVKPLRIDDIIDQ 463
           K+        + PQ+                          Q D   V+K L +  ++ +
Sbjct: 158 KMLEDNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRLERSQDDAKYVIKALDLQHVLKR 217

Query: 464 EVQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFI 523
           +V  LSGGELQR AI ++    AD+Y+ DEPS+YLD +QR+  + VIR  +  N  T  I
Sbjct: 218 DVGALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALVIRSLL--NATTYVI 275

Query: 524 -VEHDFIMATYLADKVIVFEGIPSKNAHARAPESLLTGCNRFLK----NLNVTFRRDPNS 578
            VEHD  +  YL+D V +  G+PS       P S+  G N FL+    + N+ FR++   
Sbjct: 276 SVEHDLSVLDYLSDFVCILYGVPSVYGVVTLPSSVREGINIFLEGHIPSENMRFRQEALQ 335

Query: 579 FR 580
           FR
Sbjct: 336 FR 337

>YPL226W (NEW1) [5223] chr16 (121767..125357) Member of the
           non-transporter group of the ATP-binding cassette (ABC)
           superfamily, also a prion responsible for the [NU+]
           determinant [3591 bp, 1196 aa]
          Length = 1196

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 88/346 (25%), Positives = 136/346 (39%), Gaps = 49/346 (14%)

Query: 68  DAIQIINLPTNLEAHVTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTALKILAGKQ 127
           + I+I+N  T+       R   N   L  L     G   GL G NG GKST ++ +A   
Sbjct: 568 EGIEIVN--TDFSLAYGSRMLLNKTNLRLLK----GHRYGLCGRNGAGKSTLMRAIAN-- 619

Query: 128 KPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLEDDIKAIIKPQYVDNIPRAIKGPVQKV 187
               G+ D  P+   +   F   +LQ     +   D+ + I          A+   +Q  
Sbjct: 620 ----GQLDGFPDKDTLRTCFVEHKLQGEEGDL---DLVSFI----------ALDEELQST 662

Query: 188 G-ELLKLRMEKSPEDVKRYIKILQLENVLKRDIEKLSGGELQRFAIGMSCVQEADVYMFD 246
             E +   +E    D +R  +           +  LSGG   +  +  + +Q+AD+ + D
Sbjct: 663 SREEIAAALESVGFDEERRAQT----------VGSLSGGWKMKLELARAMLQKADILLLD 712

Query: 247 EPSSYLDVKQRLNAAQIIRSLLAPTKYV-ICVEHDLSVLDYLSDFVCIIYGVPSVYGVVT 305
           EP+++LDV    N   +   LL  T    + V HD   LD +   +         Y    
Sbjct: 713 EPTNHLDVS---NVKWLEEYLLEHTDITSLIVSHDSGFLDTVCTDIIHYENKKLAYYKGN 769

Query: 306 LPASVR---EGINIFLDGHIPAENLRFRTEALQFRIADATEDLQNDSASRAFSYPSLKKT 362
           L A V    E  + +      A+ +RF    +   +   T  +        FSYP  +K 
Sbjct: 770 LAAFVEQKPEAKSYYTLTDSNAQ-MRFPPPGILTGVKSNTRAVAK-MTDVTFSYPGAQKP 827

Query: 363 QGDFVLNVEEGEFSDSEILVMMGENGTGKTTLIKLLAGALKPDEGQ 408
               V        S S  +  +G NG GK+TLIKLL G L P+EG+
Sbjct: 828 SLSHV----SCSLSLSSRVACLGPNGAGKSTLIKLLTGELVPNEGK 869

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 41/81 (50%), Gaps = 5/81 (6%)

Query: 463 QEVQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFIL-HNKKTA 521
           Q V  LSGG   ++ +  A+   ADI L+DEP+ +LD    +   K +  ++L H   T+
Sbjct: 683 QTVGSLSGGWKMKLELARAMLQKADILLLDEPTNHLD----VSNVKWLEEYLLEHTDITS 738

Query: 522 FIVEHDFIMATYLADKVIVFE 542
            IV HD      +   +I +E
Sbjct: 739 LIVSHDSGFLDTVCTDIIHYE 759

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 20/30 (66%)

Query: 109 VGTNGIGKSTALKILAGKQKPNLGRFDDPP 138
           +G NG GKST +K+L G+  PN G+ +  P
Sbjct: 845 LGPNGAGKSTLIKLLTGELVPNEGKVEKHP 874

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 30/58 (51%), Gaps = 6/58 (10%)

Query: 468  LSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRF------ILHNKK 519
            LSGG+L +V I  A+     + ++DEP+ YLD +     +  IR +      I HN +
Sbjct: 1033 LSGGQLVKVVIAGAMWNNPHLLVLDEPTNYLDRDSLGALAVAIRDWSGGVVMISHNNE 1090

>AEL032W [2474] [Homologous to ScYFR009W (GCN20) - SH]
           complement(572196..574457) [2262 bp, 753 aa]
          Length = 753

 Score = 59.3 bits (142), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 51/189 (26%), Positives = 90/189 (47%), Gaps = 31/189 (16%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLEDDIK 165
           + LVG NG GK+T LK++  + +P  G     P  +  I YF     Q++   M   D+ 
Sbjct: 562 IALVGANGCGKTTLLKVMMEQLRPITGHVSRNPRLR--IGYF----TQHHIDSM---DLN 612

Query: 166 AIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKSPEDVKRYIKILQLENVLK-RDIEKLSG 224
           A      VD + +   G              K+ E+ +R++    +   L  + ++ LSG
Sbjct: 613 A----SAVDWMSKTFPG--------------KTDEEYRRHLGAFGITGSLGLQKMQLLSG 654

Query: 225 GELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAAQIIRSLLAPTKYVICVEHDLSVL 284
           G+  R A    C+    + + DEPS++LD    L+A  ++++L   +  V+ V HD+SV+
Sbjct: 655 GQKSRVAFAALCLNSPHILILDEPSNHLDTAG-LDA--LVQALKNFSGGVLMVSHDISVI 711

Query: 285 DYLSDFVCI 293
           D + D + +
Sbjct: 712 DSVCDEIWV 720

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 55/207 (26%), Positives = 90/207 (43%), Gaps = 40/207 (19%)

Query: 353 AFSYPSLKKTQGDFVLNVEEGEFSDSEILVMMGENGTGKTTLIKLLAGALKPDEGQ--DI 410
           +F Y   +    D  L+V+     DS I  ++G NG GKTTL+K++   L+P  G     
Sbjct: 539 SFGYDESQLLLKDVNLDVQ----MDSRI-ALVGANGCGKTTLLKVMMEQLRPITGHVSRN 593

Query: 411 PKLNVSMKPQK--------------IAPKFPGTVRQLFFKKIRGQFLNPQFQTDVVKPLR 456
           P+L +    Q               ++  FPG   + + + + G F        +   L 
Sbjct: 594 PRLRIGYFTQHHIDSMDLNASAVDWMSKTFPGKTDEEYRRHL-GAF-------GITGSLG 645

Query: 457 IDDIIDQEVQHLSGGELQRVAIV-LALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFIL 515
           +     Q++Q LSGG+  RVA   L L  P  I ++DEPS +LD+       + ++ F  
Sbjct: 646 L-----QKMQLLSGGQKSRVAFAALCLNSPH-ILILDEPSNHLDTAGLDALVQALKNF-- 697

Query: 516 HNKKTAFIVEHDFIMATYLADKVIVFE 542
                  +V HD  +   + D++ V E
Sbjct: 698 --SGGVLMVSHDISVIDSVCDEIWVSE 722

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 58/222 (26%), Positives = 99/222 (44%), Gaps = 39/222 (17%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQ------------KPNLGRFDDPPEWQEII------ 144
           G+  GLVG NGIGKST L+ L+ ++            +  L R DD    Q ++      
Sbjct: 226 GRRYGLVGQNGIGKSTLLRALSRRELNVPKHISILHVEQEL-RGDDTKVLQSVLDADVWR 284

Query: 145 KYFRGSELQNYFTKMLED--DIKA-----IIKPQYVDNIPRAIKGPVQKVGELLKLRMEK 197
           K     EL+    + L+D   ++A      ++ + +DN    ++  +Q++ E  KL   +
Sbjct: 285 KQLLSEELK--INERLQDIDKLRAEFDEDSLEVKKLDNERDDLESHLQQIAE--KLADME 340

Query: 198 SPEDVKRYIKILQ----LENVLKRDIEKLSGGELQRFAIGMSCVQEADVYMFDEPSSYLD 253
           S +   R   IL          ++     SGG   R ++  +   + D+ + DEPS+ LD
Sbjct: 341 SDKAEARAASILYGLGFSTEAQQKPTNSFSGGWRMRLSLARALFCQPDLLLLDEPSNMLD 400

Query: 254 VKQRLNAAQIIRSLLAPTKYVICVEHDLSVLDYLSDFVCIIY 295
           V      A+ +++  A    V+ V HD S L+ ++    IIY
Sbjct: 401 VPSIAYLAEYLKTYPAT---VLVVSHDRSFLNEVA--TDIIY 437

 Score = 30.8 bits (68), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 33/72 (45%), Gaps = 4/72 (5%)

Query: 468 LSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHD 527
            SGG   R+++  AL    D+ L+DEPS  LD       ++ ++ +      T  +V HD
Sbjct: 369 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPSIAYLAEYLKTY----PATVLVVSHD 424

Query: 528 FIMATYLADKVI 539
                 +A  +I
Sbjct: 425 RSFLNEVATDII 436

>Sklu_2403.5 YPL226W, Contig c2403 12436-15975 reverse complement
          Length = 1179

 Score = 59.3 bits (142), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 86/346 (24%), Positives = 141/346 (40%), Gaps = 49/346 (14%)

Query: 68  DAIQIINLPTNLEAHVTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTALKILAGKQ 127
           + I+I+N  T+       R   N   L  L     G   GL G NG GKST ++ +A   
Sbjct: 549 EGIEIVN--TDFSLAYGSRMLLNKTNLRLLK----GHRYGLCGRNGAGKSTLMRSIAN-- 600

Query: 128 KPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLEDDIKAIIKPQYVDNIPRAIKGPVQKV 187
               G+ +  P+   +   F   +LQ     +   D+ + I          A+   +Q V
Sbjct: 601 ----GQLEGFPDKDTLRTRFVEHKLQGEEGDL---DLVSFI----------ALDPELQGV 643

Query: 188 GELLKLRMEKSPEDVKRYIKILQLENVLK-RDIEKLSGGELQRFAIGMSCVQEADVYMFD 246
                     S ED+   ++ +  ++  + + +  LSGG   +  +  + +Q+ADV + D
Sbjct: 644 ----------SREDIANALESVGFDDYRRSQTVGSLSGGWKMKLELARAMLQKADVLLLD 693

Query: 247 EPSSYLDVKQRLNAAQIIRSLLAPTKYV-ICVEHDLSVLDYLSDFVCIIYGVPSVYGVVT 305
           EP+++LDV    N   +   LL  T+   + V HD   LD +   +         Y    
Sbjct: 694 EPTNHLDVA---NVKWLEDYLLEHTEITSLIVSHDSGFLDAVCTEIIHYENKKLAYYKGN 750

Query: 306 LPASVR---EGINIFLDGHIPAENLRFRTEALQFRIADATEDLQNDSASRAFSYPSLKKT 362
           L A V    E    +      A+ +RF    +   +   T  +   +   +F+YP   + 
Sbjct: 751 LAAFVEQKPEAKAYYTLTDTNAQ-MRFPPPGILTGVKSNTRAVAKVTGV-SFTYPGASQP 808

Query: 363 QGDFVLNVEEGEFSDSEILVMMGENGTGKTTLIKLLAGALKPDEGQ 408
                L       S S  + ++G NG GK+TLIKLL G L P EG+
Sbjct: 809 S----LTDVSCSLSLSSRVAVLGPNGAGKSTLIKLLTGELVPQEGK 850

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 44/170 (25%), Positives = 80/170 (47%), Gaps = 22/170 (12%)

Query: 383 MMGENGTGKTTLIKLLA-GALKPDEGQDIPKLNVSMKPQKIAPKFPGTVRQLFFKKIRGQ 441
           + G NG GK+TL++ +A G L+    +D      +++ + +  K  G    L        
Sbjct: 583 LCGRNGAGKSTLMRSIANGQLEGFPDKD------TLRTRFVEHKLQGEEGDLDLVSFIA- 635

Query: 442 FLNPQFQ-------TDVVKPLRIDDII-DQEVQHLSGGELQRVAIVLALGIPADIYLIDE 493
            L+P+ Q        + ++ +  DD    Q V  LSGG   ++ +  A+   AD+ L+DE
Sbjct: 636 -LDPELQGVSREDIANALESVGFDDYRRSQTVGSLSGGWKMKLELARAMLQKADVLLLDE 694

Query: 494 PSAYLDSEQRIICSKVIRRFIL-HNKKTAFIVEHDFIMATYLADKVIVFE 542
           P+ +LD    +   K +  ++L H + T+ IV HD      +  ++I +E
Sbjct: 695 PTNHLD----VANVKWLEDYLLEHTEITSLIVSHDSGFLDAVCTEIIHYE 740

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 30/58 (51%), Gaps = 6/58 (10%)

Query: 468  LSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRF------ILHNKK 519
            LSGG+L +V I  A+     + ++DEP+ YLD +     +  IR +      I HN +
Sbjct: 1014 LSGGQLVKVVIAGAMWNNPHLLVLDEPTNYLDRDSLGALAVAIRDWTGGVVMISHNNE 1071

 Score = 30.8 bits (68), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 21/33 (63%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLGRFDDPP 138
           + ++G NG GKST +K+L G+  P  G+ +  P
Sbjct: 823 VAVLGPNGAGKSTLIKLLTGELVPQEGKVEKHP 855

>KLLA0C16115g 1405766..1409317 similar to sgd|S0006147 Saccharomyces
           cerevisiae YPL226w NEW1, start by similarity
          Length = 1183

 Score = 59.3 bits (142), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 87/359 (24%), Positives = 137/359 (38%), Gaps = 75/359 (20%)

Query: 68  DAIQIINLPTNLEAHVTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTALKILAGKQ 127
           + I+I+N  T+       R   N   L  L     G   GL G NG GKST ++ +A   
Sbjct: 554 EGIEIVN--TDFSLAYGSRMLLNKTNLRLLK----GHRYGLCGRNGAGKSTLMRSIAN-- 605

Query: 128 KPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLEDDIKAIIKPQYVDNIPRAIKGPVQKV 187
               G+ +  P+   +   F   +LQ       E D+         D +      P+ K 
Sbjct: 606 ----GQLEGFPDKDTLRTCFVEHKLQGE-----EGDL---------DLVSFIALDPILK- 646

Query: 188 GELLKLRMEKSPEDVKRYIKILQLENVLK-RDIEKLSGGELQRFAIGMSCVQEADVYMFD 246
                   + S ED+   ++ +  ++  + + +  LSGG   +  +  + +Q ADV + D
Sbjct: 647 --------DVSKEDISNALESVGFDDYRRSQTVGSLSGGWKMKLELARAMLQRADVLLLD 698

Query: 247 EPSSYLDVKQRLNAAQIIRSLLAPTKYV-ICVEHDLSVLD----------------YLSD 289
           EP+++LDV    N   +   LL  T    + V HD   LD                Y  +
Sbjct: 699 EPTNHLDVA---NVKWLQDYLLEHTDITSLIVSHDSGFLDTVCTDIIHYENKKLAYYKGN 755

Query: 290 FVCIIYGVPSVYGVVTLPASVREGINIFLDGHIPAENLRFRTEALQFRIADATEDLQNDS 349
               +   P      TL  S  +        H P   +    ++    +A  T+      
Sbjct: 756 LADFVEQKPEAKAYYTLTNSNAQ-------MHFPPPGILSGVKSNTRAVAKMTD------ 802

Query: 350 ASRAFSYPSLKKTQGDFVLNVEEGEFSDSEILVMMGENGTGKTTLIKLLAGALKPDEGQ 408
               F+YP   K      L+      S S  + ++G NG GK+TLIKLL G L PD G+
Sbjct: 803 --VTFTYPGASKPS----LSNVSCALSLSSRVAILGPNGAGKSTLIKLLNGELLPDSGK 855

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 61/245 (24%), Positives = 106/245 (43%), Gaps = 67/245 (27%)

Query: 340 DATEDLQND--SASRAFSYPSLKKTQGDFVLNVEEGEFS---DSEILV------------ 382
           D+ E ++ND  +  R+  +   KKT  D  + +   +FS    S +L+            
Sbjct: 526 DSAEFIENDIVNVMRSVFHQERKKTDEDEGIEIVNTDFSLAYGSRMLLNKTNLRLLKGHR 585

Query: 383 --MMGENGTGKTTLIKLLA-GALKPDEGQDIPKLNVSMKPQKIAPKFPG--TVRQLFFK- 436
             + G NG GK+TL++ +A G L   EG                  FP   T+R  F + 
Sbjct: 586 YGLCGRNGAGKSTLMRSIANGQL---EG------------------FPDKDTLRTCFVEH 624

Query: 437 KIRGQ----------FLNPQFQ-------TDVVKPLRIDDII-DQEVQHLSGGELQRVAI 478
           K++G+           L+P  +       ++ ++ +  DD    Q V  LSGG   ++ +
Sbjct: 625 KLQGEEGDLDLVSFIALDPILKDVSKEDISNALESVGFDDYRRSQTVGSLSGGWKMKLEL 684

Query: 479 VLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFIL-HNKKTAFIVEHDFIMATYLADK 537
             A+   AD+ L+DEP+ +LD    +   K ++ ++L H   T+ IV HD      +   
Sbjct: 685 ARAMLQRADVLLLDEPTNHLD----VANVKWLQDYLLEHTDITSLIVSHDSGFLDTVCTD 740

Query: 538 VIVFE 542
           +I +E
Sbjct: 741 IIHYE 745

 Score = 33.5 bits (75), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 45/105 (42%), Gaps = 4/105 (3%)

Query: 468  LSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHD 527
            LSGG+L +V I  A+     + ++DEP+ YLD +     +  IR +         I  ++
Sbjct: 1020 LSGGQLVKVVIAGAMWNNPHLLVLDEPTNYLDRDSLGALAMAIREW---TGGVVMISHNN 1076

Query: 528  FIMATYLADKVIVFEGIPSKNAHARAPESLLT-GCNRFLKNLNVT 571
              +     ++ IV  G   +   A   +S    G N     LNVT
Sbjct: 1077 EFVGALCPEQWIVENGTMVQKGIAEIDQSRFEDGGNTNAVGLNVT 1121

 Score = 31.2 bits (69), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 22/33 (66%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLGRFDDPP 138
           + ++G NG GKST +K+L G+  P+ G+ +  P
Sbjct: 828 VAILGPNGAGKSTLIKLLNGELLPDSGKVEKHP 860

>CAGL0B03487g complement(345399..348536) highly similar to sp|P16521
           Saccharomyces cerevisiae YLR249w YEF3 or sp|P53978
           Saccharomyces cerevisiae YNL014w HEF3, start by
           similarity
          Length = 1045

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 71/309 (22%), Positives = 122/309 (39%), Gaps = 43/309 (13%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLED 162
           G+  GL G NG GKST ++ +A       G+ D  P  +E +  +            +E 
Sbjct: 456 GRRYGLCGPNGAGKSTLMRAIAN------GQVDGFPTPEECMTVY------------VEH 497

Query: 163 DIKAIIKPQYV-DNIPRAIKGPVQKVGELLKLRMEKSPEDVKRYIKILQLENVLKRDIEK 221
           DI        V D +  +  G  + +                + ++    E ++   I  
Sbjct: 498 DIDGTHADTSVLDFVVSSEVGTKEAI--------------TAKLVEFGFTEEMINMPISS 543

Query: 222 LSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAAQIIRSLLAPTKYVICVEHDL 281
           LSGG   + A+  + ++ AD+ + DEP+++LD    +N A ++  L       + V HD 
Sbjct: 544 LSGGWKMKLALARAVLKNADILLLDEPTNHLDT---VNVAWLVNYLNTCGITSVIVSHDS 600

Query: 282 SVLDYLSDFVCIIYGVPSVYGVVTLPASVREGINIFLDGHIPAENLRFR-TEALQFRIAD 340
             LD +  ++    G+        L   V++         + A +L F+  E        
Sbjct: 601 GFLDNVCQYIIHYEGLKLRKYKGNLSEFVKKCPTAQSYYELGASDLEFKFPEPGYLEGVK 660

Query: 341 ATEDLQNDSASRAFSYPSLKKTQ-GDFVLNVEEGEFSDSEILVMMGENGTGKTTLIKLLA 399
             +      ++  F YP   K Q  D        + S S  + ++G NG GK+TLI +L 
Sbjct: 661 TKQKAIVKVSNMTFQYPGTSKPQISDISF-----QCSLSSRIAVIGPNGAGKSTLINVLT 715

Query: 400 GALKPDEGQ 408
           G L P  G+
Sbjct: 716 GELLPTSGE 724

 Score = 38.9 bits (89), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 46/87 (52%), Gaps = 4/87 (4%)

Query: 458 DDIIDQEVQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHN 517
           +++I+  +  LSGG   ++A+  A+   ADI L+DEP+ +LD+    +    +  ++   
Sbjct: 534 EEMINMPISSLSGGWKMKLALARAVLKNADILLLDEPTNHLDT----VNVAWLVNYLNTC 589

Query: 518 KKTAFIVEHDFIMATYLADKVIVFEGI 544
             T+ IV HD      +   +I +EG+
Sbjct: 590 GITSVIVSHDSGFLDNVCQYIIHYEGL 616

 Score = 31.6 bits (70), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 38/86 (44%), Gaps = 3/86 (3%)

Query: 209 LQLENVLKRDIEKLSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAAQIIRSLL 268
           L  E V    I  LSGG+  +  +     Q   + + DEP++YLD   R +   + ++L 
Sbjct: 884 LDAELVSHSRIRGLSGGQKVKLVLAACSWQRPHLIVLDEPTNYLD---RDSLGALSKALK 940

Query: 269 APTKYVICVEHDLSVLDYLSDFVCII 294
           A    VI + H       L++ V  +
Sbjct: 941 AFEGGVIIITHSAEFTKNLTEEVWAV 966

>Sklu_2187.2 YFR009W, Contig c2187 2884-5142 reverse complement
          Length = 752

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 49/189 (25%), Positives = 86/189 (45%), Gaps = 31/189 (16%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLEDDIK 165
           + LVG NG GK+T LK++  + +P  G     P  +             YFT+   D + 
Sbjct: 561 IALVGANGCGKTTLLKVMMEQLRPTKGYVSRNPRLR-----------IGYFTQHHVDSMD 609

Query: 166 AIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKSPEDVKRYIKILQLENVLK-RDIEKLSG 224
             +    VD + +   G              K+ E+ +R++    +   L  + ++ LSG
Sbjct: 610 --LNTSAVDWMSKTFPG--------------KTDEEYRRHLGAFGITGSLGLQKMQLLSG 653

Query: 225 GELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAAQIIRSLLAPTKYVICVEHDLSVL 284
           G+  R A    C+    + + DEPS++LD    L+A  +I +L   T  V+ V HD+SV+
Sbjct: 654 GQKSRVAFAALCLNNPHILVLDEPSNHLDTAG-LDA--LIDALKNFTGGVLMVSHDISVI 710

Query: 285 DYLSDFVCI 293
           D++   + +
Sbjct: 711 DHVCSEIWV 719

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 49/183 (26%), Positives = 81/183 (44%), Gaps = 36/183 (19%)

Query: 377 DSEILVMMGENGTGKTTLIKLLAGALKPDEG--QDIPKLNVSMKPQK------------- 421
           DS I  ++G NG GKTTL+K++   L+P +G     P+L +    Q              
Sbjct: 558 DSRI-ALVGANGCGKTTLLKVMMEQLRPTKGYVSRNPRLRIGYFTQHHVDSMDLNTSAVD 616

Query: 422 -IAPKFPGTVRQLFFKKIRGQFLNPQFQTDVVKPLRIDDIIDQEVQHLSGGELQRVAI-V 479
            ++  FPG   + + + + G F        +   L +     Q++Q LSGG+  RVA   
Sbjct: 617 WMSKTFPGKTDEEYRRHL-GAF-------GITGSLGL-----QKMQLLSGGQKSRVAFAA 663

Query: 480 LALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVI 539
           L L  P  I ++DEPS +LD+         ++ F         +V HD  +  ++  ++ 
Sbjct: 664 LCLNNPH-ILVLDEPSNHLDTAGLDALIDALKNFT----GGVLMVSHDISVIDHVCSEIW 718

Query: 540 VFE 542
           V E
Sbjct: 719 VSE 721

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 49/217 (22%), Positives = 93/217 (42%), Gaps = 29/217 (13%)

Query: 103 GQVLGLVGTNGIGKSTALKILA--------------------GKQKPNLGRFDDPPEW-- 140
           G+  GLVG NGIGKST L+ L+                    G +   L    D   W  
Sbjct: 225 GRRYGLVGQNGIGKSTLLRALSRRELNVPKHISILHVEQELRGDETKALQSVLDADVWRK 284

Query: 141 QEIIKYFRGSELQNYFTKMLEDDIKAIIKPQYVDNIPRAIKGPVQKVGE-LLKLRMEKSP 199
           Q + +  + +E      K+ E+  +  ++ + +DN    +   ++++ E L+ +  +K+ 
Sbjct: 285 QLLSEESKINERLQEIEKLREEFDEDSLEVKKLDNEREDLDNHLEQISEKLVDMESDKAE 344

Query: 200 EDVKRYIKILQLEN-VLKRDIEKLSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRL 258
                 +  L       ++     SGG   R ++  +   + D+ + DEPS+ LDV    
Sbjct: 345 ARAASILYGLGFSTEAQQKPTNSFSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPSIA 404

Query: 259 NAAQIIRSLLAPTKYVICVEHDLSVLDYLSDFVCIIY 295
             ++ +++  A    V+ V HD + L+ ++    IIY
Sbjct: 405 YLSEYLKTYPAT---VLVVSHDRAFLNEVA--TDIIY 436

 Score = 32.7 bits (73), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 33/72 (45%), Gaps = 4/72 (5%)

Query: 468 LSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHD 527
            SGG   R+++  AL    D+ L+DEPS  LD       S+ ++ +      T  +V HD
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPSIAYLSEYLKTY----PATVLVVSHD 423

Query: 528 FIMATYLADKVI 539
                 +A  +I
Sbjct: 424 RAFLNEVATDII 435

>Scas_720.36
          Length = 1190

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 77/323 (23%), Positives = 118/323 (36%), Gaps = 67/323 (20%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLED 162
           G   GL G NG GKST ++ +A       G+ D  P+   +   F   +LQ       E 
Sbjct: 593 GHRYGLCGRNGAGKSTLMRAIAN------GQLDGFPDKDTLRTCFVEHKLQGE-----EG 641

Query: 163 DIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKSPEDVKRYIKILQLENVLKRDIEKL 222
           D+  +      + +    +  +    E +    E+  + V                   L
Sbjct: 642 DLDLVSFIALDEELQATSREEISNALEHVGFDEERRAQTVG-----------------SL 684

Query: 223 SGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAAQIIRSLLAPTKYV-ICVEHDL 281
           SGG   +  +  + +Q+AD+ + DEP+++LDV    N   +   LL  T    + V HD 
Sbjct: 685 SGGWKMKLELARAMLQKADILLLDEPTNHLDVS---NVKWLQDYLLEHTDITSLIVSHDS 741

Query: 282 SVLD----------------YLSDFVCIIYGVPSVYGVVTLPASVREGINIFLDGHIPAE 325
             LD                Y  +    +   P      TL  S  +        H P  
Sbjct: 742 GFLDTVCTDIIHYENKKLAYYKGNLADFVEQKPEAKSYYTLSDSNAQM-------HFPPP 794

Query: 326 NLRFRTEALQFRIADATEDLQNDSASRAFSYPSLKKTQGDFVLNVEEGEFSDSEILVMMG 385
            +    ++    +A  T+          FSYP   K     V        S S  + ++G
Sbjct: 795 GILTGVKSNTRAVAKMTD--------VTFSYPGADKPSLSHV----SCALSLSSRVAVLG 842

Query: 386 ENGTGKTTLIKLLAGALKPDEGQ 408
            NG GK+TLIKLL G L P EG+
Sbjct: 843 PNGAGKSTLIKLLTGELVPQEGK 865

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 42/81 (51%), Gaps = 5/81 (6%)

Query: 463 QEVQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFIL-HNKKTA 521
           Q V  LSGG   ++ +  A+   ADI L+DEP+ +LD    +   K ++ ++L H   T+
Sbjct: 679 QTVGSLSGGWKMKLELARAMLQKADILLLDEPTNHLD----VSNVKWLQDYLLEHTDITS 734

Query: 522 FIVEHDFIMATYLADKVIVFE 542
            IV HD      +   +I +E
Sbjct: 735 LIVSHDSGFLDTVCTDIIHYE 755

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 26/46 (56%)

Query: 468  LSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRF 513
            LSGG+L +V I  A+     + ++DEP+ YLD +     +  IR +
Sbjct: 1029 LSGGQLVKVVIAGAMWNNPHLLVLDEPTNYLDRDSLGALAIAIRDW 1074

 Score = 30.8 bits (68), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 21/33 (63%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLGRFDDPP 138
           + ++G NG GKST +K+L G+  P  G+ +  P
Sbjct: 838 VAVLGPNGAGKSTLIKLLTGELVPQEGKVEKHP 870

>Kwal_0.327
          Length = 1019

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 57/212 (26%), Positives = 88/212 (41%), Gaps = 32/212 (15%)

Query: 367 VLNVEEGEFSDSEILVMMGENGTGKTTLIKLLAGALKPDEGQDIPKLNVSMKPQKIAPKF 426
           +LN   G     EI+ +MG +G GKTTL+ +LA   K  +     K+N S   ++   K 
Sbjct: 384 ILNGISGSVKPGEIMALMGGSGAGKTTLLDILAMKDKAGKASGSIKINGSEITKQNLSKI 443

Query: 427 PGTVRQLFF----KKIRGQFLNPQFQ---------------TDVVKPLRIDDIIDQEV-- 465
            G V Q  F      +    LN                     V++ LRI DI D+ +  
Sbjct: 444 AGFVDQENFLLPTLTVYETVLNSALLRLPRKLSFVQKQKRVYQVLEELRILDIKDRIIGD 503

Query: 466 ---QHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAF 522
              + +SGGE +RV+I   L     +  +DEP++ LDS       + + R  LH  +T  
Sbjct: 504 DLERGISGGEKRRVSIACELVTSPSVLFLDEPTSGLDSNNANNVIECLVRLALHYNRTLI 563

Query: 523 IVEH--------DFIMATYLADKVIVFEGIPS 546
           +  H         F     L+   +VF G+ +
Sbjct: 564 LSIHQPRSNIFKSFDKLVLLSQGEMVFSGVAT 595

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 47/174 (27%), Positives = 77/174 (44%), Gaps = 20/174 (11%)

Query: 101 RPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGS-----ELQNY 155
           +PG+++ L+G +G GK+T L ILA K K             EI K          + +N+
Sbjct: 393 KPGEIMALMGGSGAGKTTLLDILAMKDKAGKASGSIKINGSEITKQNLSKIAGFVDQENF 452

Query: 156 FTKMLEDDIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKSPEDVKRYIKILQLENVL 215
               L   +   +    +  +PR +   VQK   + ++  E    D+K        + ++
Sbjct: 453 LLPTL--TVYETVLNSALLRLPRKLS-FVQKQKRVYQVLEELRILDIK--------DRII 501

Query: 216 KRDIEK-LSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAAQIIRSLL 268
             D+E+ +SGGE +R +I    V    V   DEP+S LD     NA  +I  L+
Sbjct: 502 GDDLERGISGGEKRRVSIACELVTSPSVLFLDEPTSGLDSN---NANNVIECLV 552

>Scas_618.3
          Length = 793

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 49/190 (25%), Positives = 88/190 (46%), Gaps = 33/190 (17%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQ-NYFTKMLEDDI 164
           + LVG NG GK+T LK++  + +P  G               R   L+  YFT+   D +
Sbjct: 602 IALVGANGCGKTTLLKVMMEELRPTKGFVS------------RNGRLRIGYFTQHHVDSM 649

Query: 165 KAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKSPEDVKRYIKILQLENVLK-RDIEKLS 223
              +    VD + +A  G              K+ E+ + ++    +   L  + +E LS
Sbjct: 650 D--LTTSAVDWMSKAYPG--------------KTDEEYRHHLGSFGITGTLGLQKMELLS 693

Query: 224 GGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAAQIIRSLLAPTKYVICVEHDLSV 283
           GG+  R A    C+    + + DEPS++LD    L+A  ++ SL   +  V+ V HD+S+
Sbjct: 694 GGQKSRVAFAALCLNNPHILVLDEPSNHLDTTG-LDA--LVESLKNFSGGVLMVSHDISI 750

Query: 284 LDYLSDFVCI 293
           +D++ + + +
Sbjct: 751 IDHVCNEIWV 760

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 44/183 (24%), Positives = 82/183 (44%), Gaps = 36/183 (19%)

Query: 377 DSEILVMMGENGTGKTTLIKLLAGALKPDEG---------------QDIPKLNVSMKP-Q 420
           DS I  ++G NG GKTTL+K++   L+P +G                 +  ++++     
Sbjct: 599 DSRI-ALVGANGCGKTTLLKVMMEELRPTKGFVSRNGRLRIGYFTQHHVDSMDLTTSAVD 657

Query: 421 KIAPKFPGTVRQLFFKKIRGQFLNPQFQTDVVKPLRIDDIIDQEVQHLSGGELQRVAI-V 479
            ++  +PG   + +   + G F        +   L +     Q+++ LSGG+  RVA   
Sbjct: 658 WMSKAYPGKTDEEYRHHL-GSF-------GITGTLGL-----QKMELLSGGQKSRVAFAA 704

Query: 480 LALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVI 539
           L L  P  I ++DEPS +LD+       + ++ F         +V HD  +  ++ +++ 
Sbjct: 705 LCLNNPH-ILVLDEPSNHLDTTGLDALVESLKNF----SGGVLMVSHDISIIDHVCNEIW 759

Query: 540 VFE 542
           V E
Sbjct: 760 VSE 762

 Score = 36.2 bits (82), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 52/229 (22%), Positives = 100/229 (43%), Gaps = 53/229 (23%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEII---KYFRGSE---LQN-- 154
           G   GLVG NGIGKST L+ L+ ++        + P+   I+   +  RG E   LQ+  
Sbjct: 266 GHRYGLVGQNGIGKSTLLRALSRREL-------NVPKHVSILHVEQELRGDETLALQSVL 318

Query: 155 ----YFTKMLEDDIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKSPEDVKRYI---- 206
               +  ++L ++ K   + + +D +    +    +V +L     +   ED+ +++    
Sbjct: 319 DADVWRKQLLSEEAKINERLKEMDKLRSEFEEDSLEVKKL-----DNEREDLDKHLIQID 373

Query: 207 -KILQLEN-------------------VLKRDIEKLSGGELQRFAIGMSCVQEADVYMFD 246
            K+  +E+                     ++     SGG   R ++  +   + D+ + D
Sbjct: 374 EKLADMESDKAEARAASILYGLGFSTEAQQKPTNSFSGGWRMRLSLARALFCQPDLLLLD 433

Query: 247 EPSSYLDVKQRLNAAQIIRSLLAPTKYVICVEHDLSVLDYLSDFVCIIY 295
           EPS+ LDV      A+ +++   P+  V+ V HD + L+ ++    IIY
Sbjct: 434 EPSNMLDVPSIAYLAEYLKTY--PST-VLTVSHDRAFLNEVA--TDIIY 477

 Score = 30.8 bits (68), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 32/72 (44%), Gaps = 4/72 (5%)

Query: 468 LSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHD 527
            SGG   R+++  AL    D+ L+DEPS  LD       ++ ++ +      T   V HD
Sbjct: 409 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPSIAYLAEYLKTY----PSTVLTVSHD 464

Query: 528 FIMATYLADKVI 539
                 +A  +I
Sbjct: 465 RAFLNEVATDII 476

>YNL014W (HEF3) [4572] chr14 (606317..609451) Translation elongation
           factor EF-3B, member of the non-transporter group of the
           ATP-binding cassette (ABC) superfamily [3135 bp, 1044
           aa]
          Length = 1044

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 73/314 (23%), Positives = 126/314 (40%), Gaps = 53/314 (16%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLED 162
           G+  GL G NG GKST ++ +A       G+ D  P   E    +   ++ N  + M   
Sbjct: 456 GRRYGLCGPNGAGKSTLMRSIAN------GQVDGFPTQDECRTVYVEHDIDNTHSDM--- 506

Query: 163 DIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKSPEDVKRYIKILQLENVLKRDIEKL 222
              +++   Y  N+     G    +   LK              +    + +++  I  L
Sbjct: 507 ---SVLDFVYSGNV-----GTKDVITSKLK--------------EFGFSDEMIEMPIASL 544

Query: 223 SGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAAQIIRSLLAPTKYVICVEHDLS 282
           SGG   + A+  + +++AD+ + DEP+++LD    +N   ++  L       + V HD  
Sbjct: 545 SGGWKMKLALARAVLKDADILLLDEPTNHLDT---VNVEWLVNYLNTCGITSVIVSHDSG 601

Query: 283 VLDYLSDFVCIIYGVPSVYGVVTLPASVREGINIFLDGHIPAENLRFRTEALQFRIADAT 342
            LD +  ++    G+        L   V++         + A +L F     QF      
Sbjct: 602 FLDKVCQYIIHYEGLKLRKYKGNLSEFVQKCPTAQSYYELGASDLEF-----QFPTPGYL 656

Query: 343 EDLQNDS------ASRAFSYPSLKKTQGDFVLNVEEGEF--SDSEILVMMGENGTGKTTL 394
           E ++         ++  F YP   K Q      V +  F  S S  + ++G NG GK+TL
Sbjct: 657 EGVKTKQKAIVKVSNMTFQYPGTTKPQ------VSDVTFQCSLSSRIAVIGPNGAGKSTL 710

Query: 395 IKLLAGALKPDEGQ 408
           I +L G L P  G+
Sbjct: 711 INVLTGELLPTSGE 724

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 47/87 (54%), Gaps = 4/87 (4%)

Query: 458 DDIIDQEVQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHN 517
           D++I+  +  LSGG   ++A+  A+   ADI L+DEP+ +LD+    +  + +  ++   
Sbjct: 534 DEMIEMPIASLSGGWKMKLALARAVLKDADILLLDEPTNHLDT----VNVEWLVNYLNTC 589

Query: 518 KKTAFIVEHDFIMATYLADKVIVFEGI 544
             T+ IV HD      +   +I +EG+
Sbjct: 590 GITSVIVSHDSGFLDKVCQYIIHYEGL 616

 Score = 33.1 bits (74), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 38/86 (44%), Gaps = 3/86 (3%)

Query: 209 LQLENVLKRDIEKLSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAAQIIRSLL 268
           L  E V    I  LSGG+  +  +     Q   + + DEP++YLD   R +   + ++L 
Sbjct: 884 LDSELVSHSRIRGLSGGQKVKLVLAACTWQRPHLIVLDEPTNYLD---RDSLGALSKALK 940

Query: 269 APTKYVICVEHDLSVLDYLSDFVCII 294
           A    VI + H       L+D V  +
Sbjct: 941 AFEGGVIIITHSAEFTKNLTDEVWAV 966

 Score = 31.2 bits (69), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 37/76 (48%), Gaps = 8/76 (10%)

Query: 465 VQHLSGGELQRVAIVLALGIPADIYLI--DEPSAYLDSEQRIICSKVIRRFILHNKKTAF 522
           ++ LSGG  Q+V +VLA       +LI  DEP+ YLD +     SK ++ F    +    
Sbjct: 894 IRGLSGG--QKVKLVLAACTWQRPHLIVLDEPTNYLDRDSLGALSKALKAF----EGGVI 947

Query: 523 IVEHDFIMATYLADKV 538
           I+ H       L D+V
Sbjct: 948 IITHSAEFTKNLTDEV 963

>Kwal_0.167
          Length = 1044

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 52/192 (27%), Positives = 82/192 (42%), Gaps = 10/192 (5%)

Query: 219 IEKLSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAAQIIRSLLAPTKYVICVE 278
           I  LSGG   + A+  + ++ AD+ + DEP+++LD    +N A ++  L       I V 
Sbjct: 541 ISSLSGGWKMKLALARAVLKNADILLLDEPTNHLDT---VNVAWLVNYLNTCGITSIIVS 597

Query: 279 HDLSVLDYLSDFVCIIYGVPSVYGVVTLPASVREGINIFLDGHIPAENLRFRTEALQFRI 338
           HD   LD ++ ++    G+        +   V++         + A  L FR     F  
Sbjct: 598 HDSGFLDNVTQYIIHYEGLKLRKYKGNMSEFVKKCPTAKSYYELGASELEFRFPEPGFLE 657

Query: 339 ADATEDLQNDSASR-AFSYPSLKKTQ-GDFVLNVEEGEFSDSEILVMMGENGTGKTTLIK 396
              T+       S   F YP   K Q  D        + S S  + ++G NG GK+TLI 
Sbjct: 658 GVKTKQKAIVKVSNMTFQYPGTSKPQISDISF-----QCSLSSRIAVIGPNGAGKSTLIN 712

Query: 397 LLAGALKPDEGQ 408
           +L G L P  G+
Sbjct: 713 VLTGELLPTSGE 724

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 42/164 (25%), Positives = 77/164 (46%), Gaps = 10/164 (6%)

Query: 383 MMGENGTGKTTLIKLLA-GALKPDEGQDIPKLNVSMKPQKIAPKFPGTVRQLFFKKIRGQ 441
           + G NG GK+TL++ +A G +     QD  +  V ++          +V    F+   G 
Sbjct: 461 LCGPNGAGKSTLMRAIANGQVDGFPTQDECR-TVYVEHDIDGTHSDTSVLDFVFQ---GD 516

Query: 442 FLNPQFQTDVVKPLRI-DDIIDQEVQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDS 500
               +  TD ++     D++I+  +  LSGG   ++A+  A+   ADI L+DEP+ +LD+
Sbjct: 517 VGTKEAITDKLREFGFSDEMINMPISSLSGGWKMKLALARAVLKNADILLLDEPTNHLDT 576

Query: 501 EQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIVFEGI 544
               +    +  ++     T+ IV HD      +   +I +EG+
Sbjct: 577 ----VNVAWLVNYLNTCGITSIIVSHDSGFLDNVTQYIIHYEGL 616

 Score = 32.3 bits (72), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 43/99 (43%), Gaps = 6/99 (6%)

Query: 209 LQLENVLKRDIEKLSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAAQIIRSLL 268
           L  E V    I  LSGG+  +  +     Q   + + DEP++YLD   R +   + ++L 
Sbjct: 884 LDSELVSHSRIRGLSGGQKVKLVLAACSWQRPHLIVLDEPTNYLD---RDSLGALSKALK 940

Query: 269 APTKYVICVEHDLSVLDYLSDFVCIIYG---VPSVYGVV 304
           A    VI + H       L++ V  +     VPS +  V
Sbjct: 941 AFEGGVIIITHSAEFTKNLTEEVWAVNNGVMVPSGHNWV 979

>AFL131W [3064] [Homologous to ScYPL226W (NEW1) - SH]
           complement(186656..190225) [3570 bp, 1189 aa]
          Length = 1189

 Score = 56.2 bits (134), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 81/333 (24%), Positives = 126/333 (37%), Gaps = 87/333 (26%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLED 162
           G   GL G NG GKST ++ ++       G+ +  P   E+   F               
Sbjct: 590 GHRYGLCGRNGAGKSTLMRSISN------GQLEGFPSQDELKTCF--------------- 628

Query: 163 DIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKSPEDVKRYIKILQLENV------LK 216
                        + RA++G    V  +  L    S E+  R   +  LE+V        
Sbjct: 629 -------------VERALEGEDGSVDIVSFLASAPSLENTPRKEIVAALESVGFDADRRA 675

Query: 217 RDIEKLSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAAQIIRSLLAPTKYV-I 275
           + +  LSGG   +  +  + +Q+AD+ + DEP+++LDV    N   +   LL  T+   +
Sbjct: 676 QTVGSLSGGWKMKLELTRAILQKADILLLDEPTNHLDVA---NVRWLEEYLLNNTEITSL 732

Query: 276 CVEHDLSVLD-------------------YLSDFVCIIYGVPSVYGVVTLPASVREGINI 316
            V HD   LD                    L DFV       S Y +    A +      
Sbjct: 733 IVSHDTGFLDKVCTDIIHYENKKLAYYKGNLHDFVEQKPEAKSYYTLTDSNAQM------ 786

Query: 317 FLDGHIPAENLRFRTEALQFRIADATEDLQNDSASRAFSYPSL-KKTQGDFVLNVEEGEF 375
               H PA  +    ++    +A  T+          F+YP   K +  D   ++     
Sbjct: 787 ----HFPAPGILSGVKSNTRAVAKMTD--------VTFTYPGAPKPSMADVSCSL----- 829

Query: 376 SDSEILVMMGENGTGKTTLIKLLAGALKPDEGQ 408
           S S  + ++G NG GK+TLIKLL G L P  G+
Sbjct: 830 SLSSRVAIIGPNGAGKSTLIKLLTGELVPTSGK 862

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 43/81 (53%), Gaps = 5/81 (6%)

Query: 463 QEVQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKK-TA 521
           Q V  LSGG   ++ +  A+   ADI L+DEP+ +LD    +   + +  ++L+N + T+
Sbjct: 676 QTVGSLSGGWKMKLELTRAILQKADILLLDEPTNHLD----VANVRWLEEYLLNNTEITS 731

Query: 522 FIVEHDFIMATYLADKVIVFE 542
            IV HD      +   +I +E
Sbjct: 732 LIVSHDTGFLDKVCTDIIHYE 752

 Score = 33.1 bits (74), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 32/60 (53%), Gaps = 4/60 (6%)

Query: 468  LSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRF----ILHNKKTAFI 523
            LSGG+L +V I  A+     + ++DEP+ YLD +     +  IR +    ++ +  T F+
Sbjct: 1027 LSGGQLVKVVIAGAMWNNPHLLVLDEPTNYLDRDSLGALAMAIREWTGGVVMISHSTEFV 1086

 Score = 31.6 bits (70), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 27/49 (55%), Gaps = 2/49 (4%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQN 154
           + ++G NG GKST +K+L G+  P  G+ +  P  +  I Y     LQ+
Sbjct: 835 VAIIGPNGAGKSTLIKLLTGELVPTSGKVEKHPNLR--IGYIAQHALQH 881

>Kwal_33.15561
          Length = 1297

 Score = 55.8 bits (133), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 54/199 (27%), Positives = 91/199 (45%), Gaps = 35/199 (17%)

Query: 354  FSYPSLKK--TQGDFVLNVEEGEFSDSEILVMMGENGTGKTTLIKLLA-------GALKP 404
            FSY ++       +  L V+ GE     I+ ++G +G+GK+TL  LL        G++  
Sbjct: 1066 FSYSNINNPMVYKNLSLKVDRGE-----IVGLIGTSGSGKSTLWSLLTRLYPVENGSISI 1120

Query: 405  DEGQDIPKLN----------VSMKPQKIAPKFPGTVRQLFFKKIRGQFLNPQFQT----D 450
            D G DI + +          V  KP   +      +     +K+  + +N    T    +
Sbjct: 1121 D-GTDINQWDRKALRSCIAVVEQKPLFFSGSIIENLTYGLMRKVSDEEVNELLLTLGMLE 1179

Query: 451  VVK--PLRIDDIIDQEVQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSK 508
             V   P R+  +ID   Q LSGG++QR+AIV AL     + ++DE ++ LD+    I S+
Sbjct: 1180 FVNSTPKRLHSVID--TQLLSGGQVQRLAIVRALLRKPQLLVLDECTSALDARHSFIMSE 1237

Query: 509  VIRRFILHNKKTAFIVEHD 527
             ++  + H   T  +V H 
Sbjct: 1238 FVKHHLYHT--TTLVVTHS 1254

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 44/187 (23%), Positives = 82/187 (43%), Gaps = 27/187 (14%)

Query: 103  GQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLED 162
            G+++GL+GT+G GKST   +L        G                G+++  +  K L  
Sbjct: 1087 GEIVGLIGTSGSGKSTLWSLLTRLYPVENGSIS-----------IDGTDINQWDRKALRS 1135

Query: 163  DIKAI-IKPQYVDN--IPRAIKGPVQKVGE------LLKLRMEKSPEDVKRYIKILQLEN 213
             I  +  KP +     I     G ++KV +      LL L M +      +     +L +
Sbjct: 1136 CIAVVEQKPLFFSGSIIENLTYGLMRKVSDEEVNELLLTLGMLEFVNSTPK-----RLHS 1190

Query: 214  VLKRDIEKLSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAAQIIRSLLAPTKY 273
            V+  D + LSGG++QR AI  + +++  + + DE +S LD +     ++ ++  L  T  
Sbjct: 1191 VI--DTQLLSGGQVQRLAIVRALLRKPQLLVLDECTSALDARHSFIMSEFVKHHLYHTTT 1248

Query: 274  VICVEHD 280
            ++    +
Sbjct: 1249 LVVTHSE 1255

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 52/201 (25%), Positives = 89/201 (44%), Gaps = 33/201 (16%)

Query: 353 AFSYPSLKK--TQGDFVLNVEEGEFSDSEILVMMGENGTGKTTLIKLLAGALKPDEGQ-- 408
           +F+YPS  K     +  L V  G F+      ++G++G+GK+T+  LL    +P  G   
Sbjct: 366 SFAYPSRSKHPVIKNLNLKVPGGRFT-----FIVGKSGSGKSTISNLLLKLYRPCSGLIK 420

Query: 409 ----DIPKLN-------VSMKPQKIAPKFPGTVR---QLFFKKIR-----GQFLNPQFQT 449
               DI ++N       +++  Q  +P F  +++   QL   + R      Q        
Sbjct: 421 VNDVDIREINQQDLFRSITLVEQN-SPLFEDSIKNNIQLTSDEHRDDGRLSQACQAAMLE 479

Query: 450 DVVKPLR--IDDIIDQEVQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICS 507
            V++ L   +D II      LSGGE QRVA+  A    + I ++DE  +  D   + +  
Sbjct: 480 GVIRDLAKGLDTIIGSSGVDLSGGEQQRVALARAFVRDSPILILDEALSAQDRMHKDLLM 539

Query: 508 KVIRRFILHNKKTAFIVEHDF 528
           + IR +     +T  I+ H+ 
Sbjct: 540 EAIRFW--RKGRTTIILTHEL 558

 Score = 29.6 bits (65), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 49/201 (24%), Positives = 89/201 (44%), Gaps = 27/201 (13%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLGRFD-DPPEWQEIIK--YFRGSELQNYFTKM 159
           G+   +VG +G GKST   +L    +P  G    +  + +EI +   FR   L    + +
Sbjct: 388 GRFTFIVGKSGSGKSTISNLLLKLYRPCSGLIKVNDVDIREINQQDLFRSITLVEQNSPL 447

Query: 160 LEDDIKAIIK---PQYVDN--IPRAIKGPVQKVGELLKLRMEKSPEDVKRYIKILQLENV 214
            ED IK  I+    ++ D+  + +A +  +          +E    D+ +      L+ +
Sbjct: 448 FEDSIKNNIQLTSDEHRDDGRLSQACQAAM----------LEGVIRDLAK-----GLDTI 492

Query: 215 LKRDIEKLSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAAQIIRSLLAPTKYV 274
           +      LSGGE QR A+  + V+++ + + DE  S  D   +    + IR      +  
Sbjct: 493 IGSSGVDLSGGEQQRVALARAFVRDSPILILDEALSAQDRMHKDLLMEAIR-FWRKGRTT 551

Query: 275 ICVEHDLSVLDYLS-DFVCII 294
           I + H+L+  D L  DFV ++
Sbjct: 552 IILTHELN--DILEDDFVLLM 570

>Kwal_34.16240
          Length = 752

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 50/181 (27%), Positives = 81/181 (44%), Gaps = 31/181 (17%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLEDDIK 165
           + LVG NG GK+T LKIL  + +P  G     P  +             YFT+   D + 
Sbjct: 561 IALVGANGCGKTTLLKILMEQLRPIQGYVSRNPRLRVA-----------YFTQHHVDSMD 609

Query: 166 AIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKSPEDVKRYIKILQLENVLK-RDIEKLSG 224
             +    VD +     G              K+ E+ +R++    +   L  + ++ LSG
Sbjct: 610 --LNTSAVDWMSTTFPG--------------KTDEEYRRHLGAFGITGSLGLQKMQLLSG 653

Query: 225 GELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAAQIIRSLLAPTKYVICVEHDLSVL 284
           G+  R A    C+    + + DEPS++LD    L+A  ++ +L   T  V+ V HD+SV+
Sbjct: 654 GQKSRVAFAALCLNNPHILVLDEPSNHLDTAG-LDA--LMDALKKFTGGVLMVSHDISVI 710

Query: 285 D 285
           D
Sbjct: 711 D 711

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 51/183 (27%), Positives = 83/183 (45%), Gaps = 36/183 (19%)

Query: 377 DSEILVMMGENGTGKTTLIKLLAGALKPDEG--QDIPKLNVSMKPQK------------- 421
           DS I  ++G NG GKTTL+K+L   L+P +G     P+L V+   Q              
Sbjct: 558 DSRI-ALVGANGCGKTTLLKILMEQLRPIQGYVSRNPRLRVAYFTQHHVDSMDLNTSAVD 616

Query: 422 -IAPKFPGTVRQLFFKKIRGQFLNPQFQTDVVKPLRIDDIIDQEVQHLSGGELQRVAI-V 479
            ++  FPG   + + + + G F        +   L +     Q++Q LSGG+  RVA   
Sbjct: 617 WMSTTFPGKTDEEYRRHL-GAF-------GITGSLGL-----QKMQLLSGGQKSRVAFAA 663

Query: 480 LALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVI 539
           L L  P  I ++DEPS +LD+         +++F         +V HD  +   + +++ 
Sbjct: 664 LCLNNPH-ILVLDEPSNHLDTAGLDALMDALKKFT----GGVLMVSHDISVIDGVCNEIW 718

Query: 540 VFE 542
           V E
Sbjct: 719 VSE 721

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 49/221 (22%), Positives = 93/221 (42%), Gaps = 37/221 (16%)

Query: 103 GQVLGLVGTNGIGKSTALKILA--------------------GKQKPNLGRFDDPPEW-- 140
           G   G+VG NGIGKST L+ L+                    G +   L    D   W  
Sbjct: 225 GHRYGIVGQNGIGKSTLLRALSRRELNVPKHISILHVEQELRGDETKALNSVLDADVWRK 284

Query: 141 ----QEIIKYFRGSELQNYFTKMLEDDIKAIIKPQYVDNIPRAIKGPVQKVGE-LLKLRM 195
               +E     R  E++   ++  ED +++    + +DN    ++  ++++ E L+ +  
Sbjct: 285 QLLSEESKINERLQEIEKLRSEFEEDSLES----KKLDNEREDLESHLEQISEKLIDMES 340

Query: 196 EKSPEDVKRYIKILQLENVLKRD-IEKLSGGELQRFAIGMSCVQEADVYMFDEPSSYLDV 254
           +K+       +  L      ++      SGG   R ++  +   + D+ + DEPS+ LDV
Sbjct: 341 DKAEARAASILYGLGFSTEAQQQPTNSFSGGWRMRLSLARALFCQPDLLLLDEPSNMLDV 400

Query: 255 KQRLNAAQIIRSLLAPTKYVICVEHDLSVLDYLSDFVCIIY 295
                 ++ +++  A    V+ V HD + L+ ++    IIY
Sbjct: 401 PSIAYLSEYLKTYPAT---VVVVSHDRAFLNEVA--TDIIY 436

 Score = 32.7 bits (73), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 34/77 (44%), Gaps = 4/77 (5%)

Query: 463 QEVQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAF 522
           Q     SGG   R+++  AL    D+ L+DEPS  LD       S+ ++ +      T  
Sbjct: 363 QPTNSFSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPSIAYLSEYLKTY----PATVV 418

Query: 523 IVEHDFIMATYLADKVI 539
           +V HD      +A  +I
Sbjct: 419 VVSHDRAFLNEVATDII 435

>AFR432W [3624] [Homologous to ScYKL209C (STE6) - SH]
            complement(1213217..1217071) [3855 bp, 1284 aa]
          Length = 1284

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 57/212 (26%), Positives = 105/212 (49%), Gaps = 32/212 (15%)

Query: 354  FSYPSLKKTQ--GDFVLNVEEGEFSDSEILVMMGENGTGKTTLIKLLAGA--LKPD---- 405
            F+YP+ K  Q   +F L + +G       + ++GE+G+GK+TL  L+ G   +KP     
Sbjct: 1053 FAYPAAKDVQIYKNFNLRINQGT-----KVAIVGESGSGKSTLFYLICGLYPVKPASLFI 1107

Query: 406  EGQDIPKLNVSMKPQKIA-----PKF-PGTVRQLFFKKIRGQFLNPQFQTDVVKPLRIDD 459
            +G DI    +S   + IA     P+F  GT+R+     + G   + +   +V+  +RI +
Sbjct: 1108 DGTDICNWEMSALRKIIAVVEQKPRFFNGTIRENLVYGLEGTITDNEIY-EVLAEVRIIN 1166

Query: 460  IIDQ---------EVQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVI 510
             +           +   +SGG+LQR++IV AL     + ++DE ++ LD+      + V+
Sbjct: 1167 FVRSLPEGLETRVDTNLVSGGQLQRLSIVRALLRRPTLLILDECTSALDAANANAIANVV 1226

Query: 511  RRFILHNKKTAFIVEHDFIMATYLADKVIVFE 542
            R   LH+  T  ++ H   M   + D+++V +
Sbjct: 1227 RNS-LHD-ITVIVITHSKQMMK-MCDRIVVLK 1255

 Score = 35.8 bits (81), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 58/198 (29%), Positives = 83/198 (41%), Gaps = 28/198 (14%)

Query: 99  TPRPGQVLGLVGTNGIGKSTALKILA----------GKQKPNLGRFDDPPEWQEIIKYFR 148
           T RP Q+  +VG +G GKST   +L                NL   D     Q I    +
Sbjct: 383 TFRPNQITFIVGKSGSGKSTLGNLLLKFYSDYEGIITVNSTNLRGIDRSWLLQNITLVEQ 442

Query: 149 GSELQNYFTKMLEDDIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKSPEDVKRYIKI 208
              L   F   L ++I    KP  V+    A+K   Q    LL+  +   PE        
Sbjct: 443 SCTL---FNGTLFENITLSAKP--VNKTAGAVKRACQMA--LLEKLVFDLPEG------- 488

Query: 209 LQLENVLKRDIEKLSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAAQIIRSLL 268
             L   +      +SGG+ QR A+  + +++A V + DE  S LD+  R    ++IRS  
Sbjct: 489 --LHTKVGSGGISMSGGQQQRVALARAILRDAPVLILDEAISALDIIHRDLLMEVIRSWR 546

Query: 269 APTKYVICVEHDLS-VLD 285
           A  K  I + H+LS VLD
Sbjct: 547 AD-KTTIILTHELSHVLD 563

 Score = 34.3 bits (77), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 47/191 (24%), Positives = 79/191 (41%), Gaps = 36/191 (18%)

Query: 103  GQVLGLVGTNGIGKSTALKILAGKQ--KPNLGRFDDPPEWQEIIKYFRGSELQNYFTKML 160
            G  + +VG +G GKST   ++ G    KP    F D            G+++ N+    L
Sbjct: 1074 GTKVAIVGESGSGKSTLFYLICGLYPVKPA-SLFID------------GTDICNWEMSAL 1120

Query: 161  EDDIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKSPEDVKRY-----IKILQLENVL 215
               I        V+  PR   G ++   E L   +E +  D + Y     ++I+     L
Sbjct: 1121 RKIIAV------VEQKPRFFNGTIR---ENLVYGLEGTITDNEIYEVLAEVRIINFVRSL 1171

Query: 216  KRDIEK------LSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAAQIIRSLLA 269
               +E       +SGG+LQR +I  + ++   + + DE +S LD       A ++R+ L 
Sbjct: 1172 PEGLETRVDTNLVSGGQLQRLSIVRALLRRPTLLILDECTSALDAANANAIANVVRNSLH 1231

Query: 270  PTKYVICVEHD 280
                VI + H 
Sbjct: 1232 DIT-VIVITHS 1241

>KLLA0A10857g complement(941784..944042) highly similar to sp|P43535
           Saccharomyces cerevisiae YFR009w GCN20 positive effector
           of GCN2P, start by similarity
          Length = 752

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 48/192 (25%), Positives = 87/192 (45%), Gaps = 31/192 (16%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLEDDIK 165
           + LVG NG GK+T LK++  + +P  G     P  +             YFT+   D + 
Sbjct: 561 ISLVGANGCGKTTLLKVMMEQLRPTKGFVSRNPRLR-----------IGYFTQHHVDSMD 609

Query: 166 AIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKSPEDVKRYIKILQLENVLK-RDIEKLSG 224
             +    VD +  A  G              K+ E+ +R++    +   L  + ++ LSG
Sbjct: 610 --LNQSAVDWMSTAFPG--------------KTDEEYRRHLGAFGISGSLGIQRMQLLSG 653

Query: 225 GELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAAQIIRSLLAPTKYVICVEHDLSVL 284
           G+  R A    C+    + + DEPS++LD    L+A  ++ +L +    V+ V HD+SV+
Sbjct: 654 GQKSRVAFAALCLNNPHILVLDEPSNHLDTAG-LDA--LVDALKSFNGGVLMVSHDISVI 710

Query: 285 DYLSDFVCIIYG 296
           + + + + +  G
Sbjct: 711 NSVCNEIWVSEG 722

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 57/208 (27%), Positives = 90/208 (43%), Gaps = 40/208 (19%)

Query: 353 AFSYPSLKKTQGDFVLNVEEGEFSDSEILVMMGENGTGKTTLIKLLAGALKPDEG--QDI 410
           +FSY        D  L+V+     DS I  ++G NG GKTTL+K++   L+P +G     
Sbjct: 538 SFSYKESDPLLTDVNLDVQ----MDSRI-SLVGANGCGKTTLLKVMMEQLRPTKGFVSRN 592

Query: 411 PKLNVSMKPQK--------------IAPKFPGTVRQLFFKKIRGQFLNPQFQTDVVKPLR 456
           P+L +    Q               ++  FPG   + + + + G F        +   L 
Sbjct: 593 PRLRIGYFTQHHVDSMDLNQSAVDWMSTAFPGKTDEEYRRHL-GAF-------GISGSLG 644

Query: 457 IDDIIDQEVQHLSGGELQRVAIV-LALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFIL 515
           I     Q +Q LSGG+  RVA   L L  P  I ++DEPS +LD+         ++ F  
Sbjct: 645 I-----QRMQLLSGGQKSRVAFAALCLNNPH-ILVLDEPSNHLDTAGLDALVDALKSF-- 696

Query: 516 HNKKTAFIVEHDFIMATYLADKVIVFEG 543
                  +V HD  +   + +++ V EG
Sbjct: 697 --NGGVLMVSHDISVINSVCNEIWVSEG 722

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 52/220 (23%), Positives = 100/220 (45%), Gaps = 35/220 (15%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQN------YF 156
           G+  GLVG NGIGKST LK L+ +++ N+ +       ++ I+      LQ+      + 
Sbjct: 225 GRRYGLVGQNGIGKSTLLKALS-RRELNVPKHISVLHVEQEIRGDETKALQSVLDADVWR 283

Query: 157 TKMLEDDIKAIIKPQYVDNIPRAIKGPVQKVGELLKLR--MEKSPEDVKRYIKILQLEN- 213
            ++L ++ K   + Q ++N+ +       +V +L   R  +E+  E +    K++ +E+ 
Sbjct: 284 KQLLSEESKINERLQEIENLRKEFNEESLEVKKLDNERTDLEEHLEQISE--KLIDMESD 341

Query: 214 ------------------VLKRDIEKLSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVK 255
                               ++     SGG   R ++  +   + D+ + DEPS+ LDV 
Sbjct: 342 KAEARAASILYGLGFSTEAQQQPTNSFSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVP 401

Query: 256 QRLNAAQIIRSLLAPTKYVICVEHDLSVLDYLSDFVCIIY 295
                A+ +++  A    V+ V HD + L+ ++    IIY
Sbjct: 402 SIAYLAEYLKTYPAT---VLVVSHDRAFLNEVA--TDIIY 436

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 34/77 (44%), Gaps = 4/77 (5%)

Query: 463 QEVQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAF 522
           Q     SGG   R+++  AL    D+ L+DEPS  LD       ++ ++ +      T  
Sbjct: 363 QPTNSFSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPSIAYLAEYLKTY----PATVL 418

Query: 523 IVEHDFIMATYLADKVI 539
           +V HD      +A  +I
Sbjct: 419 VVSHDRAFLNEVATDII 435

>AAL028W [159] [Homologous to ScYLR249W (YEF3) - SH; ScYNL014W
           (HEF3) - SH] complement(291808..294942) [3135 bp, 1044
           aa]
          Length = 1044

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 52/192 (27%), Positives = 83/192 (43%), Gaps = 10/192 (5%)

Query: 219 IEKLSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAAQIIRSLLAPTKYVICVE 278
           I  LSGG   + A+  + ++ AD+ + DEP+++LD    +N A ++  L       I V 
Sbjct: 541 IMSLSGGWKMKLALARAVLKNADILLLDEPTNHLDT---VNVAWLVNYLNTCGITSIIVS 597

Query: 279 HDLSVLDYLSDFVCIIYGVPSVYGVVTLPASVREGINIFLDGHIPAENLRFRTEALQFRI 338
           HD   LD +  ++    G+        L   V++         + A +L F+     F  
Sbjct: 598 HDSGFLDNVCQYIIHYEGLKLRKYKGNLSEFVKKCPTAKSYYELGASDLEFKFPEPGFLE 657

Query: 339 ADATEDLQNDSASR-AFSYPSLKKTQ-GDFVLNVEEGEFSDSEILVMMGENGTGKTTLIK 396
              T+       S  +F YP   K Q  D        + S S  + ++G NG GK+TLI 
Sbjct: 658 GVKTKQKAIVKVSNMSFQYPGTSKPQIADINF-----QCSLSSRIAVIGPNGAGKSTLIN 712

Query: 397 LLAGALKPDEGQ 408
           +L G L P  G+
Sbjct: 713 VLTGELLPTTGE 724

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 41/164 (25%), Positives = 77/164 (46%), Gaps = 10/164 (6%)

Query: 383 MMGENGTGKTTLIKLLA-GALKPDEGQDIPKLNVSMKPQKIAPKFPGTVRQLFFKKIRGQ 441
           + G NG GK+TL++ +A G +     QD  +  V ++      +   +V    F+   G 
Sbjct: 461 LCGPNGAGKSTLMRAIANGQVDGFPTQDECR-TVYVEHDIDGTQADTSVLDFVFQ---GD 516

Query: 442 FLNPQFQTDVVKPLRI-DDIIDQEVQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDS 500
               +  T+ ++     D++I   +  LSGG   ++A+  A+   ADI L+DEP+ +LD+
Sbjct: 517 VGTREVITEKLREFGFSDEMIAMPIMSLSGGWKMKLALARAVLKNADILLLDEPTNHLDT 576

Query: 501 EQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIVFEGI 544
               +    +  ++     T+ IV HD      +   +I +EG+
Sbjct: 577 ----VNVAWLVNYLNTCGITSIIVSHDSGFLDNVCQYIIHYEGL 616

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 39/86 (45%), Gaps = 3/86 (3%)

Query: 209 LQLENVLKRDIEKLSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAAQIIRSLL 268
           L+ E V    I  LSGG+  +  +     Q   + + DEP++YLD   R +   + ++L 
Sbjct: 884 LEAELVSHSRIRGLSGGQKVKLVLAACTWQRPHLIVLDEPTNYLD---RDSLGALSKALK 940

Query: 269 APTKYVICVEHDLSVLDYLSDFVCII 294
           A    VI + H       L++ V  +
Sbjct: 941 AFEGGVIIITHSAEFTKDLTEEVWAV 966

 Score = 31.2 bits (69), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 44/89 (49%), Gaps = 9/89 (10%)

Query: 465 VQHLSGGELQRVAIVLALGIPADIYLI--DEPSAYLDSEQRIICSKVIRRFILHNKKTAF 522
           ++ LSGG  Q+V +VLA       +LI  DEP+ YLD +     SK ++ F    +    
Sbjct: 894 IRGLSGG--QKVKLVLAACTWQRPHLIVLDEPTNYLDRDSLGALSKALKAF----EGGVI 947

Query: 523 IVEHDFIMATYLADKVI-VFEGIPSKNAH 550
           I+ H       L ++V  V +GI + + H
Sbjct: 948 IITHSAEFTKDLTEEVWAVKDGIMTPSGH 976

>YFR009W (GCN20) [1689] chr6 (162482..164740) Component of a protein
           complex required for activation of Gcn2p protein kinase
           in response to amino acid starvation, member of the
           non-transporter group within the ATP-binding cassette
           (ABC) superfamily [2259 bp, 752 aa]
          Length = 752

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 48/181 (26%), Positives = 82/181 (45%), Gaps = 31/181 (17%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLEDDIK 165
           + LVG NG GK+T LKI+  + +P  G     P  +             YFT+   D + 
Sbjct: 561 IALVGANGCGKTTLLKIMMEQLRPLKGFVSRNPRLR-----------IGYFTQHHVDSMD 609

Query: 166 AIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKSPEDVKRYIKILQLENVLK-RDIEKLSG 224
             +    VD + ++  G              K+ E+ +R++    +   L  + ++ LSG
Sbjct: 610 --LTTSAVDWMSKSFPG--------------KTDEEYRRHLGSFGITGTLGLQKMQLLSG 653

Query: 225 GELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAAQIIRSLLAPTKYVICVEHDLSVL 284
           G+  R A    C+    + + DEPS++LD    L+A  ++ +L      V+ V HD+SV+
Sbjct: 654 GQKSRVAFAALCLNNPHILVLDEPSNHLDTTG-LDA--LVEALKNFNGGVLMVSHDISVI 710

Query: 285 D 285
           D
Sbjct: 711 D 711

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 49/183 (26%), Positives = 81/183 (44%), Gaps = 36/183 (19%)

Query: 377 DSEILVMMGENGTGKTTLIKLLAGALKPDEG--QDIPKLNVSMKPQK------------- 421
           DS I  ++G NG GKTTL+K++   L+P +G     P+L +    Q              
Sbjct: 558 DSRI-ALVGANGCGKTTLLKIMMEQLRPLKGFVSRNPRLRIGYFTQHHVDSMDLTTSAVD 616

Query: 422 -IAPKFPGTVRQLFFKKIRGQFLNPQFQTDVVKPLRIDDIIDQEVQHLSGGELQRVAIV- 479
            ++  FPG   + + + + G F        +   L +     Q++Q LSGG+  RVA   
Sbjct: 617 WMSKSFPGKTDEEYRRHL-GSF-------GITGTLGL-----QKMQLLSGGQKSRVAFAA 663

Query: 480 LALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVI 539
           L L  P  I ++DEPS +LD+       + ++ F         +V HD  +   +  ++ 
Sbjct: 664 LCLNNPH-ILVLDEPSNHLDTTGLDALVEALKNF----NGGVLMVSHDISVIDSVCKEIW 718

Query: 540 VFE 542
           V E
Sbjct: 719 VSE 721

 Score = 35.0 bits (79), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 56/236 (23%), Positives = 93/236 (39%), Gaps = 67/236 (28%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEII---KYFRGSELQNYFTKM 159
           G   GLVG NGIGKST L+ L+ ++        + P+   I+   +  RG          
Sbjct: 225 GHRYGLVGQNGIGKSTLLRALSRREL-------NVPKHVSILHVEQELRG---------- 267

Query: 160 LEDDIKAIIKPQYVDNIPRAIKGPVQKVGELLK----LRME------------KSPEDVK 203
             DD KA+      D   + +     K+ E LK    LR E               ED+ 
Sbjct: 268 --DDTKALQSVLDADVWRKQLLSEEAKINERLKEMDVLRQEFEEDSLEVKKLDNEREDLD 325

Query: 204 RYI-----KILQLEN-------------------VLKRDIEKLSGGELQRFAIGMSCVQE 239
            ++     K++ +E+                     ++     SGG   R ++  +   +
Sbjct: 326 NHLIQISDKLVDMESDKAEARAASILYGLGFSTEAQQQPTNSFSGGWRMRLSLARALFCQ 385

Query: 240 ADVYMFDEPSSYLDVKQRLNAAQIIRSLLAPTKYVICVEHDLSVLDYLSDFVCIIY 295
            D+ + DEPS+ LDV      A+ +++   P   V+ V HD + L+ ++    IIY
Sbjct: 386 PDLLLLDEPSNMLDVPSIAYLAEYLKTY--PNT-VLTVSHDRAFLNEVA--TDIIY 436

 Score = 31.2 bits (69), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 33/77 (42%), Gaps = 4/77 (5%)

Query: 463 QEVQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAF 522
           Q     SGG   R+++  AL    D+ L+DEPS  LD       ++ ++ +      T  
Sbjct: 363 QPTNSFSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPSIAYLAEYLKTY----PNTVL 418

Query: 523 IVEHDFIMATYLADKVI 539
            V HD      +A  +I
Sbjct: 419 TVSHDRAFLNEVATDII 435

>Sklu_2442.20 YLR249W, Contig c2442 35272-38406 reverse complement
          Length = 1044

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 51/199 (25%), Positives = 85/199 (42%), Gaps = 10/199 (5%)

Query: 212 ENVLKRDIEKLSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAAQIIRSLLAPT 271
           + +++  I  LSGG   + A+  + ++ AD+ + DEP+++LD    +N A ++  L    
Sbjct: 534 DEMIEMPIASLSGGWKMKLALARAVLKNADILLLDEPTNHLDT---VNVAWLVNYLNTCG 590

Query: 272 KYVICVEHDLSVLDYLSDFVCIIYGVPSVYGVVTLPASVREGINIFLDGHIPAENLRFR- 330
              I V HD   LD +  ++    G+        L   V++         + A  L FR 
Sbjct: 591 ITSIIVSHDSGFLDSVCQYIIHYEGLKLRKYRGNLSEFVKKCPTAKSYYELGASELEFRF 650

Query: 331 TEALQFRIADATEDLQNDSASRAFSYPSLKKTQ-GDFVLNVEEGEFSDSEILVMMGENGT 389
            E          +      ++  F YP   K Q  D        + S S  + ++G NG 
Sbjct: 651 PEPGYLEGVKTKQKAIVKVSNMTFQYPGTSKPQISDISF-----QCSLSSRIAVIGPNGA 705

Query: 390 GKTTLIKLLAGALKPDEGQ 408
           GK+TLI +L G L P  G+
Sbjct: 706 GKSTLINVLTGELLPTIGE 724

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/167 (25%), Positives = 78/167 (46%), Gaps = 16/167 (9%)

Query: 383 MMGENGTGKTTLIKLLA-GALKPDEGQDIPKLNVSMKPQKIAPKFPGTVRQLFFKKIRGQ 441
           + G NG GK+TL++ +A G +     QD  +  V ++          +V +  F+   G 
Sbjct: 461 LCGPNGAGKSTLMRAIANGQVDGFPSQDECR-TVYVEHDIDGTHSDTSVLEFVFQGDVGT 519

Query: 442 FLNPQFQTDVVKPLR----IDDIIDQEVQHLSGGELQRVAIVLALGIPADIYLIDEPSAY 497
                 +  + + LR     D++I+  +  LSGG   ++A+  A+   ADI L+DEP+ +
Sbjct: 520 ------KETISEKLREFGFSDEMIEMPIASLSGGWKMKLALARAVLKNADILLLDEPTNH 573

Query: 498 LDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIVFEGI 544
           LD+    +    +  ++     T+ IV HD      +   +I +EG+
Sbjct: 574 LDT----VNVAWLVNYLNTCGITSIIVSHDSGFLDSVCQYIIHYEGL 616

 Score = 36.2 bits (82), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 61/289 (21%), Positives = 104/289 (35%), Gaps = 94/289 (32%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLG-----------------------RFDDPPEWQE 142
           + ++G NG GKST + +L G+  P +G                         D  P   E
Sbjct: 697 IAVIGPNGAGKSTLINVLTGELLPTIGEVYTHENCRIAYIKQHAFAHIESHLDKTP--SE 754

Query: 143 IIKY-FRGSE----LQNYFTKMLEDDIKAIIKPQYVDNIPRAIKG--------------- 182
            I++ F+  E    +     ++ EDD +A+ K   +D  PR I G               
Sbjct: 755 YIQWRFQTGEDRETMDRANRQINEDDAQAMNKIFKIDGTPRRIAGIHARRKFKNTYEYEC 814

Query: 183 ----------------PVQKV-------GELLKLRMEKSPE-DVKRYIKILQLENVLKRD 218
                           P+  V       GEL++   +   E D+K  +   Q   + +++
Sbjct: 815 SFLLGENIGMKSERWVPMMSVDNAWIPRGELVESHSKMVAEVDMKEALASGQFRPLTRKE 874

Query: 219 IEK-------------------LSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLN 259
           IE+                   LSGG+  +  +     Q   + + DEP++YLD   R +
Sbjct: 875 IEEHCAMLGLDAELVSHSRIRGLSGGQKVKLVLAAGTWQRPHLIVLDEPTNYLD---RDS 931

Query: 260 AAQIIRSLLAPTKYVICVEHDLSVLDYLSDFVCIIYG---VPSVYGVVT 305
              + ++L A    VI + H       L++ V  +      PS +  VT
Sbjct: 932 LGALSKALKAFEGGVIIITHSAEFTKDLTEEVWAVKDGKMTPSGHNWVT 980

 Score = 33.5 bits (75), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 30/51 (58%), Gaps = 4/51 (7%)

Query: 465 VQHLSGGELQRVAIVLALGIPADIYLI--DEPSAYLDSEQRIICSKVIRRF 513
           ++ LSGG  Q+V +VLA G     +LI  DEP+ YLD +     SK ++ F
Sbjct: 894 IRGLSGG--QKVKLVLAAGTWQRPHLIVLDEPTNYLDRDSLGALSKALKAF 942

>CAGL0D03674g 370066..373626 highly similar to tr|Q08972
           Saccharomyces cerevisiae YPL226w NEW1, start by
           similarity
          Length = 1186

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 79/327 (24%), Positives = 125/327 (38%), Gaps = 75/327 (22%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLED 162
           G   GL G NG GKST ++ +A       G+ D  P+   +   F   +LQ     +   
Sbjct: 590 GHRYGLCGRNGAGKSTLMRSIAN------GQLDGFPDKDTLKTCFVEHKLQGEEGDL--- 640

Query: 163 DIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKSPEDVKRYIKILQLENVLK-RDIEK 221
           D+ + I          A+   +Q            S +D+   +  +  +   + + +  
Sbjct: 641 DLVSFI----------ALDEQLQTT----------SRDDIANALASVGFDETRRAQTVGS 680

Query: 222 LSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAAQIIRSLLAPTKYV-ICVEHD 280
           LSGG   +  +  + +Q+AD+ + DEP+++LDV    N   +   LL  T    + V HD
Sbjct: 681 LSGGWKMKLELARAMLQKADILLLDEPTNHLDVA---NVKWLEEYLLEHTNITSLIVSHD 737

Query: 281 LSVLD----------------YLSDFVCIIYGVPSVYGVVTLP---ASVREGINIFLDGH 321
              LD                Y  +    +   P      TL    A +R      L G 
Sbjct: 738 SGFLDAVCTDIIHYENKKLIYYKGNLAKFVEQKPEAKAYYTLSDTNAQMRFPPPGILTG- 796

Query: 322 IPAENLRFRTEALQFRIADATEDLQNDSASRAFSYPSLKKTQGDFVLNVEEGEFSDSEIL 381
                ++  T A+  ++ D T           F+YP         V        S S  +
Sbjct: 797 -----VKSNTRAVA-KVTDVT-----------FTYPGASTPSLSHV----SCALSLSSRV 835

Query: 382 VMMGENGTGKTTLIKLLAGALKPDEGQ 408
            ++G NG GK+TLIKLL G L P EG+
Sbjct: 836 AVLGPNGAGKSTLIKLLTGELVPQEGK 862

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 53/186 (28%), Positives = 80/186 (43%), Gaps = 44/186 (23%)

Query: 383 MMGENGTGKTTLIKLLA-GALK--PDEGQDIPKLNVSMKPQKIAPKFPGTVRQLFFKKIR 439
           + G NG GK+TL++ +A G L   PD+         ++K   +  K  G    L      
Sbjct: 595 LCGRNGAGKSTLMRSIANGQLDGFPDKD--------TLKTCFVEHKLQGEEGDLDLVSFI 646

Query: 440 GQFLNPQFQTDVVKPLRIDDIID-------------QEVQHLSGGELQRVAIVLALGIPA 486
              L+ Q QT        DDI +             Q V  LSGG   ++ +  A+   A
Sbjct: 647 A--LDEQLQT-----TSRDDIANALASVGFDETRRAQTVGSLSGGWKMKLELARAMLQKA 699

Query: 487 DIYLIDEPSAYLDSEQRIICSKVIRRFIL-HNKKTAFIVEHD--FIMAT------YLADK 537
           DI L+DEP+ +LD    +   K +  ++L H   T+ IV HD  F+ A       Y   K
Sbjct: 700 DILLLDEPTNHLD----VANVKWLEEYLLEHTNITSLIVSHDSGFLDAVCTDIIHYENKK 755

Query: 538 VIVFEG 543
           +I ++G
Sbjct: 756 LIYYKG 761

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 48/106 (45%), Gaps = 14/106 (13%)

Query: 468  LSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRF------ILHNKK-- 519
            LSGG+L +V I  A+     + ++DEP+ YLD +     +  IR +      I HN +  
Sbjct: 1026 LSGGQLVKVVIAGAMWNNPHLLVLDEPTNYLDRDSLGALAIAIRDWSGGVVMISHNNEFV 1085

Query: 520  -----TAFIVEHDFIMATYLAD-KVIVFEGIPSKNAHARAPESLLT 559
                   +IVE+  ++   + D     FE   + NA    P S +T
Sbjct: 1086 GALCPEQWIVENGTMVQKGVKDVDQSRFEDGGNANAVGLKPSSSVT 1131

 Score = 30.8 bits (68), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 21/33 (63%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLGRFDDPP 138
           + ++G NG GKST +K+L G+  P  G+ +  P
Sbjct: 835 VAVLGPNGAGKSTLIKLLTGELVPQEGKVEKHP 867

>YKL209C (STE6) [3066] chr11 complement(42424..46296) Membrane
            transporter responsible for export of a factor mating
            pheromone, member of ATP-binding cassette (ABC)
            superfamily of membrane transporters [3873 bp, 1290 aa]
          Length = 1290

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 86/182 (47%), Gaps = 27/182 (14%)

Query: 353  AFSYPSLKKTQGDFVLNVEEGEFSDSEILVMMGENGTGKTTLIKLLA-------GALKPD 405
             F+YPS       FV      +    + L ++GE+GTGK+TL+ LL        G +K D
Sbjct: 1058 TFAYPSAPTA---FVYKNMNFDMFCGQTLGIIGESGTGKSTLVLLLTKLYNCEVGKIKID 1114

Query: 406  EGQDIPKLNVSMKPQKIAPK------FPGTVRQLFFKKIRGQFLNPQFQTDVVKPLRIDD 459
             G D+   N++   ++I+        F GT+R      ++ + L  +   D +K + I D
Sbjct: 1115 -GTDVNDWNLTSLRKEISVVEQKPLLFNGTIRDNLTYGLQDEILEIEMY-DALKYVGIHD 1172

Query: 460  IIDQEVQHL---------SGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVI 510
             +    Q L         SGG+ QR+ I  AL   + I ++DE ++ LDS    I ++++
Sbjct: 1173 FVISSPQGLDTRIDTTLLSGGQAQRLCIARALLRKSKILILDECTSALDSVSSSIINEIV 1232

Query: 511  RR 512
            ++
Sbjct: 1233 KK 1234

 Score = 49.3 bits (116), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 64/232 (27%), Positives = 93/232 (40%), Gaps = 42/232 (18%)

Query: 330 RTEALQFRIADATEDLQNDSASRAFSYPS--LKKTQGDFVLNVEEGEFSDSEILVMMGEN 387
           +T A QF +  AT DL    A+ +FSYPS   +    +  LN   G+F+      ++G++
Sbjct: 342 KTVAHQFPLDYATSDLT--FANVSFSYPSRPSEAVLKNVSLNFSAGQFT-----FIVGKS 394

Query: 388 GTGKTTLIKLLAGALKPDEGQ-DIPKLNVSMKPQKIAPKFPGTVRQ---LFFKKIRGQFL 443
           G+GK+TL  LL        G   I   N+    QK+  +    V Q   LF   +R   L
Sbjct: 395 GSGKSTLSNLLLRFYDGYNGSISINGHNIQTIDQKLLIENITVVEQRCTLFNDTLRKNIL 454

Query: 444 ----------------NPQFQTDVVK-----------PLRIDDIIDQEVQHLSGGELQRV 476
                           N     D  +           P  ++ +I      LSGG+ QRV
Sbjct: 455 LGSTDSVRNADCSTNENRHLIKDACQMALLDRFILDLPDGLETLIGTGGVTLSGGQQQRV 514

Query: 477 AIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDF 528
           AI  A      I  +DE  + LD   R +  K IR +     KT  I+ H+ 
Sbjct: 515 AIARAFIRDTPILFLDEAVSALDIVHRNLLMKAIRHW--RKGKTTIILTHEL 564

 Score = 38.1 bits (87), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 39/163 (23%), Positives = 72/163 (44%), Gaps = 33/163 (20%)

Query: 103  GQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLED 162
            GQ LG++G +G GKST + +L       +G+               G+++ ++    L  
Sbjct: 1080 GQTLGIIGESGTGKSTLVLLLTKLYNCEVGKIK-----------IDGTDVNDWNLTSLRK 1128

Query: 163  DIKAI-IKPQYV-----DNIPRAIKGPVQKVGELLKLRMEKSPEDVKRYIKILQL----- 211
            +I  +  KP        DN+   ++       E+L++ M     D  +Y+ I        
Sbjct: 1129 EISVVEQKPLLFNGTIRDNLTYGLQD------EILEIEMY----DALKYVGIHDFVISSP 1178

Query: 212  ENVLKR-DIEKLSGGELQRFAIGMSCVQEADVYMFDEPSSYLD 253
            + +  R D   LSGG+ QR  I  + ++++ + + DE +S LD
Sbjct: 1179 QGLDTRIDTTLLSGGQAQRLCIARALLRKSKILILDECTSALD 1221

 Score = 35.4 bits (80), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 39/80 (48%), Gaps = 4/80 (5%)

Query: 211 LENVLKRDIEKLSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAAQIIRSLLAP 270
           LE ++      LSGG+ QR AI  + +++  +   DE  S LD+  R    + IR     
Sbjct: 495 LETLIGTGGVTLSGGQQQRVAIARAFIRDTPILFLDEAVSALDIVHRNLLMKAIRH-WRK 553

Query: 271 TKYVICVEHDLSVL---DYL 287
            K  I + H+LS +   DYL
Sbjct: 554 GKTTIILTHELSQIESDDYL 573

>YLR249W (YEF3) [3645] chr12 (636782..639916) Translation elongation
           factor EF-3A, member of the non-transporter group of the
           ATP-binding cassette (ABC) superfamily [3135 bp, 1044
           aa]
          Length = 1044

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 54/201 (26%), Positives = 85/201 (42%), Gaps = 28/201 (13%)

Query: 219 IEKLSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAAQIIRSLLAPTKYVICVE 278
           I  LSGG   + A+  + ++ AD+ + DEP+++LD    +N A ++  L       I + 
Sbjct: 541 ISALSGGWKMKLALARAVLRNADILLLDEPTNHLDT---VNVAWLVNYLNTCGITSITIS 597

Query: 279 HDLSVLDYLSDFVCIIYGVP--SVYGVVT-----LPA--SVREGINIFLDGHIPAENLRF 329
           HD   LD + +++    G+      G  T      PA  +  E  N  L+   P      
Sbjct: 598 HDSVFLDNVCEYIINYEGLKLRKYKGNFTEFVKKCPAAKAYEELSNTDLEFKFPEPGYLE 657

Query: 330 RTEALQFRIADATEDLQNDSASRAFSYPSLKKTQGDFVLNVEEGEF--SDSEILVMMGEN 387
             +  Q  I   T        +  F YP   K Q      + +  F  S S  + ++G N
Sbjct: 658 GVKTKQKAIVKVT--------NMEFQYPGTSKPQ------ITDINFQCSLSSRIAVIGPN 703

Query: 388 GTGKTTLIKLLAGALKPDEGQ 408
           G GK+TLI +L G L P  G+
Sbjct: 704 GAGKSTLINVLTGELLPTSGE 724

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 46/87 (52%), Gaps = 4/87 (4%)

Query: 458 DDIIDQEVQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHN 517
           D++I   +  LSGG   ++A+  A+   ADI L+DEP+ +LD+    +    +  ++   
Sbjct: 534 DEMIAMPISALSGGWKMKLALARAVLRNADILLLDEPTNHLDT----VNVAWLVNYLNTC 589

Query: 518 KKTAFIVEHDFIMATYLADKVIVFEGI 544
             T+  + HD +    + + +I +EG+
Sbjct: 590 GITSITISHDSVFLDNVCEYIINYEGL 616

 Score = 33.9 bits (76), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 30/51 (58%), Gaps = 4/51 (7%)

Query: 465 VQHLSGGELQRVAIVLALGIPADIYLI--DEPSAYLDSEQRIICSKVIRRF 513
           ++ LSGG  Q+V +VLA G     +LI  DEP+ YLD +     SK ++ F
Sbjct: 894 IRGLSGG--QKVKLVLAAGTWQRPHLIVLDEPTNYLDRDSLGALSKALKEF 942

>CAGL0M13739g complement(1346231..1348414) similar to sp|P40416
           Saccharomyces cerevisiae YMR301c ATM1, hypothetical
           start
          Length = 727

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 53/185 (28%), Positives = 87/185 (47%), Gaps = 30/185 (16%)

Query: 383 MMGENGTGKTTLIKLLAGALKPDEGQ-----------DIPKLN--VSMKPQKIAPKFPGT 429
           + G +G+GK+T++KL+     P+EG+           DI +L   + + PQ   P F  T
Sbjct: 496 IAGPSGSGKSTVLKLVFRFYDPEEGRVLVNGVDVREYDIDQLRKAIGVVPQD-TPLFNDT 554

Query: 430 VRQ-LFFKKIRGQFLNPQFQTDVVKPLRIDDIIDQEVQ-----------HLSGGELQRVA 477
           + + + F +I     + +  T V+   ++ D+I +  Q            +SGGE QR+A
Sbjct: 555 IWENVKFGRIEA---SDEEITRVIDKAQLSDLIAKLPQGSSTIVGERGLMISGGEKQRLA 611

Query: 478 IVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADK 537
           I   L   ADI   DE ++ LD+       + IRR     +KT+  + H  +     ADK
Sbjct: 612 IARVLLKDADIMFFDEATSALDTHTEQSLLRTIRRNFNSGEKTSVYIAHR-LRTIADADK 670

Query: 538 VIVFE 542
           +IV E
Sbjct: 671 IIVLE 675

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 51/197 (25%), Positives = 86/197 (43%), Gaps = 35/197 (17%)

Query: 102 PGQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLE 161
            G    + G +G GKST LK++         RF DP E + ++    G +++ Y    L 
Sbjct: 490 AGMKTAIAGPSGSGKSTVLKLVF--------RFYDPEEGRVLVN---GVDVREYDIDQLR 538

Query: 162 DDIKAIIK--PQYVDNIPRAIKGPVQKVGELLKLRMEKSPEDVKRYIKILQLENVLKRDI 219
             I  + +  P + D I   +K            R+E S E++ R I   QL +++ +  
Sbjct: 539 KAIGVVPQDTPLFNDTIWENVKFG----------RIEASDEEITRVIDKAQLSDLIAKLP 588

Query: 220 EK-----------LSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAAQII-RSL 267
           +            +SGGE QR AI    +++AD+  FDE +S LD     +  + I R+ 
Sbjct: 589 QGSSTIVGERGLMISGGEKQRLAIARVLLKDADIMFFDEATSALDTHTEQSLLRTIRRNF 648

Query: 268 LAPTKYVICVEHDLSVL 284
            +  K  + + H L  +
Sbjct: 649 NSGEKTSVYIAHRLRTI 665

>Scas_703.17
          Length = 1046

 Score = 52.8 bits (125), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 50/195 (25%), Positives = 83/195 (42%), Gaps = 18/195 (9%)

Query: 219 IEKLSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAAQIIRSLLAPTKYVICVE 278
           I  LSGG   + A+  + ++ AD+ + DEP+++LD    +N   ++  L       I V 
Sbjct: 542 ISALSGGWKMKLALARAVLKNADILLLDEPTNHLDT---INVKWLVDYLNTCGITSIIVS 598

Query: 279 HDLSVLDYLSDFVCIIYGVPSVYGVVTLPASVREGINIFLDGHIPAENLRFRTEALQFRI 338
           HD   LD +  ++    G+        L   +++  +      + A +L F     QF  
Sbjct: 599 HDSGFLDNVCQYIIHYEGLKLRKYKGNLSEFIKKCPSAKSYSELGASDLEF-----QFPA 653

Query: 339 ADATEDLQNDS------ASRAFSYPSLKKTQGDFVLNVEEGEFSDSEILVMMGENGTGKT 392
               E ++         ++  F YP   K Q   V      + S S  + ++G NG GK+
Sbjct: 654 PGYLEGVKTKQKAIVKVSNMTFQYPRTSKPQISDV----SFQCSLSSRIAVIGPNGAGKS 709

Query: 393 TLIKLLAGALKPDEG 407
           TLI +L G L P  G
Sbjct: 710 TLINVLTGELLPTSG 724

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 46/87 (52%), Gaps = 4/87 (4%)

Query: 458 DDIIDQEVQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHN 517
           D+ I+  +  LSGG   ++A+  A+   ADI L+DEP+ +LD+    I  K +  ++   
Sbjct: 535 DETINMPISALSGGWKMKLALARAVLKNADILLLDEPTNHLDT----INVKWLVDYLNTC 590

Query: 518 KKTAFIVEHDFIMATYLADKVIVFEGI 544
             T+ IV HD      +   +I +EG+
Sbjct: 591 GITSIIVSHDSGFLDNVCQYIIHYEGL 617

 Score = 31.2 bits (69), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 23/97 (23%), Positives = 46/97 (47%), Gaps = 5/97 (5%)

Query: 200 EDVKRYIKILQLENVL--KRDIEKLSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQR 257
           ++++ +  +L L++ L     I  LSGG+  +  +     Q   + + DEP++YLD   R
Sbjct: 874 KEIEEHCSMLGLDSELVSHSQIRGLSGGQKVKLVLAACTWQRPHLIVLDEPTNYLD---R 930

Query: 258 LNAAQIIRSLLAPTKYVICVEHDLSVLDYLSDFVCII 294
            +   + ++L A    VI + H       L++ V  +
Sbjct: 931 DSLGALSKALKAFEGGVIIITHSEEFTKNLTEEVWAV 967

 Score = 30.4 bits (67), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 30/52 (57%), Gaps = 4/52 (7%)

Query: 464 EVQHLSGGELQRVAIVLALGIPADIYLI--DEPSAYLDSEQRIICSKVIRRF 513
           +++ LSGG  Q+V +VLA       +LI  DEP+ YLD +     SK ++ F
Sbjct: 894 QIRGLSGG--QKVKLVLAACTWQRPHLIVLDEPTNYLDRDSLGALSKALKAF 943

>KLLA0A01452g 130078..131901 highly similar to sp|P40024
           Saccharomyces cerevisiae YER036c, start by similarity
          Length = 607

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 49/182 (26%), Positives = 89/182 (48%), Gaps = 42/182 (23%)

Query: 383 MMGENGTGKTTLIKLLAGALKP-DEGQDIPKLNVSMKPQK------IAPKFPGTVRQL-- 433
           ++GENG GK+T +K +A    P  E  DI  L+   +P +      +  +  G +++L  
Sbjct: 109 LLGENGCGKSTFLKAVASREYPIPENIDIYLLDEPAEPSEYSALEYVVREAQGELKRLED 168

Query: 434 FFKKIRGQFLNPQFQTDVVKPL--RIDDI----------------------IDQEVQHLS 469
             +KI    L    ++D+++PL  R+DD+                      I+++ + +S
Sbjct: 169 LVEKI---LLEDGPESDLLEPLYERMDDMDPSTFESRAAIILIGLGFNSKTINKKTKDMS 225

Query: 470 GGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEH--D 527
           GG   RVA+  AL +   + L+D+P+A+LD E  +   + ++RF     +T  +V H  D
Sbjct: 226 GGWKMRVALAKALFVKPTLLLLDDPTAHLDLEACVWLEEYLKRF----DRTLVLVSHSQD 281

Query: 528 FI 529
           F+
Sbjct: 282 FL 283

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 60/237 (25%), Positives = 96/237 (40%), Gaps = 48/237 (20%)

Query: 353 AFSYPSLKKTQGDFVLNVEEGEFSDSEILVMMGENGTGKTTLIKLLAGALKPDEG----Q 408
           +FSY     ++ +   +++ G   DS I  ++G NG GK+TL+K++ G L    G     
Sbjct: 396 SFSYDG--NSENNLYEHLDFGVDMDSRI-ALVGPNGVGKSTLLKIMTGQLTTQSGRVSRH 452

Query: 409 DIPKLNVSMKPQK------------IAPKFPGTVRQLFFKKIRGQF----LNPQFQTDVV 452
              KL V  +  +            +  K+P   +   F+  RGQ     L  + QT   
Sbjct: 453 SHVKLGVYSQHSQDQLDLTKSALEFVRDKYPHVSQD--FQYWRGQLGRYGLTGEGQT--- 507

Query: 453 KPLRIDDIIDQEVQHLSGGELQRVAI-VLALGIPADIYLIDEPSAYLDSEQRIICSKVIR 511
                      ++  LS G+  RV   +LAL  P ++ L+DEP+  LD       +  I 
Sbjct: 508 ----------VQMGTLSEGQRSRVVFALLALEQP-NVLLLDEPTNGLDIPTIDSLADAIN 556

Query: 512 RFILHNKKTAFIVEHDFIMATYLADKVIVFEGIPSKNAHARAPESLLTGCNRFLKNL 568
            F         +V HDF +   +A  + V E         R   S+L   N+  KN+
Sbjct: 557 EF----NGGVVVVSHDFRLLDKIAKDIFVVE----HKTATRWDGSILDYKNKLAKNV 605

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 43/189 (22%), Positives = 79/189 (41%), Gaps = 27/189 (14%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLEDDIK 165
           + LVG NG+GKST LKI+ G+     GR       +  + Y + S+ Q   TK   + ++
Sbjct: 421 IALVGPNGVGKSTLLKIMTGQLTTQSGRVSRHSHVKLGV-YSQHSQDQLDLTKSALEFVR 479

Query: 166 AIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKSPEDVKRYIKILQLENVLKRDIEKLSGG 225
                   D  P   +      G+L +  +    + V+               +  LS G
Sbjct: 480 --------DKYPHVSQDFQYWRGQLGRYGLTGEGQTVQ---------------MGTLSEG 516

Query: 226 ELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAAQIIRSLLAPTKYVICVEHDLSVLD 285
           +  R    +  +++ +V + DEP++ LD+    + A  I         V+ V HD  +LD
Sbjct: 517 QRSRVVFALLALEQPNVLLLDEPTNGLDIPTIDSLADAINEF---NGGVVVVSHDFRLLD 573

Query: 286 YLSDFVCII 294
            ++  + ++
Sbjct: 574 KIAKDIFVV 582

 Score = 39.7 bits (91), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 41/170 (24%), Positives = 76/170 (44%), Gaps = 33/170 (19%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKP-----NLGRFDDPPEWQE------IIKYFRGSE 151
           G+  GL+G NG GKST LK +A ++ P     ++   D+P E  E      +++  +G  
Sbjct: 104 GRRYGLLGENGCGKSTFLKAVASREYPIPENIDIYLLDEPAEPSEYSALEYVVREAQGE- 162

Query: 152 LQNYFTKMLEDDIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEK-SPEDVKRYIKILQ 210
                 K LED ++ I+             GP   + E L  RM+   P   +    I+ 
Sbjct: 163 -----LKRLEDLVEKILLED----------GPESDLLEPLYERMDDMDPSTFESRAAIIL 207

Query: 211 L-----ENVLKRDIEKLSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVK 255
           +        + +  + +SGG   R A+  +   +  + + D+P+++LD++
Sbjct: 208 IGLGFNSKTINKKTKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLE 257

>KLLA0D04554g complement(385733..388801) similar to sp|P25371
           Saccharomyces cerevisiae YCR011c ADP1 ATP-dependent
           permease, start by similarity
          Length = 1022

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 74/268 (27%), Positives = 113/268 (42%), Gaps = 68/268 (25%)

Query: 367 VLNVEEGEFSDSEILVMMGENGTGKTTLIKLLA---------GALKPDEGQDIPKLNVSM 417
           VLN   G     E+L +MG +G GKTTL+ +LA         G++K + G DI K   S 
Sbjct: 389 VLNEVTGSVKPGEMLAIMGGSGAGKTTLLDILAMKNKTGKVTGSIKVN-GVDIDKDKYSK 447

Query: 418 ------KPQKIAPKFP--GTV---------RQLFFKKIRGQFLNPQFQTDVVKPLRIDDI 460
                 +   + P      TV         RQL F   + +        DV++ LRI DI
Sbjct: 448 IIGFVDQEDYLLPTLTVYETVLNSALLRLPRQLSFSAKQRRVY------DVLEELRIFDI 501

Query: 461 IDQEV-----QHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFIL 515
            D+ +     + +SGGE +RV+I   L     +  +DEP++ LD+       + + R   
Sbjct: 502 RDRVIGSEYERGISGGEKRRVSIACELVTSPQVLFLDEPTSGLDANNANNVIECLVRLAN 561

Query: 516 HNKKTAFIVEHDFIMATY-LADKVIVFEG---IPSKNAHARAPESLLTGCNRFLKN---- 567
           H  KT  +  H    + + L DK+++      + S +AH           N FLKN    
Sbjct: 562 HYNKTLVLSIHQPRSSIFQLFDKLVLLSNGKMVYSGDAHK---------VNEFLKNEGYA 612

Query: 568 -----------LNVTFRRDPNSFRPRIN 584
                      ++VTF  +P+ F  R N
Sbjct: 613 CPPDYNIADYLIDVTF--EPSKFVTRAN 638

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 45/178 (25%), Positives = 80/178 (44%), Gaps = 28/178 (15%)

Query: 101 RPGQVLGLVGTNGIGKSTALKILAGKQKPNL--------GRFDDPPEWQEIIKYFRGSEL 152
           +PG++L ++G +G GK+T L ILA K K           G   D  ++ +II +    + 
Sbjct: 398 KPGEMLAIMGGSGAGKTTLLDILAMKNKTGKVTGSIKVNGVDIDKDKYSKIIGFV---DQ 454

Query: 153 QNYFTKMLEDDIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKSPEDVKRYIKILQLE 212
           ++Y    L   +   +    +  +PR +    +          ++   DV   ++I  + 
Sbjct: 455 EDYLLPTLT--VYETVLNSALLRLPRQLSFSAK----------QRRVYDVLEELRIFDIR 502

Query: 213 N-VLKRDIEK-LSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAAQIIRSLL 268
           + V+  + E+ +SGGE +R +I    V    V   DEP+S LD     NA  +I  L+
Sbjct: 503 DRVIGSEYERGISGGEKRRVSIACELVTSPQVLFLDEPTSGLDAN---NANNVIECLV 557

>CAGL0K10472g 1020016..1022274 highly similar to sp|P43535
           Saccharomyces cerevisiae YFR009w GCN20 positive effector
           of GCN2P, start by similarity
          Length = 752

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 43/181 (23%), Positives = 79/181 (43%), Gaps = 31/181 (17%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLEDDIK 165
           + LVG NG GK+T LK++  + +P  G     P  +             YFT+   D + 
Sbjct: 561 IALVGANGCGKTTLLKVMLEQLRPLSGYVSRNPRLR-----------IGYFTQHHVDSMD 609

Query: 166 AIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKSPEDVKRYIKILQLENVLK-RDIEKLSG 224
             +    VD + +   G              K+ E+ +R++    +   L  + ++ LSG
Sbjct: 610 --LSTSAVDWMSKTFPG--------------KTDEEYRRHLGSFGITGTLGLQKMQLLSG 653

Query: 225 GELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAAQIIRSLLAPTKYVICVEHDLSVL 284
           G+  R A    C+    + + DEPS++LD         ++ ++   T  ++ V HD+SV+
Sbjct: 654 GQKSRVAFAALCLNNPHILILDEPSNHLDTT---GIDALVDAMKNFTGGILMVSHDISVI 710

Query: 285 D 285
           +
Sbjct: 711 N 711

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 43/141 (30%), Positives = 66/141 (46%), Gaps = 32/141 (22%)

Query: 377 DSEILVMMGENGTGKTTLIKLLAGALKPDEG--QDIPKLNVSMKPQK------------- 421
           DS I  ++G NG GKTTL+K++   L+P  G     P+L +    Q              
Sbjct: 558 DSRI-ALVGANGCGKTTLLKVMLEQLRPLSGYVSRNPRLRIGYFTQHHVDSMDLSTSAVD 616

Query: 422 -IAPKFPGTVRQLFFKKIRGQFLNPQFQTDVVKPLRIDDIIDQEVQHLSGGELQRVAI-V 479
            ++  FPG   + + + + G F        +   L +     Q++Q LSGG+  RVA   
Sbjct: 617 WMSKTFPGKTDEEYRRHL-GSF-------GITGTLGL-----QKMQLLSGGQKSRVAFAA 663

Query: 480 LALGIPADIYLIDEPSAYLDS 500
           L L  P  I ++DEPS +LD+
Sbjct: 664 LCLNNPH-ILILDEPSNHLDT 683

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 51/217 (23%), Positives = 92/217 (42%), Gaps = 29/217 (13%)

Query: 103 GQVLGLVGTNGIGKSTALKILA--------------------GKQKPNLGRFDDPPEW-- 140
           G   GLVG NGIGKST L+ L+                    G +   L    D   W  
Sbjct: 225 GHRYGLVGQNGIGKSTLLRALSRRELNVPKHISILHVEQELRGDETKALQSVLDADVWRK 284

Query: 141 QEIIKYFRGSELQNYFTKMLEDDIKAIIKPQYVDNIPRAIKGPVQKVGE-LLKLRMEKSP 199
           Q + +  + +E      K+ E+  +  ++ + +DN    +   + ++ E L+ +  +K+ 
Sbjct: 285 QLLTEENKINERLKEIEKLREEFDEDSLEVKKLDNEREDLDAHLIQISEKLVDMESDKAE 344

Query: 200 EDVKRYIKILQLENVLKRD-IEKLSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRL 258
                 +  L      ++      SGG   R ++  +   + D+ + DEPS+ LDV    
Sbjct: 345 ARAASILYGLGFSTEAQQQPTNSFSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPSIA 404

Query: 259 NAAQIIRSLLAPTKYVICVEHDLSVLDYLSDFVCIIY 295
             A+ ++S   P+  V+ V HD + L+ ++    IIY
Sbjct: 405 YLAEYLKSY--PST-VLTVSHDRAFLNEVA--TDIIY 436

 Score = 31.6 bits (70), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 33/77 (42%), Gaps = 4/77 (5%)

Query: 463 QEVQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAF 522
           Q     SGG   R+++  AL    D+ L+DEPS  LD       ++ ++ +      T  
Sbjct: 363 QPTNSFSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPSIAYLAEYLKSY----PSTVL 418

Query: 523 IVEHDFIMATYLADKVI 539
            V HD      +A  +I
Sbjct: 419 TVSHDRAFLNEVATDII 435

>KLLA0F12210g 1125630..1128764 highly similar to sp|P16521
           Saccharomyces cerevisiae YLR249w YEF3 translation
           elongation factor eEF3 P6.7.f5.1, start by similarity
          Length = 1044

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 50/193 (25%), Positives = 81/193 (41%), Gaps = 12/193 (6%)

Query: 219 IEKLSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAAQIIRSLLAPTKYVICVE 278
           I  LSGG   + A+  + ++ AD+ + DEP+++LD    +N   ++  L       I V 
Sbjct: 541 IASLSGGWKMKLALARAVLKNADILLLDEPTNHLDT---VNVNWLVEYLNTCGITSIIVS 597

Query: 279 HDLSVLDYLSDFVCIIYGVPSVYGVVTLPASVREGINIFLDGHIPAENLRFR-TEALQFR 337
           HD   LD +  ++    G+        L   V++         + A  L FR  E     
Sbjct: 598 HDSGFLDKVCQYIIHYEGLKLRKYKGNLSEFVKKCPTAKSYYELGASELEFRFPEPGYLE 657

Query: 338 IADATEDLQNDSASRAFSYPSLKKTQGDFVLNVEEGEF--SDSEILVMMGENGTGKTTLI 395
                +      ++  F YP   K Q      + +  F  S S  + ++G NG GK+TLI
Sbjct: 658 GVKTKQKAIVKVSNMTFQYPGTAKPQ------ISDISFQCSLSSRIAVIGPNGAGKSTLI 711

Query: 396 KLLAGALKPDEGQ 408
            +L G L P  G+
Sbjct: 712 NVLTGELLPTVGE 724

 Score = 39.7 bits (91), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 41/164 (25%), Positives = 75/164 (45%), Gaps = 10/164 (6%)

Query: 383 MMGENGTGKTTLIKLLA-GALKPDEGQDIPKLNVSMKPQKIAPKFPGTVRQLFFKKIRGQ 441
           + G NG GK+TL++ +A G +     Q+  +  V ++      +   +V    F    G 
Sbjct: 461 LCGPNGAGKSTLMRAIANGQVDGFPTQEECR-TVYVEHDIDGTQADTSVVDFVFS---GN 516

Query: 442 FLNPQFQTDVVKPLRI-DDIIDQEVQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDS 500
                  TD ++     D++I   +  LSGG   ++A+  A+   ADI L+DEP+ +LD+
Sbjct: 517 VGTKDVITDKLREFGFSDEMIAMPIASLSGGWKMKLALARAVLKNADILLLDEPTNHLDT 576

Query: 501 EQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIVFEGI 544
               +    +  ++     T+ IV HD      +   +I +EG+
Sbjct: 577 ----VNVNWLVEYLNTCGITSIIVSHDSGFLDKVCQYIIHYEGL 616

 Score = 35.8 bits (81), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 61/289 (21%), Positives = 104/289 (35%), Gaps = 94/289 (32%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLG-----------------------RFDDPPEWQE 142
           + ++G NG GKST + +L G+  P +G                         D  P   E
Sbjct: 697 IAVIGPNGAGKSTLINVLTGELLPTVGEVYTHENCRIAYIKQHAFAHIESHLDKTP--SE 754

Query: 143 IIKY-FRGSELQNYFTK----MLEDDIKAIIKPQYVDNIPRAIKG--------------- 182
            I++ F+  E +    +    + EDD +A+ K   +D  PR I G               
Sbjct: 755 YIQWRFQTGEDRETMDRANRVINEDDAEAMNKIFKIDGTPRRIAGIHARRKFKNTYEYEC 814

Query: 183 ----------------PVQKV-------GELLKLRMEKSPE-DVKRYIKILQLENVLKRD 218
                           P+  V       GEL++   +   E D+K  +   Q   + +++
Sbjct: 815 SFLLGENIGMKSERWVPMMSVDNAWLPRGELVESHSKMVAEVDMKEALASGQFRPLTRKE 874

Query: 219 IEK-------------------LSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLN 259
           IE+                   LSGG+  +  +     Q   + + DEP++YLD   R +
Sbjct: 875 IEEHCAMLGLDAELVSHSRIRGLSGGQKVKLVLAACTWQRPHLIVLDEPTNYLD---RDS 931

Query: 260 AAQIIRSLLAPTKYVICVEHDLSVLDYLSDFVCIIYG---VPSVYGVVT 305
              + ++L A    VI + H       L++ V  +      PS +  VT
Sbjct: 932 LGALSKALKAFEGGVIIITHSAEFTKNLTEEVWAVKDGRMTPSGHNWVT 980

>AGR047W [4357] [Homologous to ScYDR135C (YCF1) - SH]
           complement(802685..807163) [4479 bp, 1492 aa]
          Length = 1492

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 50/184 (27%), Positives = 85/184 (46%), Gaps = 31/184 (16%)

Query: 378 SEILVMMGENGTGKTTLIKLLAGALKPDEGQDIPKLNVSMKPQKIAPKFPGTVRQ--LFF 435
           SE+  ++G+ G+GK+ LI+ + G L    G  + + NV+   Q +A    GTVR   LF 
Sbjct: 638 SELTCIIGKVGSGKSALIQAMLGDLFRVNGSAVVRGNVAYVSQ-VAWIMNGTVRDNILFG 696

Query: 436 KKIRGQFLNPQFQTDVVKPLRID---------DIIDQEVQHLSGGELQRVAIVLALGIPA 486
            K   +F     QT     L +D           + ++   LSGG+  R+++  A+   A
Sbjct: 697 HKYDAKFYQ---QTIKACALTVDLSILPDGDNTFVGEKGISLSGGQKARLSLARAVYARA 753

Query: 487 DIYLIDEPSAYLDSEQRIICSKVIRRFILHN--------KKTAFIVEHDFIMATYLADKV 538
           D YL+D+P A +D          + + +L N        K  A ++  + I A  +AD +
Sbjct: 754 DTYLLDDPLAAVDEH--------VAKHLLQNVFGPNGLLKSKARVLTTNKITALEIADHI 805

Query: 539 IVFE 542
           ++ E
Sbjct: 806 VLLE 809

>Kwal_33.15623
          Length = 562

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 49/194 (25%), Positives = 89/194 (45%), Gaps = 15/194 (7%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLED 162
           G  + +VG NGIGK+T LK+L+G         DD P    I    R   L  +F ++  +
Sbjct: 61  GDKVTIVGENGIGKTTFLKLLSG--------VDDYPFSGSIEIEGRIGFLPQHFEEVDGN 112

Query: 163 --DIKAIIKPQYVDNIPRAIKGPVQKVG-ELLKLRMEKSPEDVKRYIKILQL-ENVLKRD 218
              ++ ++K  Y D I   ++ P+     E ++        ++ R +  + L + +L+R 
Sbjct: 113 LLAVEVLLKSLYDDEINEFLELPLTPFSHEWIQELNSLGGHEIFRQVSHIGLRQEILRRP 172

Query: 219 IEKLSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAAQIIRSLLAPTKYVICVE 278
              LSGGE  +  +    +   D  + DEP+++LD K        +R        V+ V 
Sbjct: 173 FRLLSGGEKTKTLLCALSILNPDFILLDEPTNHLDTKGIEWLEFFLRKF---NGTVVMVT 229

Query: 279 HDLSVLDYLSDFVC 292
           HD ++++ +S F+ 
Sbjct: 230 HDRALINAVSSFIS 243

 Score = 37.0 bits (84), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 34/135 (25%), Positives = 56/135 (41%), Gaps = 16/135 (11%)

Query: 375 FSDSEILVMMGENGTGKTTLIKLLAGALKPDEGQDIPKLNVSMKPQKIAPKFPGTVRQLF 434
            +  E LV+ G NG GKTTL ++L   +KPD G       VSM    +          L 
Sbjct: 390 LTKGERLVIQGPNGCGKTTLNRILMAHIKPDHG------TVSMSGNAVVGYLDQEQENLP 443

Query: 435 FKKIRGQFLNPQFQTDVVKPLRIDDIID----------QEVQHLSGGELQRVAIVLALGI 484
            +K   Q L    + D  +   I ++ D            ++ LS G  ++  +   +  
Sbjct: 444 LEKSPIQLLEEDPKIDASRQTAIRNLRDFGIYKWHDLKSPLRDLSVGCRRKTQLCQIIMR 503

Query: 485 PADIYLIDEPSAYLD 499
              I ++DEP+ ++D
Sbjct: 504 KCSILVLDEPTNHID 518

 Score = 33.1 bits (74), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 41/173 (23%), Positives = 71/173 (41%), Gaps = 31/173 (17%)

Query: 381 LVMMGENGTGKTTLIKLLAGALK-PDEGQDIPKLNVSMKPQKIAP------KFPGTVRQL 433
           + ++GENG GKTT +KLL+G    P  G    +  +   PQ               ++ L
Sbjct: 64  VTIVGENGIGKTTFLKLLSGVDDYPFSGSIEIEGRIGFLPQHFEEVDGNLLAVEVLLKSL 123

Query: 434 FFKKIRGQFLN---PQFQTDVVKPLRI----------------DDIIDQEVQHLSGGELQ 474
           +  +I  +FL      F  + ++ L                   +I+ +  + LSGGE  
Sbjct: 124 YDDEI-NEFLELPLTPFSHEWIQELNSLGGHEIFRQVSHIGLRQEILRRPFRLLSGGEKT 182

Query: 475 RVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHD 527
           +  +     +  D  L+DEP+ +LD++        +R+F      T  +V HD
Sbjct: 183 KTLLCALSILNPDFILLDEPTNHLDTKGIEWLEFFLRKF----NGTVVMVTHD 231

>CAGL0L07744g 849961..853128 similar to sp|P25371 Saccharomyces
           cerevisiae YCR011c ADP1 ATP-dependent permease, start by
           similarity
          Length = 1055

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 55/198 (27%), Positives = 85/198 (42%), Gaps = 34/198 (17%)

Query: 339 ADATEDLQNDSASRAFSYPSL----------KKTQGDFVLNVEEGEFSDSEILVMMGENG 388
           AD TE+    S S   ++ ++          +  +   VLN   G     EIL +MG +G
Sbjct: 354 ADETENFLQSSKSATLTFENINYYVAASANSRSDEKQRVLNDISGLVKPGEILSIMGGSG 413

Query: 389 TGKTTLIKLLAGALKPDEGQDIPKLNVSMKPQKIAPKFPGTVRQ----LFFKKIRGQFLN 444
            GKTTL+ +LA   K  +     ++N  +  +K   K  G V Q    L    +    LN
Sbjct: 414 AGKTTLLDILAMKRKTGDVSGSIRVNGKVVSRKDYTKLIGFVDQDDYLLPTLTVYETVLN 473

Query: 445 P---------QFQT------DVVKPLRIDDIIDQEVQH-----LSGGELQRVAIVLALGI 484
                      F+        V++ LRI DI D+ V +     +SGGE +RV+I   L  
Sbjct: 474 SALLRLPRTMSFEAKQARVFHVLEELRIMDIKDRIVGNDFERGISGGEKRRVSIACELVT 533

Query: 485 PADIYLIDEPSAYLDSEQ 502
              +  +DEP++ LD+  
Sbjct: 534 SPLVLFLDEPTSGLDANN 551

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 43/177 (24%), Positives = 79/177 (44%), Gaps = 26/177 (14%)

Query: 101 RPGQVLGLVGTNGIGKSTALKILAGKQKPN--------LGRFDDPPEWQEIIKYFRGSEL 152
           +PG++L ++G +G GK+T L ILA K+K           G+     ++ ++I +    + 
Sbjct: 401 KPGEILSIMGGSGAGKTTLLDILAMKRKTGDVSGSIRVNGKVVSRKDYTKLIGFV---DQ 457

Query: 153 QNYFTKMLEDDIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKSPEDVKRYIKILQLE 212
            +Y    L   +   +    +  +PR +    ++   +  +  E    D+K        +
Sbjct: 458 DDYLLPTLT--VYETVLNSALLRLPRTMSFEAKQ-ARVFHVLEELRIMDIK--------D 506

Query: 213 NVLKRDIEK-LSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAAQIIRSLL 268
            ++  D E+ +SGGE +R +I    V    V   DEP+S LD     NA  +I  L+
Sbjct: 507 RIVGNDFERGISGGEKRRVSIACELVTSPLVLFLDEPTSGLDAN---NANNVIECLV 560

>CAGL0K00363g complement(37452..41135) similar to sp|P12866
           Saccharomyces cerevisiae YKL209c STE6, hypothetical
           start
          Length = 1227

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 46/172 (26%), Positives = 73/172 (42%), Gaps = 30/172 (17%)

Query: 383 MMGENGTGKTTLIKLLAGALKPDEGQ------DIPKLNVSMKPQKIAPKFPGTVRQLFFK 436
           ++G +G+GK+TL  L+        G       DI  +N ++  + I          LF  
Sbjct: 385 VIGPSGSGKSTLFDLILLHYDNYHGSIMLGDLDIRSINRNIILENIT--LVSQTPTLFND 442

Query: 437 KIRGQFLNPQFQTDVVKPLRID----------------DIIDQEVQH----LSGGELQRV 476
            IR   L     T++   L ++                D +D  +      LSGG+ Q+V
Sbjct: 443 TIRNNILACSNWTNLPSKLEMECICKFALLENLIAELPDGLDTRIGSGGIKLSGGQAQKV 502

Query: 477 AIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDF 528
           A+  A      I L+DEP + +D  QRI+  + I+R+   N KT  I+ HD 
Sbjct: 503 ALARAFARNTSILLLDEPLSAVDMRQRIVLMENIKRW--RNGKTTVIITHDL 552

 Score = 38.1 bits (87), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 34/61 (55%), Gaps = 1/61 (1%)

Query: 221 KLSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAAQIIRSLLAPTKYVICVEHD 280
           KLSGG+ Q+ A+  +  +   + + DEP S +D++QR+   + I+      K  + + HD
Sbjct: 493 KLSGGQAQKVALARAFARNTSILLLDEPLSAVDMRQRIVLMENIKR-WRNGKTTVIITHD 551

Query: 281 L 281
           L
Sbjct: 552 L 552

 Score = 36.6 bits (83), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 48/185 (25%), Positives = 78/185 (42%), Gaps = 30/185 (16%)

Query: 102  PGQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLE 161
              Q+ G+VG +G GKST + ++ G    + G  +               ++  + TK L 
Sbjct: 1019 SNQIYGIVGKSGSGKSTLINLICGLYSLSEGSIN-----------ICSCDINKWSTKELH 1067

Query: 162  DDIKAIIKPQYV---DNI-PRAIKGPVQKVGELLKLRMEKSPEDVKRYIK----ILQLEN 213
              + A+++   V   D I    + G  + VG+       +   +V  Y+     I+ L N
Sbjct: 1068 KTV-ALLQQNPVLQFDTIRNNLLYGLTETVGD-------EHLLNVLEYVGLKSFIISLNN 1119

Query: 214  VL--KRDIEKLSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAAQIIRS-LLAP 270
             L  K D   LSGG+ QR  +    ++   V + DE +S LDV        II S  LAP
Sbjct: 1120 GLDSKLDDSLLSGGQSQRLCMAREMLRNPKVLILDECTSALDVTSAKKINDIIGSRSLAP 1179

Query: 271  TKYVI 275
               ++
Sbjct: 1180 VTIIV 1184

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 41/172 (23%), Positives = 84/172 (48%), Gaps = 27/172 (15%)

Query: 350  ASRAFSYPSL--KKTQGDFVLNVEEGEFSDSEILVMMGENGTGKTTLIKLLAGALKPDEG 407
            ++ +F+Y  +  KKT    + N+    +S+ +I  ++G++G+GK+TLI L+ G     EG
Sbjct: 995  SNLSFTYAQVHNKKT----LTNINMQLYSN-QIYGIVGKSGSGKSTLINLICGLYSLSEG 1049

Query: 408  Q-DIPKLNVSMKPQKIAPKFPGTVRQ---LFFKKIRGQFLNPQFQT-------DVVKP-- 454
              +I   +++    K   K    ++Q   L F  IR   L    +T       +V++   
Sbjct: 1050 SINICSCDINKWSTKELHKTVALLQQNPVLQFDTIRNNLLYGLTETVGDEHLLNVLEYVG 1109

Query: 455  -----LRIDDIIDQEVQH--LSGGELQRVAIVLALGIPADIYLIDEPSAYLD 499
                 + +++ +D ++    LSGG+ QR+ +   +     + ++DE ++ LD
Sbjct: 1110 LKSFIISLNNGLDSKLDDSLLSGGQSQRLCMAREMLRNPKVLILDECTSALD 1161

>Scas_716.81
          Length = 1565

 Score = 49.3 bits (116), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 50/199 (25%), Positives = 92/199 (46%), Gaps = 26/199 (13%)

Query: 90  NSFKLHRLPTPRPGQVLGLVGTNGIGKSTALKILAGK--QKPNLGR----FDDPPEWQEI 143
           NS+ L      +PG+++ ++G  G G S+ LK++AG+  Q P   +    +D  P+ +E+
Sbjct: 236 NSYAL-----AKPGEMILVLGRPGAGCSSFLKVIAGEIDQFPGGVKGEITYDGIPQ-KEM 289

Query: 144 IKYFRGSELQNYFTKMLEDDIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKSPEDVK 203
           +K+++   + N     L+     +   Q +D    A K P ++V  + +    KS  ++ 
Sbjct: 290 MKHYKSDVIYN---GELDVHFPHLTVQQTLD-FALACKTPAKRVNNISRDEYIKSSREL- 344

Query: 204 RYIKILQLENVLKRD-----IEKLSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRL 258
            Y  I  L +          +  +SGGE +R +I  +      +Y +D  +  LD    L
Sbjct: 345 -YATIFGLRHTYNTKVGNDFVRGVSGGERKRVSIAEALAANGSIYCWDNATRGLDASTAL 403

Query: 259 NAAQIIR---SLLAPTKYV 274
             A+ IR   +LL  T +V
Sbjct: 404 EYAKAIRIMTNLLGSTAFV 422

 Score = 39.7 bits (91), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 42/185 (22%), Positives = 84/185 (45%), Gaps = 20/185 (10%)

Query: 102  PGQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYF--RGSELQNYFTKM 159
            PG +  L+G +G GK+T L  LA + +  +   D     + +   F  R   +Q     +
Sbjct: 940  PGTLTALMGESGAGKTTLLNTLAKRNEIGVVTGDMLVNGRPVDASFERRTGYVQQQDIHI 999

Query: 160  LEDDIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKSPEDVKRYIKILQLENVLKRDI 219
             E  ++  +  Q+   + R+     + V +  KL        V++ I++L++E      +
Sbjct: 1000 AELTVRESL--QFSARMRRS-----EHVSDEEKLAY------VEKIIRVLEMEEFADALV 1046

Query: 220  EKLSGG----ELQRFAIGMSCVQEADVYMF-DEPSSYLDVKQRLNAAQIIRSLLAPTKYV 274
              +  G    + ++ +IG+  V + D+ +F DEP+S LD +      Q++R L    + +
Sbjct: 1047 GAIGCGLNVEQRKKLSIGVELVAKPDLLLFLDEPTSGLDSQSSWAIVQLLRKLAQAGQSI 1106

Query: 275  ICVEH 279
            +C  H
Sbjct: 1107 LCTIH 1111

 Score = 34.7 bits (78), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 30/60 (50%)

Query: 465 VQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIV 524
           V+ +SGGE +RV+I  AL     IY  D  +  LD+   +  +K IR        TAF+ 
Sbjct: 364 VRGVSGGERKRVSIAEALAANGSIYCWDNATRGLDASTALEYAKAIRIMTNLLGSTAFVT 423

>YER036C (YER036C) [1461] chr5 complement(223366..225198) Member of
           the non-transporter group of the ATP-binding cassette
           (ABC) superfamily [1833 bp, 610 aa]
          Length = 610

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 49/179 (27%), Positives = 85/179 (47%), Gaps = 36/179 (20%)

Query: 383 MMGENGTGKTTLIKLLAGALKP-DEGQDIPKLNVSMKPQKI-APKFPGTVRQLFFKKIRG 440
           ++GENG GK+T +K LA    P  E  DI  L+   +P ++ A  +  T  Q   K+I  
Sbjct: 112 LLGENGCGKSTFLKALATREYPIPEHIDIYLLDEPAEPSELSALDYVVTEAQHELKRIED 171

Query: 441 ----QFLNPQFQTDVVKPL--RIDDI----------------------IDQEVQHLSGGE 472
                 L    ++++++PL  R+D +                      I ++ + +SGG 
Sbjct: 172 LVEKTILEDGPESELLEPLYERMDSLDPDTFESRAAIILIGLGFNKKTILKKTKDMSGGW 231

Query: 473 LQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEH--DFI 529
             RVA+  AL +   + L+D+P+A+LD E  +   + ++RF     +T  +V H  DF+
Sbjct: 232 KMRVALAKALFVKPTLLLLDDPTAHLDLEACVWLEEYLKRF----DRTLVLVSHSQDFL 286

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 57/198 (28%), Positives = 88/198 (44%), Gaps = 16/198 (8%)

Query: 377 DSEILVMMGENGTGKTTLIKLLAGALKPDEGQDIPKLNVSMK--PQKIAPKFPGTVRQLF 434
           DS I  ++G NG GK+TL+K++ G L P  G+     +V +    Q    +   T   L 
Sbjct: 421 DSRI-ALVGPNGVGKSTLLKIMTGELTPQSGRVSRHTHVKLGVYSQHSQDQLDLTKSALE 479

Query: 435 FKKIRGQFLNPQFQTDVVKPLRIDDIID-QEVQHLSGGELQRVAIV---LALGIPADIYL 490
           F + +   ++  FQ    +  R     + Q VQ  +  E QR  +V   LAL  P ++ L
Sbjct: 480 FVRDKYSNISQDFQFWRGQLGRYGLTGEGQTVQMATLSEGQRSRVVFALLALEQP-NVLL 538

Query: 491 IDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIVFEGIPSKNAH 550
           +DEP+  LD       +  I  F         +V HDF +   +A  + V E   +K A 
Sbjct: 539 LDEPTNGLDIPTIDSLADAINEF----NGGVVVVSHDFRLLDKIAQDIFVVE---NKTA- 590

Query: 551 ARAPESLLTGCNRFLKNL 568
            R   S+L   N+  KN+
Sbjct: 591 TRWDGSILQYKNKLAKNV 608

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 48/190 (25%), Positives = 84/190 (44%), Gaps = 29/190 (15%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTK-MLEDDI 164
           + LVG NG+GKST LKI+ G+  P  GR       +  + Y + S+ Q   TK  LE   
Sbjct: 424 IALVGPNGVGKSTLLKIMTGELTPQSGRVSRHTHVKLGV-YSQHSQDQLDLTKSALE--- 479

Query: 165 KAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKSPEDVKRYIKILQLENVLKRDIEKLSG 224
              ++ +Y  NI +  +    ++G               RY    + + V    +  LS 
Sbjct: 480 --FVRDKY-SNISQDFQFWRGQLG---------------RYGLTGEGQTV---QMATLSE 518

Query: 225 GELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAAQIIRSLLAPTKYVICVEHDLSVL 284
           G+  R    +  +++ +V + DEP++ LD+    + A  I         V+ V HD  +L
Sbjct: 519 GQRSRVVFALLALEQPNVLLLDEPTNGLDIPTIDSLADAINEF---NGGVVVVSHDFRLL 575

Query: 285 DYLSDFVCII 294
           D ++  + ++
Sbjct: 576 DKIAQDIFVV 585

 Score = 42.7 bits (99), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 44/166 (26%), Positives = 81/166 (48%), Gaps = 25/166 (15%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKP-----NLGRFDDPPEWQEIIKY-FRGSELQNYF 156
           G+  GL+G NG GKST LK LA ++ P     ++   D+P E  E+    +  +E Q+  
Sbjct: 107 GRRYGLLGENGCGKSTFLKALATREYPIPEHIDIYLLDEPAEPSELSALDYVVTEAQHEL 166

Query: 157 TKMLEDDIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEK-SPEDVKRYIKILQL---- 211
            K +ED ++  I             GP  ++ E L  RM+   P+  +    I+ +    
Sbjct: 167 -KRIEDLVEKTILED----------GPESELLEPLYERMDSLDPDTFESRAAIILIGLGF 215

Query: 212 --ENVLKRDIEKLSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVK 255
             + +LK+  + +SGG   R A+  +   +  + + D+P+++LD++
Sbjct: 216 NKKTILKK-TKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLE 260

>AER190W [2692] [Homologous to ScYCR011C (ADP1) - SH; ScYOL075C -
           SH] complement(994534..997569) [3036 bp, 1011 aa]
          Length = 1011

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 51/184 (27%), Positives = 75/184 (40%), Gaps = 24/184 (13%)

Query: 367 VLNVEEGEFSDSEILVMMGENGTGKTTLIKLLAGALKPDEGQDIPKLNVSMKPQKIAPKF 426
           +LN   G  S  EIL +MG +G GKT L+ +L    K  E     K+N     +    K 
Sbjct: 383 ILNSISGYVSPGEILAVMGGSGAGKTCLLDILGMKNKAGEVSGTVKINGVPITKHTVSKV 442

Query: 427 PGTVRQ----LFFKKIRGQFLNPQFQ---------------TDVVKPLRIDDIIDQEVQH 467
            G V Q    L    +    LN                     V++ LRI DI D+ + +
Sbjct: 443 VGFVDQDNHLLPTLTVYETVLNSALLRLPRSMSFAAKQKRVYQVLEELRIFDIRDRLIGN 502

Query: 468 -----LSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAF 522
                +SGGE +RV+I   L     I  +DEP++ LDS       + + R     ++T  
Sbjct: 503 DFERGISGGEKRRVSIACELVTSPLILFLDEPTSGLDSNNANNVIECLVRLASQYRRTLV 562

Query: 523 IVEH 526
           +  H
Sbjct: 563 LSIH 566

 Score = 36.2 bits (82), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 41/174 (23%), Positives = 74/174 (42%), Gaps = 22/174 (12%)

Query: 102 PGQVLGLVGTNGIGKSTALKILAGKQKPN----LGRFDDPPEWQEIIKYFRGSELQ-NYF 156
           PG++L ++G +G GK+  L IL  K K        + +  P  +  +    G   Q N+ 
Sbjct: 393 PGEILAVMGGSGAGKTCLLDILGMKNKAGEVSGTVKINGVPITKHTVSKVVGFVDQDNHL 452

Query: 157 TKMLEDDIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKSPEDVKRYIKILQLEN-VL 215
              L   +   +    +  +PR++    +          +K    V   ++I  + + ++
Sbjct: 453 LPTL--TVYETVLNSALLRLPRSMSFAAK----------QKRVYQVLEELRIFDIRDRLI 500

Query: 216 KRDIEK-LSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAAQIIRSLL 268
             D E+ +SGGE +R +I    V    +   DEP+S LD     NA  +I  L+
Sbjct: 501 GNDFERGISGGEKRRVSIACELVTSPLILFLDEPTSGLDSN---NANNVIECLV 551

>Scas_566.1
          Length = 466

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 60/226 (26%), Positives = 103/226 (45%), Gaps = 28/226 (12%)

Query: 90  NSFKLHRLPTPRPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRG 149
           NSF L  LP+   G V+ ++G +G GK+T L +LA K    L + D    +    K  R 
Sbjct: 68  NSFSLD-LPS---GSVMAVMGGSGSGKTTLLNVLASKISGGL-KTDGDIHYILEEKPQRD 122

Query: 150 SELQNYFTKMLEDDIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKSPEDVKRYIKIL 209
           SE +    + ++D +K    PQ   ++  A     + +     L++++S E+ K  +  L
Sbjct: 123 SEQE----QEVQDHVKMAYLPQ--QDVLSARLTCRETLMYAADLKLDRSKEEKKLVVDQL 176

Query: 210 QLENVLKRDIEKL---------SGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNA 260
             E  LK   E L         SGGE +R ++G   +    +   DEP++ LD     +A
Sbjct: 177 IHELGLKDCAETLVGDNTHRGLSGGEKRRLSVGTQMISNPSIMFLDEPTTGLDA---YSA 233

Query: 261 AQIIRSLLAPTK-----YVICVEHDLSVLDYLSDFVCIIYGVPSVY 301
             ++++L    K     +++ +    S + +L D VCI+     VY
Sbjct: 234 YLVVKTLKKLAKEDGRTFIMSIHQPRSDILFLLDQVCILSKGKVVY 279

 Score = 36.2 bits (82), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 46/199 (23%), Positives = 80/199 (40%), Gaps = 50/199 (25%)

Query: 380 ILVMMGENGTGKTTLIKLLA----GALKPD-------------------EGQDIPKLNVS 416
           ++ +MG +G+GKTTL+ +LA    G LK D                   E QD  K+  +
Sbjct: 79  VMAVMGGSGSGKTTLLNVLASKISGGLKTDGDIHYILEEKPQRDSEQEQEVQDHVKM--A 136

Query: 417 MKPQKIAPKFPGTVRQLFF--------------KKIRGQFLNPQFQTDVVKPLRIDDIID 462
             PQ+       T R+                 K +  Q ++     D  + L    + D
Sbjct: 137 YLPQQDVLSARLTCRETLMYAADLKLDRSKEEKKLVVDQLIHELGLKDCAETL----VGD 192

Query: 463 QEVQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAF 522
              + LSGGE +R+++   +     I  +DEP+  LD+    +  K +++    + +T  
Sbjct: 193 NTHRGLSGGEKRRLSVGTQMISNPSIMFLDEPTTGLDAYSAYLVVKTLKKLAKEDGRT-- 250

Query: 523 IVEHDFIMATYLADKVIVF 541
                FIM+ +     I+F
Sbjct: 251 -----FIMSIHQPRSDILF 264

>Scas_288.1
          Length = 494

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 51/214 (23%), Positives = 93/214 (43%), Gaps = 22/214 (10%)

Query: 102 PGQVLGLVGTNGIGKSTALKILAGKQKPNLG------RFDDPPEWQEIIKYFRGSELQNY 155
            G+++ ++G  G G S+ LK+ AG+     G       +D  P+  E++K +R   + N 
Sbjct: 72  AGEMVLVLGRPGAGCSSFLKVTAGETDQFAGGVTGEIAYDGIPQ-DEMMKKYRADVIYN- 129

Query: 156 FTKMLEDDIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKSPEDVKRYIKILQLENVL 215
               L+     +   Q +D    A K P ++V ++ K    KS  ++  Y  I  L +  
Sbjct: 130 --GELDVHFPYLTVQQTLD-FAIACKTPAKRVNDVSKEEYIKSTREL--YATIFGLRHTY 184

Query: 216 KRD-----IEKLSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAAQIIR---SL 267
                   +  +SGGE +R +I  +      +Y +D  +  LD    L  A+ IR   +L
Sbjct: 185 NTKVGNDFVRGVSGGERKRVSIAEALAANGTIYCWDNATRGLDASTALEYAKAIRIMTNL 244

Query: 268 LAPTKYVICVEHDLSVLDYLSDFVCIIYGVPSVY 301
           L  T +V   +   ++ +   D V ++Y    +Y
Sbjct: 245 LKSTAFVTIYQASENIYETF-DKVTVLYSGRQIY 277

 Score = 37.4 bits (85), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 34/62 (54%), Gaps = 4/62 (6%)

Query: 465 VQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHN--KKTAF 522
           V+ +SGGE +RV+I  AL     IY  D  +  LD+   +  +K IR  I+ N  K TAF
Sbjct: 193 VRGVSGGERKRVSIAEALAANGTIYCWDNATRGLDASTALEYAKAIR--IMTNLLKSTAF 250

Query: 523 IV 524
           + 
Sbjct: 251 VT 252

>CAGL0I08019g complement(782863..786720) highly similar to sp|Q08234
           Saccharomyces cerevisiae YOL075c, hypothetical start
          Length = 1285

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 48/203 (23%), Positives = 94/203 (46%), Gaps = 46/203 (22%)

Query: 101 RPGQVLGLVGTNGIGKSTALKILAGKQKPNLG---------RFDDPPEWQEIIKYFRGSE 151
           +PG +  ++G +G GKS+ L +++G+ + +L          + +D P  Q++ K+     
Sbjct: 710 KPGMINAIMGPSGSGKSSFLNLISGRLESSLLVKFNTAGTIKLNDTPISQDMFKHLCSYV 769

Query: 152 LQNYFTKMLEDDIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKSPEDVKR-----YI 206
            Q+      +D + A++  +   +   A             LR++   +D KR      I
Sbjct: 770 SQD------DDHLLAMLTVRETFDFAAA-------------LRLKHLSKDDKRSRTDSLI 810

Query: 207 KILQL---ENVLKRD--IEKLSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAA 261
            IL L   EN +  +  I+ +SGGE +R ++G+  + +  + + DEP+S LD        
Sbjct: 811 AILGLKHCENTIIGNEFIKGISGGEKRRVSMGIQLLSDRPILLLDEPTSGLDSFTSSTIL 870

Query: 262 QIIRSLLAPTKYVICVEHDLSVL 284
           +I+ +L        C EH+ +V+
Sbjct: 871 EILENL--------CSEHNKTVI 885

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 53/219 (24%), Positives = 86/219 (39%), Gaps = 13/219 (5%)

Query: 89  ANSFKLHRLPTPRP-GQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYF 147
            +S  +H L    P G V+ ++G +G GK+T L +LA K    L    +     E  K  
Sbjct: 33  TDSVLVHPLSLDLPSGSVMAIMGGSGSGKTTLLNVLASKISSGLTHSGEISYILEADKNN 92

Query: 148 ---RGSELQNYFTKMLEDDIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKSPED--V 202
                SE         ++++     PQ      R            LKL   K  +   V
Sbjct: 93  VDDSSSEASFDLNATYKENVTLAYVPQQDVLCSRLTCRETLMYAADLKLDASKVEKTLIV 152

Query: 203 KRYIKILQLEN-----VLKRDIEKLSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQR 257
            + I  L L++     V       LSGGE +R ++G   V    V   DEP++ LD    
Sbjct: 153 NQLIDELGLKDCADTLVGDNSHRGLSGGEKRRLSMGTQMVSNPSVMFLDEPTTGLDAYSA 212

Query: 258 LNAAQIIRSLLAPT--KYVICVEHDLSVLDYLSDFVCII 294
               + ++ L       +++ +    S + +L D+VCI+
Sbjct: 213 YLVVKTLKKLAKEDGRTFILSIHQPRSDILFLFDYVCIL 251

 Score = 34.7 bits (78), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 54/243 (22%), Positives = 95/243 (39%), Gaps = 35/243 (14%)

Query: 345 LQNDSASRAFSYPSLKKTQGDFVLNVEEGEFSDSEILVMMGENGTGKTTLIKLLAGALKP 404
           L N    + F Y + K  Q     NV    F    I  +MG +G+GK++ + L++G L+ 
Sbjct: 685 LYNRKNHKIFEYENKKILQ-----NVS-AVFKPGMINAIMGPSGSGKSSFLNLISGRLES 738

Query: 405 D-----EGQDIPKLNVSMKPQKIAPKFPGTVRQ-----LFFKKIRGQF-----LNPQFQT 449
                       KLN +   Q +       V Q     L    +R  F     L  +  +
Sbjct: 739 SLLVKFNTAGTIKLNDTPISQDMFKHLCSYVSQDDDHLLAMLTVRETFDFAAALRLKHLS 798

Query: 450 DVVKPLRIDDII--------------DQEVQHLSGGELQRVAIVLALGIPADIYLIDEPS 495
              K  R D +I              ++ ++ +SGGE +RV++ + L     I L+DEP+
Sbjct: 799 KDDKRSRTDSLIAILGLKHCENTIIGNEFIKGISGGEKRRVSMGIQLLSDRPILLLDEPT 858

Query: 496 AYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIVFEGIPSKNAHARAPE 555
           + LDS       +++      + KT  +  H      ++    I+      + A   +PE
Sbjct: 859 SGLDSFTSSTILEILENLCSEHNKTVILTIHQPRSELFMKFGNILLLAKSGRTAFNGSPE 918

Query: 556 SLL 558
            ++
Sbjct: 919 EMI 921

 Score = 29.6 bits (65), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 15/65 (23%), Positives = 32/65 (49%)

Query: 462 DQEVQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTA 521
           D   + LSGGE +R+++   +     +  +DEP+  LD+    +  K +++    + +T 
Sbjct: 171 DNSHRGLSGGEKRRLSMGTQMVSNPSVMFLDEPTTGLDAYSAYLVVKTLKKLAKEDGRTF 230

Query: 522 FIVEH 526
            +  H
Sbjct: 231 ILSIH 235

>Kwal_27.12711
          Length = 1246

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 50/206 (24%), Positives = 85/206 (41%), Gaps = 33/206 (16%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNL---GRFDDPPEWQEIIKYFRGSELQNYFTK- 158
           G ++ ++G +G GK+T L +LA K    L   G F   PE         G    +Y T+ 
Sbjct: 46  GSIMAIIGGSGSGKTTLLNVLASKMSKTLKQRGSFRFVPE----TSSHSGEITTSYLTQQ 101

Query: 159 -MLEDDIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKSPED--VKRYIKILQLENVL 215
            +L  ++      QY  +               LKL+  KS     V+  I  L L++  
Sbjct: 102 DILASNLTCRETLQYAAD---------------LKLQSSKSERQGLVEELIAELGLKDCA 146

Query: 216 KRDIEK-----LSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAAQIIRSLL-- 268
              +       LSGGE +R +IG+  +    +   DEP++ LD        + +R L   
Sbjct: 147 NTLVGSPNRPGLSGGEKRRLSIGVQMISNPSLMFLDEPTTGLDAYSAYLVVRTLRKLSHK 206

Query: 269 APTKYVICVEHDLSVLDYLSDFVCII 294
               +++ +    + + +L D VCI+
Sbjct: 207 GGRSFIMSIHQPRADILFLLDQVCIM 232

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 45/190 (23%), Positives = 85/190 (44%), Gaps = 21/190 (11%)

Query: 101 RPGQVLGLVGTNGIGKSTALKILAGKQKPN-LGRFDDPPEWQEIIKYFRGSELQNYFTKM 159
           +P  +  ++G +G GKST L  L+GK     L  F+          +F  S++    T+ 
Sbjct: 674 QPHAINAIMGPSGSGKSTLLNFLSGKTHSTVLASFETSGS-----IFFNNSQV----TQD 724

Query: 160 LEDDIKAIIKPQYVDNI-PRAIKGPVQKVGELLKLRMEKSPEDVKRY------IKILQLE 212
           +  D+ + + PQ  D++ P+            L+L   K+   + R       + +   E
Sbjct: 725 IFKDVCSFV-PQDDDHLLPQLTVRETLLFAADLRLHHMKARNRISRVDDLISELGLKHCE 783

Query: 213 NVL--KRDIEKLSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAAQIIRSLL-A 269
           N L     ++ +SGGE +R ++G   + ++ + + DEP+S LD        +++ ++   
Sbjct: 784 NTLVGSELVKGISGGEKRRLSMGTHLLTDSPILLLDEPTSGLDSFTSFKILEVLTNISRK 843

Query: 270 PTKYVICVEH 279
           P K VI   H
Sbjct: 844 PGKTVILTIH 853

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 46/160 (28%), Positives = 70/160 (43%), Gaps = 39/160 (24%)

Query: 375 FSDSEILVMMGENGTGKTTLIKLLAG-----ALKPDEG------------QDIPKLNVSM 417
           F    I  +MG +G+GK+TL+  L+G      L   E             QDI K   S 
Sbjct: 673 FQPHAINAIMGPSGSGKSTLLNFLSGKTHSTVLASFETSGSIFFNNSQVTQDIFKDVCSF 732

Query: 418 KPQKIAPKFPG-TVRQ--LFFKKIRGQFLNPQFQTDVVKPLRIDDIIDQE---------- 464
            PQ      P  TVR+  LF   +R   +  + +       R+DD+I +           
Sbjct: 733 VPQDDDHLLPQLTVRETLLFAADLRLHHMKARNRIS-----RVDDLISELGLKHCENTLV 787

Query: 465 ----VQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDS 500
               V+ +SGGE +R+++   L   + I L+DEP++ LDS
Sbjct: 788 GSELVKGISGGEKRRLSMGTHLLTDSPILLLDEPTSGLDS 827

>KLLA0D03432g 287805..292256 similar to sp|P32568 Saccharomyces
           cerevisiae YDR011w SNQ2 multidrug resistance protein,
           start by similarity
          Length = 1483

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 49/214 (22%), Positives = 94/214 (43%), Gaps = 21/214 (9%)

Query: 101 RPGQVLGLVGTNGIGKSTALKILAGKQKPNLG-----RFDDPPEWQEIIKYFRGSELQNY 155
           RPG++L ++G  G G ST LK +AG+     G      +D   + ++++KYF+   + N 
Sbjct: 169 RPGEMLLVLGRPGSGCSTFLKTMAGELSHFKGVSGDISYDGVSQ-KDMLKYFKSDVIYN- 226

Query: 156 FTKMLEDDIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKSPEDVKRYIKILQLENVL 215
               ++     +   Q +D    A K P +++ +  + +  +   D+  Y  I  L++  
Sbjct: 227 --GEMDVHFPHLTVQQTLD-FAVACKTPSKRINDFTRQQYIEFIRDL--YATIFGLKHTY 281

Query: 216 KRD-----IEKLSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAAQIIR---SL 267
                   +  +SGGE +R +I  +      +Y +D  +  LD    L   + IR   +L
Sbjct: 282 NTKVGDDFVRGVSGGERKRVSIAEALAARGSIYCWDNATRGLDASTALEYTEAIRCMTNL 341

Query: 268 LAPTKYVICVEHDLSVLDYLSDFVCIIYGVPSVY 301
           L  T  +   +   ++ +   D V I+Y    +Y
Sbjct: 342 LKSTALITVYQASENIYETF-DKVTILYEGKQIY 374

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 55/201 (27%), Positives = 88/201 (43%), Gaps = 38/201 (18%)

Query: 379 EILVMMGENGTGKTTLIKLLAGALKPDEG--QDIPKLNVSMKPQ------------KIAP 424
           E+L+++G  G+G +T +K +AG L   +G   DI    VS K              ++  
Sbjct: 172 EMLLVLGRPGSGCSTFLKTMAGELSHFKGVSGDISYDGVSQKDMLKYFKSDVIYNGEMDV 231

Query: 425 KFPG-TVRQL----------------FFKKIRGQFLNPQFQTDV-VKPLRIDDIIDQEVQ 466
            FP  TV+Q                 F ++   +F+   + T   +K      + D  V+
Sbjct: 232 HFPHLTVQQTLDFAVACKTPSKRINDFTRQQYIEFIRDLYATIFGLKHTYNTKVGDDFVR 291

Query: 467 HLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEH 526
            +SGGE +RV+I  AL     IY  D  +  LD+   +  ++ IR      K TA I  +
Sbjct: 292 GVSGGERKRVSIAEALAARGSIYCWDNATRGLDASTALEYTEAIRCMTNLLKSTALITVY 351

Query: 527 ---DFIMATYLADKV-IVFEG 543
              + I  T+  DKV I++EG
Sbjct: 352 QASENIYETF--DKVTILYEG 370

>CAGL0M07293g complement(733072..737619) similar to sp|Q02785
            Saccharomyces cerevisiae YPL058c PDR12 or sp|P32568
            Saccharomyces cerevisiae YDR011w, hypothetical start
          Length = 1515

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 43/193 (22%), Positives = 86/193 (44%), Gaps = 34/193 (17%)

Query: 101  RPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDD---------PPEWQEIIKYFRGSE 151
            +PG++  L+G +G GK+T L +LA  Q+ N+G             P  +     Y   ++
Sbjct: 872  KPGKMTALMGESGAGKTTLLNVLA--QRINMGVITGDMLVNSQSLPASFNRSCGYVAQAD 929

Query: 152  LQNYFTKMLEDDIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKSPEDVKRYIKILQL 211
                   M E  ++  ++       PR++              +E+  E V++ I +L +
Sbjct: 930  -----NHMAELSVRESLRFAAELRQPRSVP-------------LEEKYEYVEKIIALLGM 971

Query: 212  ENVLKRDIEKLSGG----ELQRFAIGMSCVQEADVYMF-DEPSSYLDVKQRLNAAQIIRS 266
            +N  +  + K   G    + ++ +IG+  V +  + +F DEP+S LD +   +  Q +R+
Sbjct: 972  QNYAEALVGKTGRGLNVEQRKKLSIGVELVAKPSLLLFLDEPTSGLDSQSAWSIVQFMRA 1031

Query: 267  LLAPTKYVICVEH 279
            L    + ++C  H
Sbjct: 1032 LADSGQSILCTIH 1044

 Score = 39.3 bits (90), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 48/187 (25%), Positives = 80/187 (42%), Gaps = 43/187 (22%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNL---GRFD-DPPEWQEIIKYFRGS-----ELQ 153
           G++L +VG  G G ST LK ++G+    +   G F  D  + +E++K ++G      EL 
Sbjct: 177 GEMLFVVGRPGAGCSTLLKCISGETSELVSVDGEFSYDGLDQEEMMKNYKGYVIYCPELD 236

Query: 154 NYFTKMLEDD--------------IKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKSP 199
            +F K+   +              I  + + QYVDNI R +   V  +            
Sbjct: 237 FHFPKITVKETIDFALKCKTPRVRIDRMTRKQYVDNI-RDMWCTVFGL------------ 283

Query: 200 EDVKRYIKILQLENVLKRDIEKLSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLN 259
               R+    ++ N   R +   SGGE +R ++  +    A +Y +D  +  LD    L 
Sbjct: 284 ----RHTYATKVGNDFVRGV---SGGERKRVSLVEAQAMNASIYSWDNATRGLDASTALE 336

Query: 260 AAQIIRS 266
            AQ IR+
Sbjct: 337 FAQAIRT 343

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 28/47 (59%)

Query: 465 VQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIR 511
           V+ +SGGE +RV++V A  + A IY  D  +  LD+   +  ++ IR
Sbjct: 296 VRGVSGGERKRVSLVEAQAMNASIYSWDNATRGLDASTALEFAQAIR 342

>AFR232C [3424] [Homologous to ScYER036C (KRE30) - SH]
           (859615..861438) [1824 bp, 607 aa]
          Length = 607

 Score = 45.8 bits (107), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 45/180 (25%), Positives = 82/180 (45%), Gaps = 38/180 (21%)

Query: 383 MMGENGTGKTTLIKLLAGALKP-DEGQDIPKLNVSMKPQKIAPKFPGTVRQL-------- 433
           ++GENG GK+T +K +A    P  E  D+  L+   +P + +      VR+         
Sbjct: 109 LLGENGCGKSTFLKAIASREYPIPENIDVYLLDEPAEPSEYSA-LEYVVREAQNELKRLE 167

Query: 434 -FFKKI------RGQFLNPQFQ-TDVVKPLRIDD--------------IIDQEVQHLSGG 471
              +KI        + L+P ++  D + P   +                I+++ + +SGG
Sbjct: 168 DLVEKILLEDGPESELLDPLYEKMDSMDPSTFESRAAIILIGLGFNAKTINRKTKDMSGG 227

Query: 472 ELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEH--DFI 529
              RVA+  AL +   + L+D+P+A+LD E  +   + ++RF     +T  +V H  DF+
Sbjct: 228 WKMRVALAKALFVKPTLLLLDDPTAHLDLEACVWLEEYLKRF----DRTLVLVSHSQDFL 283

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 43/166 (25%), Positives = 78/166 (46%), Gaps = 25/166 (15%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKP-----NLGRFDDPPEWQEI--IKYFRGSELQNY 155
           G+  GL+G NG GKST LK +A ++ P     ++   D+P E  E   ++Y    E QN 
Sbjct: 104 GRRYGLLGENGCGKSTFLKAIASREYPIPENIDVYLLDEPAEPSEYSALEYVV-REAQNE 162

Query: 156 FTKMLEDDIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEK-SPEDVKRYIKILQL--- 211
             K LED ++ I+             GP  ++ + L  +M+   P   +    I+ +   
Sbjct: 163 L-KRLEDLVEKILLED----------GPESELLDPLYEKMDSMDPSTFESRAAIILIGLG 211

Query: 212 --ENVLKRDIEKLSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVK 255
                + R  + +SGG   R A+  +   +  + + D+P+++LD++
Sbjct: 212 FNAKTINRKTKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLE 257

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 52/193 (26%), Positives = 85/193 (44%), Gaps = 15/193 (7%)

Query: 382 VMMGENGTGKTTLIKLLAGALKPDEGQDIPKLNVSMK--PQKIAPKFPGTVRQLFFKKIR 439
            ++G NG GK+TL+K++ G L P  G+     +V +    Q    +   T   L F + +
Sbjct: 422 ALVGPNGVGKSTLLKIMTGELTPHGGRVSRHTHVKLGVYSQHSQDQLDLTKSALEFVRDK 481

Query: 440 GQFLNPQFQTDVVKPLR---IDDIIDQEVQHLSGGELQRVAI-VLALGIPADIYLIDEPS 495
              ++  FQ    +  R     +    ++  LS G+  RV   +LAL  P ++ L+DEP+
Sbjct: 482 YAHISEDFQFWRGQLGRYGLTGEAQTAQMATLSEGQRSRVVFALLALEQP-NVLLLDEPT 540

Query: 496 AYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIVFEGIPSKNAHARAPE 555
             LD       +  I  F         +V HDF +   +A  + V E   +K A  R   
Sbjct: 541 NGLDIPTIDSLADAIDAF----NGGVVVVSHDFRLLDRIAKDIYVVE---NKTA-TRWDG 592

Query: 556 SLLTGCNRFLKNL 568
           S+L   N+  KN+
Sbjct: 593 SILDYKNKLAKNV 605

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 49/191 (25%), Positives = 78/191 (40%), Gaps = 33/191 (17%)

Query: 107 GLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTK-MLE--DD 163
            LVG NG+GKST LKI+ G+  P+ GR       +  + Y + S+ Q   TK  LE   D
Sbjct: 422 ALVGPNGVGKSTLLKIMTGELTPHGGRVSRHTHVKLGV-YSQHSQDQLDLTKSALEFVRD 480

Query: 164 IKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKSPEDVKRYIKILQLENVLKRDIEKLS 223
             A I   +     R   G     GE    +M                          LS
Sbjct: 481 KYAHISEDF--QFWRGQLGRYGLTGEAQTAQM------------------------ATLS 514

Query: 224 GGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAAQIIRSLLAPTKYVICVEHDLSV 283
            G+  R    +  +++ +V + DEP++ LD+    + A  I +       V+ V HD  +
Sbjct: 515 EGQRSRVVFALLALEQPNVLLLDEPTNGLDIPTIDSLADAIDAF---NGGVVVVSHDFRL 571

Query: 284 LDYLSDFVCII 294
           LD ++  + ++
Sbjct: 572 LDRIAKDIYVV 582

>Sklu_2152.5 YER036C, Contig c2152 6647-8473 reverse complement
          Length = 608

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 58/215 (26%), Positives = 90/215 (41%), Gaps = 50/215 (23%)

Query: 377 DSEILVMMGENGTGKTTLIKLLAGALKPDEG-----------------QDIPKLNVSMKP 419
           DS I  ++G NG GK+TL+K++ G L P  G                 QD  +L+++  P
Sbjct: 419 DSRI-ALVGPNGVGKSTLLKIMTGQLMPQSGRVSRHTHVKLGVYSQHSQD--QLDLTKSP 475

Query: 420 -QKIAPKFPGTVRQLFFKKIRGQF----LNPQFQTDVVKPLRIDDIIDQEVQHLSGGELQ 474
            + +  K+P   +   F+  RGQ     L  + QT              ++  LS G+  
Sbjct: 476 LEFVRDKYPNISQD--FQYWRGQLGRYGLTGEAQT-------------SQMGTLSEGQRS 520

Query: 475 RVAI-VLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATY 533
           RV   +LAL  P ++ L+DEP+  LD       +  I  F         +V HDF +   
Sbjct: 521 RVVFALLALEQP-NVLLLDEPTNGLDIPTIDSLADAINEF----NGGVVVVSHDFRLLDK 575

Query: 534 LADKVIVFEGIPSKNAHARAPESLLTGCNRFLKNL 568
           +A  + V E         R   S+L   N+  KN+
Sbjct: 576 IAQDIFVVE----HKTATRWNGSILDYKNKLAKNV 606

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 45/179 (25%), Positives = 81/179 (45%), Gaps = 36/179 (20%)

Query: 383 MMGENGTGKTTLIKLLAGALKP-DEGQDIPKLNVSMKPQKI-APKFPGTVRQLFFKKIR- 439
           ++GENG GK+T +K +A    P  E  D+  L+   +P ++ A  +  T  Q   K++  
Sbjct: 110 LLGENGCGKSTFLKAIATREYPIPENIDVYLLDEPAEPSELSALDYVVTEAQNELKRLED 169

Query: 440 ------------GQFLNPQFQ-TDVVKPLRIDD--------------IIDQEVQHLSGGE 472
                        + L P ++  D + P   +                I ++ + +SGG 
Sbjct: 170 LVEKIILEDGPESELLEPLYEKMDSMDPNTFESRAAVILIGLGFNSKTITKKTKDMSGGW 229

Query: 473 LQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEH--DFI 529
             RVA+  AL +   + L+D+P+A+LD E  +   + ++RF     +T  +V H  DF+
Sbjct: 230 KMRVALAKALFVKPTLLLLDDPTAHLDLEACVWLEEYLKRF----DRTLVLVSHSQDFL 284

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 42/165 (25%), Positives = 78/165 (47%), Gaps = 23/165 (13%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKP-----NLGRFDDPPEWQEIIKY-FRGSELQNYF 156
           G+  GL+G NG GKST LK +A ++ P     ++   D+P E  E+    +  +E QN  
Sbjct: 105 GRHYGLLGENGCGKSTFLKAIATREYPIPENIDVYLLDEPAEPSELSALDYVVTEAQNEL 164

Query: 157 TKMLEDDIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEK-SPEDVKRYIKILQL---- 211
            K LED ++ II             GP  ++ E L  +M+   P   +    ++ +    
Sbjct: 165 -KRLEDLVEKIILED----------GPESELLEPLYEKMDSMDPNTFESRAAVILIGLGF 213

Query: 212 -ENVLKRDIEKLSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVK 255
               + +  + +SGG   R A+  +   +  + + D+P+++LD++
Sbjct: 214 NSKTITKKTKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLE 258

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/192 (21%), Positives = 81/192 (42%), Gaps = 33/192 (17%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQ-NYFTKMLEDDI 164
           + LVG NG+GKST LKI+ G+  P  GR              R + ++   +++  +D +
Sbjct: 422 IALVGPNGVGKSTLLKIMTGQLMPQSGRVS------------RHTHVKLGVYSQHSQDQL 469

Query: 165 KAIIKP-QYV-DNIPRAIKGPVQKVGELLKLRMEKSPEDVKRYIKILQLENVLKRDIEKL 222
                P ++V D  P   +      G+L +  +    +  +               +  L
Sbjct: 470 DLTKSPLEFVRDKYPNISQDFQYWRGQLGRYGLTGEAQTSQ---------------MGTL 514

Query: 223 SGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAAQIIRSLLAPTKYVICVEHDLS 282
           S G+  R    +  +++ +V + DEP++ LD+    + A  I         V+ V HD  
Sbjct: 515 SEGQRSRVVFALLALEQPNVLLLDEPTNGLDIPTIDSLADAINEF---NGGVVVVSHDFR 571

Query: 283 VLDYLSDFVCII 294
           +LD ++  + ++
Sbjct: 572 LLDKIAQDIFVV 583

>Scas_574.8
          Length = 702

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 54/217 (24%), Positives = 94/217 (43%), Gaps = 33/217 (15%)

Query: 383 MMGENGTGKTTLIKLLAGALKPDEGQ------DIPKLNV-------SMKPQKIAPKFPGT 429
           ++G +G+GK+T++KL+     P++G+      D+ + +V        + PQ   P F  T
Sbjct: 467 VVGPSGSGKSTILKLVFRFYDPEQGRILINGVDVKEYDVDSLRRVMGVVPQD-TPLFNDT 525

Query: 430 VRQ-LFFKKIRGQFLNPQFQTDVVK----------PLRIDDIIDQEVQHLSGGELQRVAI 478
           + + + F +I     + +  T + K          P   + I+ +    +SGGE QR+AI
Sbjct: 526 IWENVKFGRIDAT--DEEVHTVIEKAQLAPLIKKLPQGYETIVGERGMMISGGEKQRLAI 583

Query: 479 VLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKV 538
              L   A I   DE ++ LD+         IR       +T+  + H  +     ADK+
Sbjct: 584 ARVLLKNAKIMFFDEATSALDTHTEQALLTTIRANFESGSRTSVYIAHR-LRTIADADKI 642

Query: 539 IVFE--GIPSKNAHA---RAPESLLTGCNRFLKNLNV 570
           IV E   +  +  H+     P SL        +NL+V
Sbjct: 643 IVLEDGAVKEEGTHSGLLATPGSLYANLWNIQENLDV 679

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 52/191 (27%), Positives = 84/191 (43%), Gaps = 19/191 (9%)

Query: 82  HVTHRYSANSFKLHRLPTPRPGQV-LGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEW 140
           +VT  Y +    L+      PG +   +VG +G GKST LK++         RF DP + 
Sbjct: 440 NVTFGYDSKRKILNNASFTIPGGLKTAVVGPSGSGKSTILKLVF--------RFYDPEQG 491

Query: 141 QEIIKYFRGSELQNYFTKMLEDDIKAIIK--PQYVDNIPRAIK-GPVQKVGELLKLRMEK 197
           + +I    G +++ Y    L   +  + +  P + D I   +K G +    E +   +EK
Sbjct: 492 RILIN---GVDVKEYDVDSLRRVMGVVPQDTPLFNDTIWENVKFGRIDATDEEVHTVIEK 548

Query: 198 SPEDVKRYIKIL--QLENVLKRDIEKLSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVK 255
           +   +   IK L    E ++      +SGGE QR AI    ++ A +  FDE +S LD  
Sbjct: 549 A--QLAPLIKKLPQGYETIVGERGMMISGGEKQRLAIARVLLKNAKIMFFDEATSALDTH 606

Query: 256 QRLNAAQIIRS 266
                   IR+
Sbjct: 607 TEQALLTTIRA 617

>Kwal_47.19116
          Length = 607

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 46/179 (25%), Positives = 84/179 (46%), Gaps = 36/179 (20%)

Query: 383 MMGENGTGKTTLIKLLAGALKP-DEGQDIPKLNVSMKPQKI-APKFPGTVRQLFFKK--- 437
           ++GENG GK+T +K LA    P  E  D+  L+   +P +  A ++     Q   K+   
Sbjct: 109 LLGENGCGKSTFLKSLATKEYPIPEHIDVYLLDEPAEPSEFSALEYVVNEAQNELKRLED 168

Query: 438 -IRGQFLNPQFQTDVVKPL--RIDDI----------------------IDQEVQHLSGGE 472
            +    L    ++DV++ +  R+D +                      I+++ + +SGG 
Sbjct: 169 LVEKTILEDGPESDVLEGIYERMDSLDPSTFESRAAVILIGLGFNSKTINKKTKDMSGGW 228

Query: 473 LQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEH--DFI 529
             RVA+  AL +   + L+D+P+A+LD E  +   + ++RF     +T  +V H  DF+
Sbjct: 229 KMRVALAKALFVKPTLLLLDDPTAHLDLEACVWLEEYLKRF----DRTLVLVSHSQDFL 283

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 45/166 (27%), Positives = 77/166 (46%), Gaps = 25/166 (15%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKP-----NLGRFDDPPEWQEI--IKYFRGSELQNY 155
           G+  GL+G NG GKST LK LA K+ P     ++   D+P E  E   ++Y   +E QN 
Sbjct: 104 GRRYGLLGENGCGKSTFLKSLATKEYPIPEHIDVYLLDEPAEPSEFSALEYVV-NEAQNE 162

Query: 156 FTKMLEDDIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEK-SPEDVKRYIKILQL--- 211
             K LED ++  I             GP   V E +  RM+   P   +    ++ +   
Sbjct: 163 L-KRLEDLVEKTILED----------GPESDVLEGIYERMDSLDPSTFESRAAVILIGLG 211

Query: 212 --ENVLKRDIEKLSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVK 255
                + +  + +SGG   R A+  +   +  + + D+P+++LD++
Sbjct: 212 FNSKTINKKTKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLE 257

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 51/194 (26%), Positives = 85/194 (43%), Gaps = 15/194 (7%)

Query: 381 LVMMGENGTGKTTLIKLLAGALKPDEGQDIPKLNVSMK--PQKIAPKFPGTVRQLFFKKI 438
           + ++G NG GK+TL+K++ G L    G+     +V +    Q    +   T   L F + 
Sbjct: 421 VALVGPNGVGKSTLLKIMTGELATQSGRVSRHTHVKLGVYSQHSQDQLDLTKSPLEFVRD 480

Query: 439 RGQFLNPQFQTDVVKPLR---IDDIIDQEVQHLSGGELQRVAI-VLALGIPADIYLIDEP 494
           +   ++  FQ    +  R     +    ++  LS G+  RV   +LAL  P ++ L+DEP
Sbjct: 481 KYSHISHDFQYWRGQLGRYGLTGEGQTSQMATLSEGQRSRVVFALLALQAP-NVLLLDEP 539

Query: 495 SAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIVFEGIPSKNAHARAP 554
           +  LD       +  I  F         +V HDF +   +A  + V E   +K A  R  
Sbjct: 540 TNGLDIATIDSLADAINEF----NGGVVVVSHDFRLLDKIAKDIFVVE---NKTA-TRWD 591

Query: 555 ESLLTGCNRFLKNL 568
            S+L   N+  KN+
Sbjct: 592 GSILDYKNKLAKNV 605

 Score = 38.5 bits (88), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 44/189 (23%), Positives = 80/189 (42%), Gaps = 27/189 (14%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLEDDIK 165
           + LVG NG+GKST LKI+ G+     GR       +  + Y + S+ Q   TK   + ++
Sbjct: 421 VALVGPNGVGKSTLLKIMTGELATQSGRVSRHTHVKLGV-YSQHSQDQLDLTKSPLEFVR 479

Query: 166 AIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKSPEDVKRYIKILQLENVLKRDIEKLSGG 225
              K  ++ +  +  +G + + G                    L  E    + +  LS G
Sbjct: 480 D--KYSHISHDFQYWRGQLGRYG--------------------LTGEGQTSQ-MATLSEG 516

Query: 226 ELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAAQIIRSLLAPTKYVICVEHDLSVLD 285
           +  R    +  +Q  +V + DEP++ LD+    + A  I         V+ V HD  +LD
Sbjct: 517 QRSRVVFALLALQAPNVLLLDEPTNGLDIATIDSLADAINEF---NGGVVVVSHDFRLLD 573

Query: 286 YLSDFVCII 294
            ++  + ++
Sbjct: 574 KIAKDIFVV 582

>Kwal_26.9480
          Length = 719

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 59/223 (26%), Positives = 94/223 (42%), Gaps = 32/223 (14%)

Query: 383 MMGENGTGKTTLIKLLAGALKPDEGQ-----------DIPKL--NVSMKPQKIAPKFPGT 429
           ++G +G+GK+T++KL+     P EG+           DI  L  ++ + PQ   P F  +
Sbjct: 494 IVGPSGSGKSTILKLVFRFYDPIEGRILLDGKDVRELDIESLRRSIGVVPQD-TPLFNES 552

Query: 430 VR-QLFFKKIRGQFLNPQFQTDVVK--------PLRIDDIIDQEVQHLSGGELQRVAIVL 480
           +   + F +I       +   D  +        P   D I+ +    +SGGE QR+AI  
Sbjct: 553 IWDNVKFGRIDATDQEIERAIDRAQLRALIRQLPKGRDTIVGERGLMISGGEKQRLAIAR 612

Query: 481 ALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIV 540
            L   A I   DE ++ LD+       + I+       KT+  + H  +     ADK+IV
Sbjct: 613 VLLKDAPIMFFDEATSALDTHTEQALLRTIKENFTTGSKTSVYIAHR-LRTIADADKIIV 671

Query: 541 FEG--IPSKNAHAR---APESL---LTGCNRFLKNLNVTFRRD 575
            E   +  +  HA     P+SL   L      L +LN    RD
Sbjct: 672 LEHGRVKEEGKHAELLATPKSLYAELWNVQENLDDLNKELERD 714

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 52/206 (25%), Positives = 92/206 (44%), Gaps = 31/206 (15%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLED 162
           G    +VG +G GKST LK++         RF DP E + ++    G +++    + L  
Sbjct: 489 GSKTAIVGPSGSGKSTILKLVF--------RFYDPIEGRILLD---GKDVRELDIESLRR 537

Query: 163 DIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKSPEDVKRYIKILQLENVLK-----R 217
            I  +  PQ       +I   V K G     R++ + ++++R I   QL  +++     R
Sbjct: 538 SIGVV--PQDTPLFNESIWDNV-KFG-----RIDATDQEIERAIDRAQLRALIRQLPKGR 589

Query: 218 DI---EK---LSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAAQIIR-SLLAP 270
           D    E+   +SGGE QR AI    +++A +  FDE +S LD        + I+ +    
Sbjct: 590 DTIVGERGLMISGGEKQRLAIARVLLKDAPIMFFDEATSALDTHTEQALLRTIKENFTTG 649

Query: 271 TKYVICVEHDLSVLDYLSDFVCIIYG 296
           +K  + + H L  +      + + +G
Sbjct: 650 SKTSVYIAHRLRTIADADKIIVLEHG 675

>ABR126W [718] [Homologous to ScYOR153W (PDR5) - NSH; ScYDR406W
            (PDR15) - NSH] complement(628623..633161) [4539 bp, 1512
            aa]
          Length = 1512

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 47/213 (22%), Positives = 87/213 (40%), Gaps = 64/213 (30%)

Query: 101  RPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKML 160
            +PG +  L+G++G GK+T L +LA + +                                
Sbjct: 881  KPGTLTALMGSSGAGKTTLLDVLANRVR-------------------------------- 908

Query: 161  EDDIKAIIKPQYVDNIPRA--------------IKGPVQKVGELLK----LRMEKSPED- 201
               +  +    +VD +PR               + G  Q V + LK    LR  +S  + 
Sbjct: 909  ---VGVVTGDMFVDGLPRGASFQRNTGYCQQQDLHGCTQTVRDALKFSAYLRQPQSVSEA 965

Query: 202  -----VKRYIKILQLEN----VLKRDIEKLSGGELQRFAIGMSCVQEADVYMF-DEPSSY 251
                 V+  I++L++E     ++    E L+  + +R  IG+  V + ++ +F DEP+S 
Sbjct: 966  EIDAYVEDIIRLLEMEAYADAIVGVTGEGLNVEQRKRLTIGVELVAKPELLLFLDEPTSG 1025

Query: 252  LDVKQRLNAAQIIRSLLAPTKYVICVEHDLSVL 284
            LD +   +  Q++R L    + V+C  H  S +
Sbjct: 1026 LDSQTAWSVCQLMRKLANHGQAVLCTIHQPSAI 1058

>Kwal_56.22747
          Length = 1538

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 64/247 (25%), Positives = 107/247 (43%), Gaps = 41/247 (16%)

Query: 355  SYPSLKKTQGDFVLNVEEGEFSDSEILVMMGENGTGKTTLIKLLAGALKPDEGQ------ 408
            +Y +  +   D VL   + E    E + ++G  G GK+TL   L   L+P EG       
Sbjct: 1293 NYSTRYRANLDPVLRHLDLEIKPQEKIGIVGRTGAGKSTLSLALFRILEPSEGTIDIDGV 1352

Query: 409  DIPKL-------NVSMKPQKIAPKFPGTVR-----------QLFFKKIRGQFLNP---QF 447
            DI K+       N+S+ PQ  A  F GTVR           +  +K +    L P   + 
Sbjct: 1353 DISKIGLKDLRSNLSIIPQD-AQAFEGTVRTNLDPFEQYSDEEIWKALELSHLKPHILKM 1411

Query: 448  QTDVVKPLRIDDIIDQEV----QHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQR 503
              D   P + +D++  ++     +LS G+ Q + +  AL   + I ++DE +A +DSE  
Sbjct: 1412 AKDDADPEKKEDLLQTKISENGSNLSVGQRQLLCLSRALLNRSRILVLDEATAAVDSETD 1471

Query: 504  IICSKVIRRFILHNKKTAFIVEH--DFIMATYLADKVIVFEGIPSKNAHARAPESLLTGC 561
             +  + IR       +T   + H  D +M +   DK++V +    K     +P +LL   
Sbjct: 1472 RLIQETIRAEF--KDRTILTIAHRIDTVMDS---DKIMVLDKGEVKEFD--SPSNLLAQK 1524

Query: 562  NRFLKNL 568
            +    NL
Sbjct: 1525 DSIFYNL 1531

 Score = 36.2 bits (82), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 35/189 (18%), Positives = 79/189 (41%), Gaps = 40/189 (21%)

Query: 369 NVEEGEFSDSEILVMMGENGTGKTTLIKLLAGALKPDEGQDIPKLNVSMKPQKIAPKFPG 428
           N++  +    +++ ++G  G GK+T ++ L G L            +S  P   +P    
Sbjct: 645 NIDGFQVFKGQLVCVVGRVGAGKSTFLQALLGQLPC----------ISNSPSHASPTVHF 694

Query: 429 TVRQLFFKKIRGQFLNPQFQTDVVKPLRIDD-------------------------IIDQ 463
               +     +   +N   + +V+   R D+                         ++ +
Sbjct: 695 RANSVALCSQQSWIMNASVKDNVLFGHRFDEATYKATLEACQLVPDLEILADGDETLVGE 754

Query: 464 EVQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFI 523
           +   LSGG+  R+++  A+   +D+YL+D+  + +D+E   +C ++I + +  +KKT  +
Sbjct: 755 KGISLSGGQKARLSLARAVYSRSDVYLLDDILSAVDAE---VCKRIIEQVL--SKKTGLL 809

Query: 524 VEHDFIMAT 532
                I+ T
Sbjct: 810 KNKTVILTT 818

>YMR301C (ATM1) [4255] chr13 complement(867554..869626) Member of
           the ATP-binding cassette (ABC) superfamily of membrane
           transporters, component of the mitochondrial inner
           membrane [2073 bp, 690 aa]
          Length = 690

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 48/196 (24%), Positives = 85/196 (43%), Gaps = 35/196 (17%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLED 162
           G    +VG++G GKST LK++         RF DP   + +I    G +++ Y    L  
Sbjct: 462 GWKTAIVGSSGSGKSTILKLVF--------RFYDPESGRILIN---GRDIKEYDIDALRK 510

Query: 163 DIKAIIK--PQYVDNIPRAIKGPVQKVGELLKLRMEKSPEDVKRYIKILQLENVLKRDIE 220
            I  + +  P + D I   +K            R++ + E+V   ++  QL  ++K+  +
Sbjct: 511 VIGVVPQDTPLFNDTIWENVKFG----------RIDATDEEVITVVEKAQLAPLIKKLPQ 560

Query: 221 -----------KLSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAAQIIR-SLL 268
                       +SGGE QR AI    ++ A +  FDE +S LD        + IR +  
Sbjct: 561 GFDTIVGERGLMISGGEKQRLAIARVLLKNARIMFFDEATSALDTHTEQALLRTIRDNFT 620

Query: 269 APTKYVICVEHDLSVL 284
           + ++  + + H L  +
Sbjct: 621 SGSRTSVYIAHRLRTI 636

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 49/184 (26%), Positives = 81/184 (44%), Gaps = 28/184 (15%)

Query: 383 MMGENGTGKTTLIKLLAGALKPDEGQ-----------DIPKLN--VSMKPQKIAPKFPGT 429
           ++G +G+GK+T++KL+     P+ G+           DI  L   + + PQ   P F  T
Sbjct: 467 IVGSSGSGKSTILKLVFRFYDPESGRILINGRDIKEYDIDALRKVIGVVPQD-TPLFNDT 525

Query: 430 VRQ-LFFKKIRGQFLNPQFQTDVVK----------PLRIDDIIDQEVQHLSGGELQRVAI 478
           + + + F +I     + +  T V K          P   D I+ +    +SGGE QR+AI
Sbjct: 526 IWENVKFGRIDAT--DEEVITVVEKAQLAPLIKKLPQGFDTIVGERGLMISGGEKQRLAI 583

Query: 479 VLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKV 538
              L   A I   DE ++ LD+       + IR       +T+  + H  +     ADK+
Sbjct: 584 ARVLLKNARIMFFDEATSALDTHTEQALLRTIRDNFTSGSRTSVYIAHR-LRTIADADKI 642

Query: 539 IVFE 542
           IV +
Sbjct: 643 IVLD 646

>Scas_712.29
          Length = 610

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 47/180 (26%), Positives = 85/180 (47%), Gaps = 38/180 (21%)

Query: 383 MMGENGTGKTTLIKLLAGALKP-DEGQDIPKLNVSMKPQKIAPKFPGTVRQLFFKKIRGQ 441
           ++GENG GK+T +K LA    P  E  DI  L+   +P + +      VR+   +  R +
Sbjct: 112 LLGENGCGKSTFLKALATREYPIPENIDIYLLDEPAEPSEYSA-LEYVVREAQNELKRLE 170

Query: 442 FLNPQF------QTDVVKPL--RIDDI----------------------IDQEVQHLSGG 471
            L  ++      + ++++PL  R+D +                      I ++ + +SGG
Sbjct: 171 DLVEKYIVEEGPECELLEPLYERMDSLDPDTFESRAAVILIGLGFNSKTILKKTKDMSGG 230

Query: 472 ELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEH--DFI 529
              RVA+  AL +   + L+D+P+A+LD E  +   + ++RF     +T  +V H  DF+
Sbjct: 231 WKMRVALAKALFVKPTLLLLDDPTAHLDLEACVWLEEYLKRF----DRTLVLVSHSQDFL 286

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 44/189 (23%), Positives = 81/189 (42%), Gaps = 27/189 (14%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLEDDIK 165
           + LVG NG+GKST LKI+ G+  P  GR       +  + Y + S+ Q   TK   + ++
Sbjct: 424 IALVGPNGVGKSTLLKIMTGELTPQSGRVSRHTHVKLGV-YSQHSQDQLDLTKSALEFVR 482

Query: 166 AIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKSPEDVKRYIKILQLENVLKRDIEKLSGG 225
                   D  P   +      G+L +  +    + V+               +  LS G
Sbjct: 483 --------DKYPNISQDFQYWRGQLGRYGLTGEGQTVQ---------------MGTLSEG 519

Query: 226 ELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAAQIIRSLLAPTKYVICVEHDLSVLD 285
           +  R    +  +++ +V + DEP++ LD+    + A+ I         V+ V HD  +LD
Sbjct: 520 QRSRVVFALLALEQPNVLLLDEPTNGLDIPTIDSLAEAINEF---NGGVVVVSHDFRLLD 576

Query: 286 YLSDFVCII 294
            ++  + ++
Sbjct: 577 KIAKDIFVV 585

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 63/224 (28%), Positives = 100/224 (44%), Gaps = 18/224 (8%)

Query: 351 SRAFSYPSLKKTQGDFVLNVEEGEFSDSEILVMMGENGTGKTTLIKLLAGALKPDEGQDI 410
           S +FSY      + +   N++ G   DS I  ++G NG GK+TL+K++ G L P  G+  
Sbjct: 397 SISFSYDG--NPENNLYENLDFGVDMDSRI-ALVGPNGVGKSTLLKIMTGELTPQSGRVS 453

Query: 411 PKLNVSMK--PQKIAPKFPGTVRQLFFKKIRGQFLNPQFQTDVVKPLRIDDIID-QEVQH 467
              +V +    Q    +   T   L F + +   ++  FQ    +  R     + Q VQ 
Sbjct: 454 RHTHVKLGVYSQHSQDQLDLTKSALEFVRDKYPNISQDFQYWRGQLGRYGLTGEGQTVQM 513

Query: 468 --LSGGELQRVAI-VLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIV 524
             LS G+  RV   +LAL  P ++ L+DEP+  LD       ++ I  F         +V
Sbjct: 514 GTLSEGQRSRVVFALLALEQP-NVLLLDEPTNGLDIPTIDSLAEAINEF----NGGVVVV 568

Query: 525 EHDFIMATYLADKVIVFEGIPSKNAHARAPESLLTGCNRFLKNL 568
            HDF +   +A  + V E   +K A  R   S+L    +  KN+
Sbjct: 569 SHDFRLLDKIAKDIFVVE---NKTA-TRWNGSILEYKTKLAKNV 608

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 49/167 (29%), Positives = 80/167 (47%), Gaps = 27/167 (16%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKP-----NLGRFDDPPEWQEI--IKYFRGSELQNY 155
           G+  GL+G NG GKST LK LA ++ P     ++   D+P E  E   ++Y    E QN 
Sbjct: 107 GRRYGLLGENGCGKSTFLKALATREYPIPENIDIYLLDEPAEPSEYSALEYVV-REAQNE 165

Query: 156 FTKMLEDDIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKSPEDV--KRYIKIL---- 209
             K LED ++  I  +          GP  ++ E L  RM+    D    R   IL    
Sbjct: 166 L-KRLEDLVEKYIVEE----------GPECELLEPLYERMDSLDPDTFESRAAVILIGLG 214

Query: 210 -QLENVLKRDIEKLSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVK 255
              + +LK+  + +SGG   R A+  +   +  + + D+P+++LD++
Sbjct: 215 FNSKTILKK-TKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLE 260

>YPL058C (PDR12) [5383] chr16 complement(445837..450372) Protein
            required for weak organic acid resistance, member of the
            ATP-binding cassette (ABC) superfamily of membrane
            transporters [4536 bp, 1511 aa]
          Length = 1511

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 41/194 (21%), Positives = 89/194 (45%), Gaps = 36/194 (18%)

Query: 101  RPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDD---------PPEWQEIIKYFRGSE 151
            +PG++  L+G +G GK+T L +LA  Q+ N+G             P  +     Y   ++
Sbjct: 869  KPGKMTALMGESGAGKTTLLNVLA--QRINMGVITGDMLVNAKPLPASFNRSCGYV--AQ 924

Query: 152  LQNYFTKM-LEDDIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKSPEDVKRYIKILQ 210
              N+  ++ + + ++   + +   ++P                 +E+  E V++ I +L 
Sbjct: 925  ADNHMAELSVRESLRFAAELRQQSSVP-----------------LEEKYEYVEKIITLLG 967

Query: 211  LENVLKRDIEKLSGG----ELQRFAIGMSCVQEADVYMF-DEPSSYLDVKQRLNAAQIIR 265
            ++N  +  + K   G    + ++ +IG+  V +  + +F DEP+S LD +   +  Q +R
Sbjct: 968  MQNYAEALVGKTGRGLNVEQRKKLSIGVELVAKPSLLLFLDEPTSGLDSQSAWSIVQFMR 1027

Query: 266  SLLAPTKYVICVEH 279
            +L    + ++C  H
Sbjct: 1028 ALADSGQSILCTIH 1041

 Score = 32.3 bits (72), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 28/47 (59%)

Query: 465 VQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIR 511
           V+ +SGGE +RV++V A  + A IY  D  +  LD+   +  ++ IR
Sbjct: 293 VRGVSGGERKRVSLVEAQAMNASIYSWDNATRGLDASTALEFAQAIR 339

>CAGL0I04862g complement(438338..442861) highly similar to sp|P32568
           Saccharomyces cerevisiae YDR011w SNQ2 multidrug
           resistance protein, hypothetical start
          Length = 1507

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 51/214 (23%), Positives = 96/214 (44%), Gaps = 20/214 (9%)

Query: 101 RPGQVLGLVGTNGIGKSTALKILAGKQKPNLG------RFDDPPEWQEIIKYFRGSELQN 154
           R G+++ ++G  G G S+ LK+ AG+     G       +D  P+ +E++K ++   + N
Sbjct: 186 RAGEMVLVLGRPGAGCSSMLKVTAGEIDQFAGGVEGEIMYDGIPQ-KEMMKRYKPDVIYN 244

Query: 155 YFTKMLEDDIK-AIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKSPEDVKRYIKILQLEN 213
                 E D+    +  Q   +   A K P ++V ++ +     S  D+   I  L+   
Sbjct: 245 -----GEQDVHFPHLTVQQTLDFAIACKTPSKRVNDVSREEYIASTRDLHATIFGLRHTY 299

Query: 214 VLKRD---IEKLSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAAQIIR---SL 267
             K     +  +SGGE +R +I  + V +  +Y +D  +  LD    L  A+ IR   +L
Sbjct: 300 HTKVGNDFVRGVSGGERKRVSIAEALVTKGSIYCWDNATRGLDASTALEYAKAIRITTNL 359

Query: 268 LAPTKYVICVEHDLSVLDYLSDFVCIIYGVPSVY 301
           L  T +V   +   ++ +   D V ++Y    +Y
Sbjct: 360 LGSTAFVTIYQASENIYETF-DKVTVLYTGRQIY 392

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 51/188 (27%), Positives = 90/188 (47%), Gaps = 25/188 (13%)

Query: 101  RPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRF--DDPPEWQEIIKYF--RGSELQNYF 156
            +PG +  L+G +G GK+T L  LA +   N+G    D     + I   F  R   +Q   
Sbjct: 884  KPGTLTALMGESGAGKTTLLNTLAQR---NVGIITGDMLVNGKPIDISFERRTGYVQQQD 940

Query: 157  TKMLEDDIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKSPEDVKRYIKILQLE---N 213
              + E  ++  +  Q+   + RA     Q V E      E+  E V+R IK+L +E   +
Sbjct: 941  IHISELTVRESL--QFSARMRRA-----QNVPE------EEKMEHVERIIKVLDMEEYAD 987

Query: 214  VLKRDIEK-LSGGELQRFAIGMSCVQEADVYMF-DEPSSYLDVKQRLNAAQIIRSLLAPT 271
             L  D+ + L+  + ++ +IG+  V + D+ +F DEP+S LD +      Q+++ L    
Sbjct: 988  ALVGDVGRGLNVEQRKKLSIGVELVAKPDLLLFLDEPTSGLDSQSSWAIVQLLKKLAKAG 1047

Query: 272  KYVICVEH 279
            + ++C  H
Sbjct: 1048 QSILCTIH 1055

 Score = 33.1 bits (74), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 30/60 (50%)

Query: 465 VQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIV 524
           V+ +SGGE +RV+I  AL     IY  D  +  LD+   +  +K IR        TAF+ 
Sbjct: 308 VRGVSGGERKRVSIAEALVTKGSIYCWDNATRGLDASTALEYAKAIRITTNLLGSTAFVT 367

>KLLA0D00748g complement(69839..72208) similar to sp|P33311
           Saccharomyces cerevisiae YPL270w MDL2 ATP-binding
           cassette (ABC) transporter family member, hypothetical
           start
          Length = 789

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 53/198 (26%), Positives = 86/198 (43%), Gaps = 29/198 (14%)

Query: 353 AFSYPSLKKTQ--GDFVLNVEEGEFSDSEILVMMGENGTGKTTLIKLLAGALKPD----- 405
           +FSYP+ K  Q   D    +E G       + ++G +G GK+T+  LL     P      
Sbjct: 478 SFSYPTRKTNQIFKDLNFTIEPGSN-----VCIVGPSGRGKSTIASLLLRYYNPTSGKIL 532

Query: 406 -EGQDIPKLNV-SMKPQ-KIAPKFP----GTVRQLFFKKIRGQFLNPQFQTDVVK----- 453
            +GQDI KL+  S++ Q  +  + P    GT+R+     +  Q    + ++   K     
Sbjct: 533 VDGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCHA 592

Query: 454 -----PLRIDDIIDQEVQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSK 508
                P   + II      LSGG+ QR+AI  AL     I ++DE ++ LD E     + 
Sbjct: 593 FISKFPNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINY 652

Query: 509 VIRRFILHNKKTAFIVEH 526
            + R +   + T   + H
Sbjct: 653 TLGRLMKSKELTIISIAH 670

 Score = 33.5 bits (75), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 33/64 (51%), Gaps = 1/64 (1%)

Query: 222 LSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAAQIIRSLLAPTKY-VICVEHD 280
           LSGG+ QR AI  + + +  + + DE +S LDV+        +  L+   +  +I + H 
Sbjct: 612 LSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAHR 671

Query: 281 LSVL 284
           LS +
Sbjct: 672 LSTI 675

>YOL075C (YOL075C) [4745] chr15 complement(189657..193541) Member of
           the ATP-binding cassette (ABC) superfamily, has
           similarity to Drosophila white protein [3885 bp, 1294
           aa]
          Length = 1294

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 40/172 (23%), Positives = 85/172 (49%), Gaps = 10/172 (5%)

Query: 101 RPGQVLGLVGTNGIGKSTALKILAGKQKPNL-GRFDDPPEWQEIIKYFRGSEL--QNYFT 157
           +PG +  ++G +G GKS+ L +++G+ K ++  +FD       +    + SEL  +N  +
Sbjct: 718 KPGMINAIMGPSGSGKSSLLNLISGRLKSSVFAKFDTSGSI--MFNDIQVSELMFKNVCS 775

Query: 158 KMLEDDIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKSPEDVKRYIKILQLEN--VL 215
            + +DD   +      + +  A    +  + E    RME++ +++ R + +   EN  + 
Sbjct: 776 YVSQDDDHLLAALTVKETLKYAAALRLHHLTE--AERMERT-DNLIRSLGLKHCENNIIG 832

Query: 216 KRDIEKLSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAAQIIRSL 267
              ++ +SGGE +R  +G+  + +  + + DEP+S LD        +I+  L
Sbjct: 833 NEFVKGISGGEKRRVTMGVQLLNDPPILLLDEPTSGLDSFTSATILEILEKL 884

 Score = 38.9 bits (89), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 60/244 (24%), Positives = 102/244 (41%), Gaps = 36/244 (14%)

Query: 81  AHVTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTALKILAGKQKPNLG-----RF- 134
           A  T+    N+F +  LP+   G V+ ++G +G GK+T L +LA K    L      R+ 
Sbjct: 37  ASKTNTTLVNTFSMD-LPS---GSVMAVMGGSGSGKTTLLNVLASKISGGLTHNGSIRYV 92

Query: 135 -----DDPPEWQEIIKYFRGSELQNYFTKMLEDDIKAIIKPQYVDNIPRAIKGPVQKVGE 189
                 +P E +    +  G +        ++  +     PQ     PR       K   
Sbjct: 93  LEDTGSEPNETEPKRAHLDGQD------HPIQKHVIMAYLPQQDVLSPRLTCRETLKFAA 146

Query: 190 LLKLRMEKSPED--VKRYIKILQLEN-----VLKRDIEKLSGGELQRFAIGMSCVQEADV 242
            LKL   +  +   V++ I+ L L++     V       LSGGE +R +IG   +    +
Sbjct: 147 DLKLNSSERTKKLMVEQLIEELGLKDCADTLVGDNSHRGLSGGEKRRLSIGTQMISNPSI 206

Query: 243 YMFDEPSSYLDVKQRLNAAQIIRSLLAPTK-----YVICVEHDLSVLDYLSDFVCIIYGV 297
              DEP++ LD     +A  +I++L    K     +++ +    S + +L D VCI+   
Sbjct: 207 MFLDEPTTGLDA---YSAFLVIKTLKKLAKEDGRTFIMSIHQPRSDILFLLDQVCILSKG 263

Query: 298 PSVY 301
             VY
Sbjct: 264 NVVY 267

 Score = 36.6 bits (83), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 46/204 (22%), Positives = 87/204 (42%), Gaps = 47/204 (23%)

Query: 367 VLNVEEGEFSDSEILVMMGENGTGKTTLIKLLA----GAL---------------KPDE- 406
           ++N    +     ++ +MG +G+GKTTL+ +LA    G L               +P+E 
Sbjct: 44  LVNTFSMDLPSGSVMAVMGGSGSGKTTLLNVLASKISGGLTHNGSIRYVLEDTGSEPNET 103

Query: 407 --------GQDIP---KLNVSMKPQK--IAPKFPGTVRQLFFKKIRGQFLNPQFQT---- 449
                   GQD P    + ++  PQ+  ++P+        F   ++   LN   +T    
Sbjct: 104 EPKRAHLDGQDHPIQKHVIMAYLPQQDVLSPRLTCRETLKFAADLK---LNSSERTKKLM 160

Query: 450 --DVVKPLRIDDIIDQEV-----QHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQ 502
              +++ L + D  D  V     + LSGGE +R++I   +     I  +DEP+  LD+  
Sbjct: 161 VEQLIEELGLKDCADTLVGDNSHRGLSGGEKRRLSIGTQMISNPSIMFLDEPTTGLDAYS 220

Query: 503 RIICSKVIRRFILHNKKTAFIVEH 526
             +  K +++    + +T  +  H
Sbjct: 221 AFLVIKTLKKLAKEDGRTFIMSIH 244

 Score = 36.2 bits (82), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 49/215 (22%), Positives = 82/215 (38%), Gaps = 49/215 (22%)

Query: 354 FSYPSLKKTQGDF------VLNVEEGEFSDSEILVMMGENGTGKTTLIKLLAGALKPDEG 407
           FS P     +G+F      +L      F    I  +MG +G+GK++L+ L++G LK    
Sbjct: 690 FSAPFSNWKEGNFHHETKEILQSVNAIFKPGMINAIMGPSGSGKSSLLNLISGRLKSSV- 748

Query: 408 QDIPKLNVSMKPQKIAPKFPGTVRQLFFKKI----------------------RGQFLNP 445
               K + S        +    V +L FK +                          L  
Sbjct: 749 --FAKFDTSGSIMFNDIQ----VSELMFKNVCSYVSQDDDHLLAALTVKETLKYAAALRL 802

Query: 446 QFQTDVVKPLRIDDII--------------DQEVQHLSGGELQRVAIVLALGIPADIYLI 491
              T+  +  R D++I              ++ V+ +SGGE +RV + + L     I L+
Sbjct: 803 HHLTEAERMERTDNLIRSLGLKHCENNIIGNEFVKGISGGEKRRVTMGVQLLNDPPILLL 862

Query: 492 DEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEH 526
           DEP++ LDS       +++ +      KT  I  H
Sbjct: 863 DEPTSGLDSFTSATILEILEKLCREQGKTIIITIH 897

>Scas_628.13
          Length = 1060

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 44/167 (26%), Positives = 70/167 (41%), Gaps = 38/167 (22%)

Query: 367 VLNVEEGEFSDSEILVMMGENGTGKTTLIKLLAGALKPDEGQDIPKLNVSMKPQKIAPKF 426
           VL   +G     +I  +MG +G GKTTL+ +LA   K  +     K+N ++  +K   K 
Sbjct: 416 VLKSIDGIVKPGQIFAIMGGSGAGKTTLLDILAMKRKTGQVGGEIKVNGNIMSRKSYSKL 475

Query: 427 PGTVRQLFFKKIRGQFLNPQFQT--------------------------DVVKPLRIDDI 460
            G V Q         +L+P                               +++ LRI DI
Sbjct: 476 IGFVDQ-------NDYLHPTLTVYETVLNSALLRLPRTMSFESKQSRVFQILEELRIFDI 528

Query: 461 IDQEVQH-----LSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQ 502
            D+ + +     +SGGE +RV+I   L     I  +DEP++ LD+  
Sbjct: 529 KDRIIGNDFERGISGGEKRRVSIACELVTSPLILFLDEPTSGLDANN 575

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 45/181 (24%), Positives = 78/181 (43%), Gaps = 26/181 (14%)

Query: 101 RPGQVLGLVGTNGIGKSTALKILAGKQKPNL--------GRFDDPPEWQEIIKYFRGSEL 152
           +PGQ+  ++G +G GK+T L ILA K+K           G       + ++I +    + 
Sbjct: 425 KPGQIFAIMGGSGAGKTTLLDILAMKRKTGQVGGEIKVNGNIMSRKSYSKLIGFV---DQ 481

Query: 153 QNYFTKMLEDDIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKSPEDVKRYIKILQLE 212
            +Y    L   +   +    +  +PR +     K   + ++  E    D+K        +
Sbjct: 482 NDYLHPTLT--VYETVLNSALLRLPRTMSFE-SKQSRVFQILEELRIFDIK--------D 530

Query: 213 NVLKRDIEK-LSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAAQIIRSLLAPT 271
            ++  D E+ +SGGE +R +I    V    +   DEP+S LD     NA  +I SL+   
Sbjct: 531 RIIGNDFERGISGGEKRRVSIACELVTSPLILFLDEPTSGLDAN---NANNVITSLVRLA 587

Query: 272 K 272
           K
Sbjct: 588 K 588

>AGL142C [4170] [Homologous to ScYPL058C (PDR12) - NSH]
            (434247..438740) [4494 bp, 1497 aa]
          Length = 1497

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 47/193 (24%), Positives = 88/193 (45%), Gaps = 24/193 (12%)

Query: 101  RPGQVLGLVGTNGIGKSTALKILAGKQKPNL--------GRFDDPPEWQEIIKYFRGSEL 152
            +PG +  L+G +G GK+T L +LA + +  +        G   D   +Q    Y +  +L
Sbjct: 869  KPGTLTALMGYSGAGKTTLLDVLANRVRVGVVTGNIFVDGHLRD-TSFQRKTGYCQQQDL 927

Query: 153  QNYFTKMLEDDIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKSPEDVKRYIKILQLE 212
                T+ + D +K     +   +I RA K     V +++KL   ++  D           
Sbjct: 928  HGR-TQTVRDALKFSAYLRQPQSISRAEKNAY--VEDIIKLLGMEAYADA---------- 974

Query: 213  NVLKRDIEKLSGGELQRFAIGMSCVQEADVYMF-DEPSSYLDVKQRLNAAQIIRSLLAPT 271
             V+    E L+  + +R  IG+  V + ++ +F DEP+S LD +   +  Q+I+ L+   
Sbjct: 975  -VVGVTGEGLNVEQRKRLTIGVELVAKPELLLFLDEPTSGLDSQTAWSICQLIKKLVNHG 1033

Query: 272  KYVICVEHDLSVL 284
            + ++C  H  S +
Sbjct: 1034 QAILCTIHQPSAI 1046

>AGL335W [3977] [Homologous to ScYMR301C (ATM1) - SH]
           complement(82640..84715) [2076 bp, 691 aa]
          Length = 691

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 48/182 (26%), Positives = 84/182 (46%), Gaps = 24/182 (13%)

Query: 383 MMGENGTGKTTLIKLLAGALKPDEGQ------DIPKLN-------VSMKPQKIAPKFPGT 429
           ++G +G+GK+T++KL+    +P++G+      DI  L+       + + PQ   P F  T
Sbjct: 466 IVGPSGSGKSTILKLVFRFYEPEQGRILVGGTDIRDLDLLSLRKAIGVVPQD-TPLFNDT 524

Query: 430 VRQ-LFFKKIRG---QFLNPQFQTDVVKPLR-----IDDIIDQEVQHLSGGELQRVAIVL 480
           + + + F  I     + L    +  + K L+        ++ +    +SGGE QR+AI  
Sbjct: 525 IWENVKFGNISSSDDEILRAIEKAQLTKLLQNLPKGASTVVGERGLMISGGEKQRLAIAR 584

Query: 481 ALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIV 540
            L   A +   DE ++ LD+         I++    N KT+  V H  +     ADK+IV
Sbjct: 585 VLLKDAPLMFFDEATSALDTHTEQALLHTIQQNFSSNSKTSVYVAHR-LRTIADADKIIV 643

Query: 541 FE 542
            E
Sbjct: 644 LE 645

 Score = 37.7 bits (86), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 47/191 (24%), Positives = 85/191 (44%), Gaps = 25/191 (13%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLED 162
           G    +VG +G GKST LK++         RF +P + + ++    G+++++     L  
Sbjct: 461 GMKTAIVGPSGSGKSTILKLVF--------RFYEPEQGRILVG---GTDIRDLDLLSLRK 509

Query: 163 DIKAIIK--PQYVDNIPRAIK-GPVQKVGELLKLRMEKSPEDVKRYIKILQ-----LENV 214
            I  + +  P + D I   +K G +    + +   +EK+     +  K+LQ        V
Sbjct: 510 AIGVVPQDTPLFNDTIWENVKFGNISSSDDEILRAIEKA-----QLTKLLQNLPKGASTV 564

Query: 215 LKRDIEKLSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAAQII-RSLLAPTKY 273
           +      +SGGE QR AI    +++A +  FDE +S LD          I ++  + +K 
Sbjct: 565 VGERGLMISGGEKQRLAIARVLLKDAPLMFFDEATSALDTHTEQALLHTIQQNFSSNSKT 624

Query: 274 VICVEHDLSVL 284
            + V H L  +
Sbjct: 625 SVYVAHRLRTI 635

>Scas_695.24
          Length = 1288

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 78/172 (45%), Gaps = 30/172 (17%)

Query: 353  AFSYPSLKKTQGDFVLNVEEGEFSDSEILVMMGENGTGKTTLIKLLA------------- 399
             F+YPS         LN+E    +  + + ++GE+G+GK+TL+ LL              
Sbjct: 1055 TFAYPSETNVNVYEDLNLEM--HASEKTIGLVGESGSGKSTLMYLLTKLYQVAPHSIYLD 1112

Query: 400  GALKPDEGQDIPKLNVSMKPQKIAPKFPGTVRQLFFKKIRGQFLNPQFQTDVVK------ 453
            G    D G    +  +S+  QK    F GTVR+     I    L+ +   D++K      
Sbjct: 1113 GTDVNDWGLMNLRTQISVVEQK-PTLFDGTVRENLSYGISTDILDMEL-FDMLKYVGIYE 1170

Query: 454  -----PLRIDDIIDQEVQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDS 500
                 P  +D  ID ++  LSGG+ QR+ I  AL     I ++DE ++ LD+
Sbjct: 1171 FVESLPFGLDTRIDTKL--LSGGQAQRICIARALLRKPKILILDECTSALDA 1220

 Score = 33.5 bits (75), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 40/162 (24%), Positives = 68/162 (41%), Gaps = 33/162 (20%)

Query: 104  QVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLEDD 163
            + +GLVG +G GKST + +L          +   P       Y  G+++ ++    L   
Sbjct: 1079 KTIGLVGESGSGKSTLMYLLTK-------LYQVAPH----SIYLDGTDVNDWGLMNLRTQ 1127

Query: 164  IKAI-IKPQYVD-----NIPRAIKGPVQKVGELLKLRMEKSPEDVKRYIKILQLENVL-- 215
            I  +  KP   D     N+   I   +        L ME    D+ +Y+ I +    L  
Sbjct: 1128 ISVVEQKPTLFDGTVRENLSYGISTDI--------LDMELF--DMLKYVGIYEFVESLPF 1177

Query: 216  ----KRDIEKLSGGELQRFAIGMSCVQEADVYMFDEPSSYLD 253
                + D + LSGG+ QR  I  + +++  + + DE +S LD
Sbjct: 1178 GLDTRIDTKLLSGGQAQRICIARALLRKPKILILDECTSALD 1219

>YDR011W (SNQ2) [865] chr4 (465916..470421) Drug-efflux pump
           involved in resistance to multiple drugs, member of the
           ATP-binding cassette (ABC) superfamily [4506 bp, 1501
           aa]
          Length = 1501

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 50/213 (23%), Positives = 92/213 (43%), Gaps = 22/213 (10%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLG------RFDDPPEWQEIIKYFRGSELQNYF 156
           G+++ ++G  G G S+ LK+ AG+     G       +D  P+ +E++K ++   + N  
Sbjct: 186 GEMILVLGRPGAGCSSFLKVTAGEIDQFAGGVSGEVAYDGIPQ-EEMMKRYKADVIYN-- 242

Query: 157 TKMLEDDIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKSPEDVKRYIKILQLENVLK 216
              L+     +   Q +D    A K P  +V  + K     S  D+  Y  I  L +   
Sbjct: 243 -GELDVHFPYLTVKQTLD-FAIACKTPALRVNNVSKKEYIASRRDL--YATIFGLRHTYN 298

Query: 217 RD-----IEKLSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAAQIIR---SLL 268
                  +  +SGGE +R +I  +   +  +Y +D  +  LD    L  A+ IR   +LL
Sbjct: 299 TKVGNDFVRGVSGGERKRVSIAEALAAKGSIYCWDNATRGLDASTALEYAKAIRIMTNLL 358

Query: 269 APTKYVICVEHDLSVLDYLSDFVCIIYGVPSVY 301
             T +V   +   ++ +   D V ++Y    +Y
Sbjct: 359 KSTAFVTIYQASENIYETF-DKVTVLYSGKQIY 390

 Score = 37.4 bits (85), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 31/60 (51%)

Query: 465 VQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIV 524
           V+ +SGGE +RV+I  AL     IY  D  +  LD+   +  +K IR      K TAF+ 
Sbjct: 306 VRGVSGGERKRVSIAEALAAKGSIYCWDNATRGLDASTALEYAKAIRIMTNLLKSTAFVT 365

 Score = 35.4 bits (80), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 45/83 (54%), Gaps = 5/83 (6%)

Query: 202  VKRYIKILQLENVLKRDIEKLSGG----ELQRFAIGMSCVQEADVYMF-DEPSSYLDVKQ 256
            V++ I++L +E   +  + ++  G    + ++ +IG+  V + D+ +F DEP+S LD + 
Sbjct: 969  VEKIIRVLGMEEYAEALVGEVGCGLNVEQRKKLSIGVELVAKPDLLLFLDEPTSGLDSQS 1028

Query: 257  RLNAAQIIRSLLAPTKYVICVEH 279
                 Q++R L    + ++C  H
Sbjct: 1029 SWAIIQLLRKLSKAGQSILCTIH 1051

>Sklu_2316.1 YKL209C, Contig c2316 84-4016 reverse complement
          Length = 1310

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 66/241 (27%), Positives = 102/241 (42%), Gaps = 58/241 (24%)

Query: 318  LDGHIPAENLRFRTEALQFRIAD----ATEDLQNDSASR-------------AFSYPSLK 360
            L G IP  +   R     FRI D    A +D +   AS              +FSYPS  
Sbjct: 1028 LIGQIPDISRGQRAATYIFRIIDNQSPAAKDEKKKIASYKFTHDPLISVKNLSFSYPSAP 1087

Query: 361  KTQ--GDFVLNVEEGEFSDSEILVMMGENGTGKTTLIKLLA-------GALKPDEGQDIP 411
             T       L+V  GE      + ++GE+G+GK+TL  L++       G+++ D G DI 
Sbjct: 1088 STAIYKGLKLDVFSGE-----TIAVVGESGSGKSTLTLLISALYEVPNGSIEID-GIDIN 1141

Query: 412  KLN----------VSMKPQKIAPKFPGTVRQLFFKKIRGQFLNPQFQ--------TDVV- 452
            + +          V  KPQ     F GTV +     I G+    Q +         D V 
Sbjct: 1142 RWDTNKLRTIISVVEQKPQF----FDGTVGENLLYGISGRVTQIQVKEALCLAGVQDFVF 1197

Query: 453  -KPLRIDDIIDQEVQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIR 511
              P  +D  ID  +  +SGG+ QR++I  A+     I  +DE ++ LD+      + +I+
Sbjct: 1198 SLPEGLDTRIDTSL--ISGGQAQRLSIARAMLRKPKILFLDECTSALDTSNTHAIANLIK 1255

Query: 512  R 512
            +
Sbjct: 1256 K 1256

 Score = 36.6 bits (83), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 42/171 (24%), Positives = 74/171 (43%), Gaps = 23/171 (13%)

Query: 102  PGQVLGLVGTNGIGKST-ALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKML 160
             G+ + +VG +G GKST  L I A  + PN G  +             G ++  + T  L
Sbjct: 1101 SGETIAVVGESGSGKSTLTLLISALYEVPN-GSIE-----------IDGIDINRWDTNKL 1148

Query: 161  EDDIKAI-IKPQYVD-----NIPRAIKGPVQKVGELLKLRMEKSPEDVKRYIKILQLENV 214
               I  +  KPQ+ D     N+   I G V ++    +++       V+ ++  L     
Sbjct: 1149 RTIISVVEQKPQFFDGTVGENLLYGISGRVTQI----QVKEALCLAGVQDFVFSLPEGLD 1204

Query: 215  LKRDIEKLSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAAQIIR 265
             + D   +SGG+ QR +I  + +++  +   DE +S LD       A +I+
Sbjct: 1205 TRIDTSLISGGQAQRLSIARAMLRKPKILFLDECTSALDTSNTHAIANLIK 1255

>Scas_710.50
          Length = 602

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 43/180 (23%), Positives = 83/180 (46%), Gaps = 22/180 (12%)

Query: 99  TPRPGQVLGLVGTNGIGKSTALKILAGKQKPNLG---------RFDDPPEWQEIIKYFRG 149
           T +PG +  ++G +G GKST L +++G+ + +            F+D    +E+ K    
Sbjct: 25  TFKPGMINAIMGPSGSGKSTLLNLVSGRIESSFFAKFATTGSIMFNDVQISEEMFK---- 80

Query: 150 SELQNYFTKMLEDDIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKSPEDVKRYIKIL 209
               N  + + +DD   + K    +    A    +  + E  + R+ KS E + R + + 
Sbjct: 81  ----NVCSYVSQDDDHLLAKLTVRETFKFAADLRLHNLTE--EQRVIKSDELI-RALGLK 133

Query: 210 QLEN--VLKRDIEKLSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAAQIIRSL 267
             EN  +    I+ +SGGE +R  +G+  + +  + + DEP+S LD        +I++ L
Sbjct: 134 HCENNIIGNEFIKGISGGEKRRVTMGIQLLNDPPIVLLDEPTSGLDSFTSATILEILKKL 193

 Score = 36.6 bits (83), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 46/199 (23%), Positives = 79/199 (39%), Gaps = 33/199 (16%)

Query: 359 LKKTQGDFVLNVEEGEFSDSEILVMMGENGTGKTTLIKLLAGALKPDEGQDIPKLN---- 414
           L   Q   +L      F    I  +MG +G+GK+TL+ L++G ++               
Sbjct: 10  LYHHQSKQILQSINATFKPGMINAIMGPSGSGKSTLLNLVSGRIESSFFAKFATTGSIMF 69

Query: 415 ----------------VSMKPQKIAPKFPGTVRQLFFKKIRGQFLNPQFQTDVVKPLRI- 457
                           VS     +  K   TVR+ F      +  N   +  V+K   + 
Sbjct: 70  NDVQISEEMFKNVCSYVSQDDDHLLAKL--TVRETFKFAADLRLHNLTEEQRVIKSDELI 127

Query: 458 ---------DDIIDQE-VQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICS 507
                    ++II  E ++ +SGGE +RV + + L     I L+DEP++ LDS       
Sbjct: 128 RALGLKHCENNIIGNEFIKGISGGEKRRVTMGIQLLNDPPIVLLDEPTSGLDSFTSATIL 187

Query: 508 KVIRRFILHNKKTAFIVEH 526
           +++++  +   KT  I  H
Sbjct: 188 EILKKLSVEYGKTIIITIH 206

>KLLA0A10131g complement(889688..891850) similar to sp|P40416
           Saccharomyces cerevisiae YMR301c ATM1 ATP-binding
           cassette transporter protein, mitochondrial,
           hypothetical start
          Length = 720

 Score = 43.1 bits (100), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 55/217 (25%), Positives = 94/217 (43%), Gaps = 33/217 (15%)

Query: 383 MMGENGTGKTTLIKLLAGALKPDEG------QDIPKLN-------VSMKPQKIAPKFPGT 429
           ++G +G+GK+T+++L+     P +G      +DI +L+       V + PQ   P F  T
Sbjct: 487 IVGPSGSGKSTILRLVFRFYDPQQGRILLDGKDIRELDLDELRRIVGVVPQD-TPLFNDT 545

Query: 430 VRQ-LFFKKIRGQFLNPQFQTDVVK----------PLRIDDIIDQEVQHLSGGELQRVAI 478
           + + + F +I     + +  T + K          P   + I+ +    +SGGE QR+AI
Sbjct: 546 IWENVKFGRINAT--DNEIVTAIEKAQLSDLIHKLPKGTETIVGERGLMISGGEKQRLAI 603

Query: 479 VLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKV 538
              L     I   DE ++ LD+       K I+       KT+  + H  +     ADK+
Sbjct: 604 ARVLLKDTPIMFFDEATSALDTHTEQSLLKTIKENFSDVAKTSVYIAHR-LRTIADADKI 662

Query: 539 IVFEGIP-----SKNAHARAPESLLTGCNRFLKNLNV 570
           IV E        + NA    P SL +      +NL++
Sbjct: 663 IVLENGAVREEGTHNALLANPNSLYSELWNIQENLDM 699

 Score = 38.1 bits (87), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 43/161 (26%), Positives = 72/161 (44%), Gaps = 18/161 (11%)

Query: 99  TPRPGQVLGLVGTNGIGKSTALKILAGKQKPNLGR-FDDPPEWQEI----IKYFRGSELQ 153
           T  PG+   +VG +G GKST L+++     P  GR   D  + +E+    ++   G   Q
Sbjct: 478 TIAPGKKTAIVGPSGSGKSTILRLVFRFYDPQQGRILLDGKDIRELDLDELRRIVGVVPQ 537

Query: 154 NYFTKMLEDDIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKSPEDVKRYIKILQLEN 213
           +  T +  D I   +K   ++     I   ++K  +L  L + K P+           E 
Sbjct: 538 D--TPLFNDTIWENVKFGRINATDNEIVTAIEK-AQLSDL-IHKLPKGT---------ET 584

Query: 214 VLKRDIEKLSGGELQRFAIGMSCVQEADVYMFDEPSSYLDV 254
           ++      +SGGE QR AI    +++  +  FDE +S LD 
Sbjct: 585 IVGERGLMISGGEKQRLAIARVLLKDTPIMFFDEATSALDT 625

>KLLA0D04059g complement(338422..343128) similar to sp|P14772
            Saccharomyces cerevisiae YLL015w BPT1, start by
            similarity
          Length = 1568

 Score = 43.1 bits (100), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 47/162 (29%), Positives = 73/162 (45%), Gaps = 35/162 (21%)

Query: 383  MMGENGTGKTTLIKLLAGALKPDEGQ------DIPKL-------NVSMKPQKIAPKFPGT 429
            ++G  G GK+TL   L   L+P EG+      DI  L       ++S+ PQ  A  F GT
Sbjct: 1347 VVGRTGAGKSTLTLALFRILEPFEGKITIDGIDISTLGLYDLRRSLSIIPQD-AQAFEGT 1405

Query: 430  VRQLF-----------FKKIRGQFLNPQFQTDVVKPLRID-----DIIDQEV----QHLS 469
            VR              +K +    L P  +  +V  L  D     D++D ++     +LS
Sbjct: 1406 VRSNLDPFNRHTDAEIWKALELSHLKPHIER-IVSELPDDENKPTDLLDTQISDNGNNLS 1464

Query: 470  GGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIR 511
             G+ Q + +  AL  P+ I ++DE +A +D E   I  + IR
Sbjct: 1465 MGQRQLLCLSRALLNPSKILILDEATAAVDRETDKIIQETIR 1506

 Score = 33.1 bits (74), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 33/161 (20%), Positives = 71/161 (44%), Gaps = 25/161 (15%)

Query: 369 NVEEGEFSDSEILVMMGENGTGKTTLIKLLAGAL---KPDEGQDI-PKLNVSMKPQKIAP 424
           ++E      +++  ++G  G+GK+T ++ + G L     D    + PK+ +        P
Sbjct: 644 SIENFSAKKAQLTCIVGRVGSGKSTFLQAILGQLPCVSSDSASGVKPKVVIRADNLAYCP 703

Query: 425 KFPGTV---------------RQLFFKKIRGQFLNPQFQTDVVKPLRIDDIIDQEVQHLS 469
           + P  +                 ++ K I+   L P  +   + P     ++ ++   LS
Sbjct: 704 QQPWIMNASLKDNILFGYKYDEAMYKKTIKACQLLPDLE---ILPDGDQTLVGEKGISLS 760

Query: 470 GGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVI 510
           GG+  R+++  A+   AD+YL+D+  + +DS    +C  +I
Sbjct: 761 GGQKARLSLARAVYSRADLYLLDDVLSAVDSH---VCKSII 798

>AFR683C [3876] [Homologous to ScYLR188W (MDL1) - SH]
           (1697345..1699378) [2034 bp, 677 aa]
          Length = 677

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 46/208 (22%), Positives = 84/208 (40%), Gaps = 37/208 (17%)

Query: 102 PGQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQ-----EIIKYFRGSELQNYF 156
           PG+ + +VG +G GKST   +L         RF DP         E I+ F  S+ +   
Sbjct: 455 PGEHVCIVGPSGGGKSTVASLLL--------RFYDPISGSITIGGEDIRLFNLSKYRRMM 506

Query: 157 TKMLEDDIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKSPEDVKRYIKILQ------ 210
             + ++ +  +     ++NI  A           L L + K P  + R +++        
Sbjct: 507 GIVQQEPV--LFNASILENITYA-----------LPLHLTKDPARIDRALRLSNCSAFVG 553

Query: 211 -----LENVLKRDIEKLSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAAQIIR 265
                L+  +     +LSGG+ QR A+  + +Q+  + + DE +S LD K     A  + 
Sbjct: 554 SFPEGLQTAVGPRGTQLSGGQKQRVALARAFLQDPAILILDEATSALDSKSEDIVASTLL 613

Query: 266 SLLAPTKYVICVEHDLSVLDYLSDFVCI 293
                 K  I + H  S + + +  + +
Sbjct: 614 QRCQEAKITISIAHRKSTIQHSTRVIVL 641

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 30/47 (63%), Gaps = 1/47 (2%)

Query: 467 HLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSE-QRIICSKVIRR 512
            LSGG+ QRVA+  A      I ++DE ++ LDS+ + I+ S +++R
Sbjct: 569 QLSGGQKQRVALARAFLQDPAILILDEATSALDSKSEDIVASTLLQR 615

>YCR011C (ADP1) [545] chr3 complement(133721..136870) Member of the
           ATP-binding cassette (ABC) superfamily of membrane
           transporters [3150 bp, 1049 aa]
          Length = 1049

 Score = 43.1 bits (100), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 63/269 (23%), Positives = 107/269 (39%), Gaps = 35/269 (13%)

Query: 353 AFSYPSLKKTQ-GDFVLNVEEGEFSDSEILVMMGENGTGKTTLIKLLAGALKPDEGQDIP 411
            +S PS+      + VLN   G     +IL +MG +G GKTTL+ +LA   K        
Sbjct: 390 TYSVPSINSDGVEETVLNEISGIVKPGQILAIMGGSGAGKTTLLDILAMKRKTGHVSGSI 449

Query: 412 KLNVSMKPQKIAPKFPGTVRQ---------LFFKKIRGQFLN-PQFQTDVVKPLRIDDII 461
           K+N     +K   K  G V Q         +F   +    L  P+  +   K  R+  ++
Sbjct: 450 KVNGISMDRKSFSKIIGFVDQDDFLLPTLTVFETVLNSALLRLPKALSFEAKKARVYKVL 509

Query: 462 DQEV--------------QHLSGGELQRVAIVLALGIPADIYLIDEPSAYLD-SEQRIIC 506
           ++                + +SGGE +RV+I   L     +  +DEP++ LD S    + 
Sbjct: 510 EELRIIDIKDRIIGNEFDRGISGGEKRRVSIACELVTSPLVLFLDEPTSGLDASNANNVI 569

Query: 507 SKVIRRFILHNKKTAFIVEHDFIMATYLADKVI-------VFEGIPSKNAHARAPESLLT 559
             ++R    +N+     +        YL DK++       V+ G   K +     E  + 
Sbjct: 570 ECLVRLSSDYNRTLVLSIHQPRSNIFYLFDKLVLLSKGEMVYSGNAKKVSEFLRNEGYIC 629

Query: 560 GCNRFLKN--LNVTFRRDPNSFRPRINKL 586
             N  + +  +++TF   P   R RI  +
Sbjct: 630 PDNYNIADYLIDITFEAGPQGKRRRIRNI 658

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 47/177 (26%), Positives = 77/177 (43%), Gaps = 26/177 (14%)

Query: 101 RPGQVLGLVGTNGIGKSTALKILAGKQKPNL--------GRFDDPPEWQEIIKYFRGSEL 152
           +PGQ+L ++G +G GK+T L ILA K+K           G   D   + +II +    + 
Sbjct: 414 KPGQILAIMGGSGAGKTTLLDILAMKRKTGHVSGSIKVNGISMDRKSFSKIIGFVDQDDF 473

Query: 153 QNYFTKMLEDDIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKSPEDVKRYIKILQLE 212
                 + E  + + +       +P+A+    +K       R+ K  E+++      ++ 
Sbjct: 474 LLPTLTVFETVLNSALL-----RLPKALSFEAKKA------RVYKVLEELRIIDIKDRII 522

Query: 213 -NVLKRDIEKLSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAAQIIRSLL 268
            N   R I   SGGE +R +I    V    V   DEP+S LD     NA  +I  L+
Sbjct: 523 GNEFDRGI---SGGEKRRVSIACELVTSPLVLFLDEPTSGLDAS---NANNVIECLV 573

>KLLA0C04477g complement(409543..413304) similar to sp|Q08234
           Saccharomyces cerevisiae YOL075c, start by similarity
          Length = 1253

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 42/158 (26%), Positives = 70/158 (44%), Gaps = 17/158 (10%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLED 162
           GQ++ ++G +G GK+T L +LAGK   ++  +D        I+Y R +  +       ++
Sbjct: 41  GQLMAIIGGSGSGKTTMLNVLAGKTNSSI-NYDGE------IQYSRDAAKEG---SKADE 90

Query: 163 DIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKSPED--VKRYIKILQL----ENVLK 216
            +      Q+     R       ++   LKL + K      V+  I  L L    E  + 
Sbjct: 91  KVTTAYLTQHDALAARLTCRETLRIAADLKLHLPKQERYSLVEELIAELGLRDCSETFVG 150

Query: 217 RDIEK-LSGGELQRFAIGMSCVQEADVYMFDEPSSYLD 253
             I K LSGGE +R +I +  +    V   DEP++ LD
Sbjct: 151 DSINKGLSGGEKRRLSIAVQMIANPSVLFLDEPTTGLD 188

 Score = 37.0 bits (84), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 33/61 (54%)

Query: 219 IEKLSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAAQIIRSLLAPTKYVICVE 278
           I+ +SGGE +R +IG+  + +  V + DEP+S LD        ++++ L    K +I   
Sbjct: 801 IKGISGGEKRRVSIGIQLLTDPSVLLLDEPTSGLDSFTSSTIIELLKKLCQQGKTIILTI 860

Query: 279 H 279
           H
Sbjct: 861 H 861

 Score = 36.2 bits (82), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 37/177 (20%), Positives = 74/177 (41%), Gaps = 28/177 (15%)

Query: 377 DSEILVMMGENGTGKTTLIKLLAG-----------------ALKPDEGQDIPKLNVSMKP 419
           + +++ ++G +G+GKTT++ +LAG                 A K     D  K+  +   
Sbjct: 40  NGQLMAIIGGSGSGKTTMLNVLAGKTNSSINYDGEIQYSRDAAKEGSKAD-EKVTTAYLT 98

Query: 420 QKIAPKFPGTVRQLFFKKIRGQFLNPQ-----FQTDVVKPLRIDD-----IIDQEVQHLS 469
           Q  A     T R+        +   P+        +++  L + D     + D   + LS
Sbjct: 99  QHDALAARLTCRETLRIAADLKLHLPKQERYSLVEELIAELGLRDCSETFVGDSINKGLS 158

Query: 470 GGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEH 526
           GGE +R++I + +     +  +DEP+  LD+    +  K +++   H  +T  +  H
Sbjct: 159 GGEKRRLSIAVQMIANPSVLFLDEPTTGLDAYSAFLLIKTLKKLCEHGGRTIIMSIH 215

 Score = 32.0 bits (71), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 25/36 (69%)

Query: 465 VQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDS 500
           ++ +SGGE +RV+I + L     + L+DEP++ LDS
Sbjct: 801 IKGISGGEKRRVSIGIQLLTDPSVLLLDEPTSGLDS 836

>CAGL0L06402g 718726..723333 highly similar to sp|P39109
           Saccharomyces cerevisiae YDR135c YCF1 or sp|P14772
           Saccharomyces cerevisiae YLL015w BPT1, hypothetical
           start
          Length = 1535

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 48/188 (25%), Positives = 83/188 (44%), Gaps = 39/188 (20%)

Query: 343 EDLQNDSASRAFSYPSLKKTQGDFVLNVEEG--------------------EFSDSEILV 382
           E+LQ D+  R    P +K+  GD  +NV +                     +    E+  
Sbjct: 624 EELQKDAVQRL---PKVKEI-GDVAVNVGDNATFLWKRKPEYKVALKNINYQAKKGELSC 679

Query: 383 MMGENGTGKTTLIKLLAGALKPDEGQDIPKLNVSMKPQKIAPKFPGTVRQLFFKKIRGQF 442
           ++G+ G+GK+  ++ L G L   +G      +V+   Q +A    GTVR      + G  
Sbjct: 680 IVGKVGSGKSAFLQSLLGDLFRVKGFATIHGSVAYVSQ-VAWIMNGTVRD---NVLFGHK 735

Query: 443 LNPQFQTDVVKP--LRID---------DIIDQEVQHLSGGELQRVAIVLALGIPADIYLI 491
            +P+F    +K   L ID          ++ ++   LSGG+  R+++  A+   AD YL+
Sbjct: 736 YDPEFYEKTIKACALTIDLATLVDGDQTLVGEKGISLSGGQKARLSLARAVYARADTYLL 795

Query: 492 DEPSAYLD 499
           D+P A +D
Sbjct: 796 DDPLAAVD 803

 Score = 35.8 bits (81), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 55/239 (23%), Positives = 102/239 (42%), Gaps = 52/239 (21%)

Query: 365  DFVLNVEEGEFSDSEILVMMGENGTGKTTL-------IKLLAGALKPDEGQDIPKL---- 413
            D+VL     E    E + ++G  G GK++L       I+  +G +  D G  I ++    
Sbjct: 1308 DYVLKDINLEIKPREKIGIVGRTGAGKSSLTLALFRIIEATSGGILID-GVHINEIGLHD 1366

Query: 414  ---NVSMKPQKIAPKFPGTVRQLFFKKIRGQFLNPQFQ---TDVVKPLRIDDIIDQEVQ- 466
               ++S+ PQ  +  F GT+R+          ++P  Q    D+ + L +  + +  +Q 
Sbjct: 1367 LRHHLSIIPQD-SQVFEGTIRE---------NIDPTNQFTDADIWRALELSHLKEHIMQM 1416

Query: 467  --------------HLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRR 512
                          +LS G+ Q + +  AL +P+ + ++DE +A +D E   +  + IR 
Sbjct: 1417 GGDGLMTMMTEGGSNLSVGQRQLMCLARALLVPSKVLVLDEATAAVDVETDKVIQETIRT 1476

Query: 513  FILHNKKTAFIVEH--DFIMATYLADKVIVFEGIPSKNAHARAPESLLTGCNRFLKNLN 569
                  +T   + H  + IM     D++IV +    K      PE+LL   N    +L+
Sbjct: 1477 SF--KDRTILTIAHRINTIMDN---DRIIVLD--KGKVVEFDTPEALLKNTNSIFYSLS 1528

>Scas_573.11
          Length = 689

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 39/73 (53%), Gaps = 3/73 (4%)

Query: 219 IEKLSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAAQIIRSLLAPTKYVICVE 278
           I  LSGG   + A+  + ++ AD+ + DEP+++LD    +N A ++  L       I + 
Sbjct: 581 ISALSGGWKMKLALARAVLRNADILLLDEPTNHLDT---VNVAWLVNYLNTCGITSITIS 637

Query: 279 HDLSVLDYLSDFV 291
           HD   LD + +++
Sbjct: 638 HDSVFLDSVCEYI 650

 Score = 40.0 bits (92), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 46/87 (52%), Gaps = 4/87 (4%)

Query: 458 DDIIDQEVQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHN 517
           D++I   +  LSGG   ++A+  A+   ADI L+DEP+ +LD+    +    +  ++   
Sbjct: 574 DEMIAMPISALSGGWKMKLALARAVLRNADILLLDEPTNHLDT----VNVAWLVNYLNTC 629

Query: 518 KKTAFIVEHDFIMATYLADKVIVFEGI 544
             T+  + HD +    + + +I +EG+
Sbjct: 630 GITSITISHDSVFLDSVCEYIINYEGL 656

>CAGL0C02343g 236840..238672 highly similar to sp|P40024
           Saccharomyces cerevisiae YER036c, start by similarity
          Length = 610

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 48/167 (28%), Positives = 75/167 (44%), Gaps = 11/167 (6%)

Query: 382 VMMGENGTGKTTLIKLLAGALKPDEGQDIPKLNVSMK--PQKIAPKFPGTVRQLFFKKIR 439
            ++G NG GK+TL+K++ G L P  G+     +V +    Q    +   T   L F + +
Sbjct: 425 ALVGPNGVGKSTLLKIMTGELMPQSGRVSRHTHVKLGVYSQHSQDQLDLTKSALEFVRDK 484

Query: 440 GQFLNPQFQTDVVKPLRIDDIID-QEVQH--LSGGELQRVAI-VLALGIPADIYLIDEPS 495
              ++  FQ    +  R     D Q+VQ   LS G+  RV   +LAL  P ++ L+DEP+
Sbjct: 485 YSNISQDFQYWRGQLGRYGLTGDAQKVQMGTLSEGQRSRVVFALLALENP-NVLLLDEPT 543

Query: 496 AYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIVFE 542
             LD       +  I  F         +V HDF +   +A  + V E
Sbjct: 544 NGLDIPTIDSLADAINEF----NGGVVVVSHDFRLLDKIAKDIFVVE 586

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 47/189 (24%), Positives = 82/189 (43%), Gaps = 29/189 (15%)

Query: 107 GLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTK-MLEDDIK 165
            LVG NG+GKST LKI+ G+  P  GR       +  + Y + S+ Q   TK  LE    
Sbjct: 425 ALVGPNGVGKSTLLKIMTGELMPQSGRVSRHTHVKLGV-YSQHSQDQLDLTKSALE---- 479

Query: 166 AIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKSPEDVKRYIKILQLENVLKRDIEKLSGG 225
             ++ +Y  NI +  +      G+L +  +    + V+               +  LS G
Sbjct: 480 -FVRDKY-SNISQDFQ---YWRGQLGRYGLTGDAQKVQ---------------MGTLSEG 519

Query: 226 ELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAAQIIRSLLAPTKYVICVEHDLSVLD 285
           +  R    +  ++  +V + DEP++ LD+    + A  I         V+ V HD  +LD
Sbjct: 520 QRSRVVFALLALENPNVLLLDEPTNGLDIPTIDSLADAINEF---NGGVVVVSHDFRLLD 576

Query: 286 YLSDFVCII 294
            ++  + ++
Sbjct: 577 KIAKDIFVV 585

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 47/184 (25%), Positives = 81/184 (44%), Gaps = 46/184 (25%)

Query: 383 MMGENGTGKTTLIKLLAGALKPDEGQDIP-KLNVSMKPQKIAPK----FPGTVRQL---- 433
           ++GENG GK+T +K LA    P     IP  ++V +  +  AP         VR+     
Sbjct: 112 LLGENGCGKSTFLKALATREYP-----IPDHIDVYLLDEPAAPTEYSALEYVVREAQNEL 166

Query: 434 -----FFKKI------RGQFLNPQFQ-TDVVKPLRIDD--------------IIDQEVQH 467
                  +KI        + L+P ++  D + P   +                I ++ + 
Sbjct: 167 KRVEDLVEKIILEDGPESELLDPLYERMDGMDPSTFESRAAVILIGLGFNSQTILKKTKD 226

Query: 468 LSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEH- 526
           +SGG   RVA+  AL +   + L+D+P+A+LD E  +   + ++RF     +T  +V H 
Sbjct: 227 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEACVWLEEYLKRF----DRTLVLVSHS 282

Query: 527 -DFI 529
            DF+
Sbjct: 283 QDFL 286

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 44/167 (26%), Positives = 80/167 (47%), Gaps = 27/167 (16%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKP-----NLGRFDDP--PEWQEIIKYFRGSELQNY 155
           G+  GL+G NG GKST LK LA ++ P     ++   D+P  P     ++Y    E QN 
Sbjct: 107 GRRYGLLGENGCGKSTFLKALATREYPIPDHIDVYLLDEPAAPTEYSALEYVV-REAQNE 165

Query: 156 FTKMLEDDIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEK-SPEDVKRYIKILQL--- 211
             K +ED ++ II             GP  ++ + L  RM+   P   +    ++ +   
Sbjct: 166 L-KRVEDLVEKIILED----------GPESELLDPLYERMDGMDPSTFESRAAVILIGLG 214

Query: 212 ---ENVLKRDIEKLSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVK 255
              + +LK+  + +SGG   R A+  +   +  + + D+P+++LD++
Sbjct: 215 FNSQTILKK-TKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLE 260

>CAGL0E03355g complement(307242..311849) similar to sp|P14772
           Saccharomyces cerevisiae YLL015w BPT1, hypothetical
           start
          Length = 1535

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 44/180 (24%), Positives = 87/180 (48%), Gaps = 22/180 (12%)

Query: 369 NVEEGEFSDSEILVMMGENGTGKTTLIKLLAGALKPDEGQD--------IPKLNVSMKPQ 420
           +++  E   S ++ ++G  G GK+T++K + G L    G +        I    V+  PQ
Sbjct: 636 SIDNFEVPKSSLICVVGRVGAGKSTILKCILGQLPCISGNNDHLSPQFQINATTVAYCPQ 695

Query: 421 KIAPKFPGTVRQ--LFFKKIRGQFLNP-----QFQTDV-VKPLRIDDIIDQEVQHLSGGE 472
           + A     +V+   LF  K    F        Q   D+ V P   + ++ ++   LSGG+
Sbjct: 696 E-AWIMNASVKDNILFGHKYDEAFYKATIKACQLLPDIKVLPDGDETMVGEKGIVLSGGQ 754

Query: 473 LQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMAT 532
             R+++  A+   AD+YL+D+  + +D+E   +C  +I+  +  ++KT  + +   ++AT
Sbjct: 755 KTRLSLARAVYSRADLYLLDDILSAVDTE---VCKTIIKEVL--DEKTGLLKDKSIVLAT 809

 Score = 32.0 bits (71), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 52/214 (24%), Positives = 90/214 (42%), Gaps = 45/214 (21%)

Query: 383  MMGENGTGKTTLIKLLAGALKPDEGQ------DIPKL-------NVSMKPQKIAPKFPGT 429
            ++G  G GK+TL   L   L+P  G       DI  +       ++++ PQ  A  F GT
Sbjct: 1308 VVGRTGAGKSTLSMALFRLLEPTAGTISIDNIDITSIGLRDLRSHIAIIPQD-AQAFEGT 1366

Query: 430  VRQLF-----------FKKIRGQFLNPQFQTDVVKPL----------RIDDIIDQEVQ-- 466
            +R              +  I    L    +T + K +          R++  +D  V+  
Sbjct: 1367 IRSNLDPFEKFSDDDLWHAIELSHLKFHLET-IAKEINDDSEYSDRSRLESPLDIPVREA 1425

Query: 467  --HLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIV 524
              +LS G+ Q + +  AL   + I ++DE +A +D E   I  + IR+      +T   +
Sbjct: 1426 GSNLSVGQKQLLCLARALLNKSKILVLDEATASVDVETDKIIQETIRKEF--ADRTILTI 1483

Query: 525  EHDFIMATYLADKVIVFEGIPSKNAHARAPESLL 558
             H  +   + +D++IV +G   K      PE+LL
Sbjct: 1484 AHR-LDTVFDSDRIIVLDGGEVK--EFDKPETLL 1514

>KLLA0B14256g 1248654..1252469 similar to sp|P12866 Saccharomyces
            cerevisiae YKL209c STE6 ATP-binding cassette transporter
            protein, hypothetical start
          Length = 1271

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 63/272 (23%), Positives = 119/272 (43%), Gaps = 47/272 (17%)

Query: 323  PAENLRFRTEALQFRIADATEDLQNDSASRAFSYPSLKKTQGDFVLNVEEGEFSDSEILV 382
            P++N  F      F  A   E ++  + S AFS   + K     + N    E   +E + 
Sbjct: 1017 PSQNQSF------FSTAGNRETIKISNLSFAFSSAPMNK-----IFNSLSCEICLNETVG 1065

Query: 383  MMGENGTGKTTLI------------KLLAGALKPDEGQDIP-KLNVSMKPQKIAPKF-PG 428
            ++GE+G+GK+TL             K+  G +  ++  +   +  +S+  QK  PKF  G
Sbjct: 1066 IVGESGSGKSTLSLLLTRLYPVPSGKVYIGGIDINKWDEYALRRTISIVEQK--PKFFDG 1123

Query: 429  TVRQLFFKKIRGQFLNPQFQTDVVKPLRIDDII-------DQEVQH--LSGGELQRVAIV 479
            TVR+     ++    N + ++ V+K + +   +       +  V    +SGG+ QR++I 
Sbjct: 1124 TVRENLVYGLKRNVSNSELRS-VLKSVDLLSFVQTLPNDLNTRVHDGLMSGGQAQRLSIA 1182

Query: 480  LALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVI 539
              L     I ++DE ++ LD+      +++IR  +L N     I   + +M   + D+V+
Sbjct: 1183 RTLLRQPKIIILDECTSALDAANSFAIAELIRT-VLKNVTVIVITHSEQLMQ--ICDRVL 1239

Query: 540  VF-------EGIPSKNAHARAPESLLTGCNRF 564
            V        EG  ++   +R     +  C R+
Sbjct: 1240 VLKKGKVKEEGSYAELFESRGELYRIVSCTRY 1271

 Score = 38.5 bits (88), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 50/207 (24%), Positives = 85/207 (41%), Gaps = 46/207 (22%)

Query: 353 AFSYPSLKKTQGDFVLNVEEGEFSDSEILVMMGENGTGKTTLIKLL-------AGALKPD 405
           +F+YP+      D+VL     +        ++G++G+GK+TL  LL        G +K  
Sbjct: 363 SFAYPT---RPDDYVLKNVSIKIKSGATCFIVGKSGSGKSTLASLLLKMYGEYTGEIKFG 419

Query: 406 EGQDIPKL-------NVSMKPQKIAPKFPGTVRQLF-----------------FKKIRGQ 441
           E  +I  L       N+++  Q+    F GT++                    F  +   
Sbjct: 420 E-YEIDSLDDSWLVENITLVEQR-CTLFNGTLKDNLTIVNKYASCTEVKQACQFALLNTV 477

Query: 442 FLNPQFQTDVVKPLRIDDIIDQEVQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSE 501
            LN         P  ID ++ +    LSGG+ QRVA+  A      + ++DE  + LD  
Sbjct: 478 LLNL--------PNGIDTLLGRHGVTLSGGQQQRVALARAYLRNTPVLILDESLSALDIM 529

Query: 502 QRIICSKVIRRFILHNKKTAFIVEHDF 528
            R +  + IR +     KT  I+ H++
Sbjct: 530 SRELIVEAIRHW--RKGKTTIILTHEY 554

 Score = 37.4 bits (85), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 33/59 (55%), Gaps = 1/59 (1%)

Query: 222  LSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAAQIIRSLLAPTKYVICVEHD 280
            +SGG+ QR +I  + +++  + + DE +S LD       A++IR++L     VI + H 
Sbjct: 1171 MSGGQAQRLSIARTLLRQPKIIILDECTSALDAANSFAIAELIRTVLKNVT-VIVITHS 1228

 Score = 32.3 bits (72), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 29/55 (52%)

Query: 211 LENVLKRDIEKLSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAAQIIR 265
           ++ +L R    LSGG+ QR A+  + ++   V + DE  S LD+  R    + IR
Sbjct: 485 IDTLLGRHGVTLSGGQQQRVALARAYLRNTPVLILDESLSALDIMSRELIVEAIR 539

>Scas_108.1
          Length = 335

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/131 (25%), Positives = 57/131 (43%), Gaps = 11/131 (8%)

Query: 179 AIKGPVQKVGELLKLRMEKSPEDVKRYIKILQLENVLKRDI-----EKLSGGELQRFAIG 233
           A K P ++V  + K    K+  ++  Y  I  L +     +       +SGGE +R +I 
Sbjct: 1   ACKTPAKRVNNISKAEYVKTTREL--YATIFGLRHTYHTKVGNDFVRGVSGGERKRVSIA 58

Query: 234 MSCVQEADVYMFDEPSSYLDVKQRLNAAQIIR---SLLAPTKYVICVEHDLSVLDYLSDF 290
            + V    VY +D  +  LD    L  A+ IR   +LL  T +V   +   ++ +   D 
Sbjct: 59  EALVANGSVYCWDNATRGLDASTALEYAKAIRIMTNLLESTAFVTIYQASENIYETF-DK 117

Query: 291 VCIIYGVPSVY 301
           V ++Y    +Y
Sbjct: 118 VTVLYDGRQIY 128

 Score = 33.9 bits (76), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 34/62 (54%), Gaps = 4/62 (6%)

Query: 465 VQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHN--KKTAF 522
           V+ +SGGE +RV+I  AL     +Y  D  +  LD+   +  +K IR  I+ N  + TAF
Sbjct: 44  VRGVSGGERKRVSIAEALVANGSVYCWDNATRGLDASTALEYAKAIR--IMTNLLESTAF 101

Query: 523 IV 524
           + 
Sbjct: 102 VT 103

>KLLA0C01991g 160778..162898 similar to sp|P33310 Saccharomyces
           cerevisiae YLR188w MDL1 ATP-binding cassette transporter
           family member, hypothetical start
          Length = 706

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 44/202 (21%), Positives = 89/202 (44%), Gaps = 19/202 (9%)

Query: 99  TPRPGQVLGLVGTNGIGKSTALKILA-----GKQKPNLGRFDDPPEWQEIIKYFRGSELQ 153
           T RPG+ + +VG +G GKST   +L      G  +  LG         + I+ F   + +
Sbjct: 452 TVRPGEHVCIVGPSGGGKSTVASLLLRYYDIGSGEIKLG--------NDNIRDFNLRKYR 503

Query: 154 NYFTKMLEDDIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKSPEDVKRYIKIL--QL 211
                + ++ +  +     +DNI  A+  P + V +  ++       +  +++      L
Sbjct: 504 RLLGVVQQEPM--LFSGTILDNITYAV--PQELVNDETRISRAIGQANCTKFLANFPDGL 559

Query: 212 ENVLKRDIEKLSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAAQIIRSLLAPT 271
           +  +     +LSGG+ QR A+  + + +  + + DE +S LD +     AQ ++   A  
Sbjct: 560 QTTVGPRGTQLSGGQKQRIALARAFLLDPSILILDEATSALDSQSEEVVAQSLQQRSARG 619

Query: 272 KYVICVEHDLSVLDYLSDFVCI 293
           K  I + H +S + + S  + +
Sbjct: 620 KTTISIAHRVSTIQHSSRVIVL 641

 Score = 33.1 bits (74), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 32/59 (54%)

Query: 467 HLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVE 525
            LSGG+ QR+A+  A  +   I ++DE ++ LDS+   + ++ +++     K T  I  
Sbjct: 569 QLSGGQKQRIALARAFLLDPSILILDEATSALDSQSEEVVAQSLQQRSARGKTTISIAH 627

>KLLA0F20075g complement(1868786..1873336) similar to sp|P39109
           Saccharomyces cerevisiae YDR135c YCF1 glutathione
           S-conjugate transporter, vacuolar, start by similarity
          Length = 1516

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 75/338 (22%), Positives = 143/338 (42%), Gaps = 66/338 (19%)

Query: 293 IIYGVPSVYGVVTLP-ASVREGINIFLDGHIPAENL-RFRTEALQFRIADATEDLQNDSA 350
           +++   +++ +++ P A V   I+ F++  +    L  F T           E+LQND+ 
Sbjct: 561 LVFPALTLFNLLSFPLAVVPNAISSFIEASVSINRLFAFLTN----------EELQNDAV 610

Query: 351 SRAFSYPSLKKTQGDFVLNVEEGEF-------------------SDSEILVMMGENGTGK 391
            R    P +K   GD  + V +  F                      E+  ++G+ G+GK
Sbjct: 611 LRE---PKVKNI-GDEGVKVNDATFLWQRKPEYKVALKNINFVAKKGELTCIVGKVGSGK 666

Query: 392 TTLIKLLAGALKPDEG-----QDIPKLNVSMKPQKIAPKFPGTVRQLFFKKIRGQFLNPQ 446
           + LI+ L G L   +G      D+   NVS  P  +     GTV+      + G   +P+
Sbjct: 667 SALIQSLLGDLIRVKGFATVHGDVA--NVSQVPWIM----NGTVKD---NILFGHKYDPE 717

Query: 447 FQTDVVKP--LRID---------DIIDQEVQHLSGGELQRVAIVLALGIPADIYLIDEPS 495
           F    +K   L ID          ++ ++   LSGG+  R+++  A+   AD YL+D+P 
Sbjct: 718 FYQLTIKACALSIDLSMLPDGDQTLVGEKGISLSGGQKARLSLARAVYSRADTYLLDDPL 777

Query: 496 AYLDSE--QRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIVFEG--IPSKNAHA 551
           A +D    + +I   +    +LH+K    ++  + I    +AD + + E   I  + ++ 
Sbjct: 778 AAVDEHVAKHLIEHVLGPHGLLHSKTK--VLATNKITVLSIADSITLMENGEIIQQGSYD 835

Query: 552 RAPESLLTGCNRFLKNLNVTFRRDPNSFRPRINKLDSQ 589
           +  ES  +  ++ +       +  P+     + KL S+
Sbjct: 836 QVNESTNSPLSKLIAEFGKKGKPTPSQSTTSLAKLASE 873

>CAGL0E00385g 31723..33549 similar to sp|P33310 Saccharomyces
           cerevisiae YLR188w MDL1 or sp|P33311 Saccharomyces
           cerevisiae YPL270w MDL2, hypothetical start
          Length = 608

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 48/213 (22%), Positives = 88/213 (41%), Gaps = 28/213 (13%)

Query: 88  SANSFKLHRLPTPRPGQVLGLVGTNGIGKSTALKIL-----AGKQKPNLGRFDDPPEWQE 142
           S  +F++H      PG+ +  VG +G GKST   +L      G    ++G +D       
Sbjct: 383 SEMNFQIH------PGEHVCFVGGSGCGKSTISSLLLRYYRTGSGNISIGNYD------- 429

Query: 143 IIKYFRGSELQNYFTKMLEDDIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKSPEDV 202
            I  F   + +     + ++ +  +     +DNI   +         L  L M     + 
Sbjct: 430 -ISAFNLRKYRRMLGVVQQEPL--LFNGTILDNITYGLHDK-----SLTDLNMALKAANC 481

Query: 203 KRYIK--ILQLENVLKRDIEKLSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNA 260
            ++IK   + L+ ++     +LSGG+ QR A+    +Q  D+ + DE +S LD K     
Sbjct: 482 DQFIKESHMGLDTLVGPRGAQLSGGQRQRIALARVFLQNPDILILDEATSALDTKSEDII 541

Query: 261 AQIIRSLLAPTKYVICVEHDLSVLDYLSDFVCI 293
            + ++         I + H LS + + S  + I
Sbjct: 542 NKELQRRQEAGMTTISIAHRLSTIRHSSRVIVI 574

 Score = 38.1 bits (87), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 43/181 (23%), Positives = 77/181 (42%), Gaps = 21/181 (11%)

Query: 353 AFSYPSLKKTQGDFVLNVEEGEFSDSEILVMMGENGTGKTTLIKLLAGALKPDEGQ-DIP 411
            F+  S   + G  VL+    +    E +  +G +G GK+T+  LL    +   G   I 
Sbjct: 367 TFNNVSFAYSNGKSVLSEMNFQIHPGEHVCFVGGSGCGKSTISSLLLRYYRTGSGNISIG 426

Query: 412 KLNVSMKPQKIAPKFPGTVRQ---LFFKKIRGQF---LNPQFQTDVVKPLR--------- 456
             ++S    +   +  G V+Q   LF   I       L+ +  TD+   L+         
Sbjct: 427 NYDISAFNLRKYRRMLGVVQQEPLLFNGTILDNITYGLHDKSLTDLNMALKAANCDQFIK 486

Query: 457 -----IDDIIDQEVQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIR 511
                +D ++      LSGG+ QR+A+        DI ++DE ++ LD++   I +K ++
Sbjct: 487 ESHMGLDTLVGPRGAQLSGGQRQRIALARVFLQNPDILILDEATSALDTKSEDIINKELQ 546

Query: 512 R 512
           R
Sbjct: 547 R 547

>Kwal_56.22329
          Length = 776

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 48/196 (24%), Positives = 78/196 (39%), Gaps = 25/196 (12%)

Query: 353 AFSYPSLKKTQGDFVLNVEEGEFSDSEILVMMGENGTGKTTLIKLLAGALKPDEGQ-DIP 411
           +FSYP+     G+ + N           + ++G +G GK+T+  LL     P  GQ  I 
Sbjct: 494 SFSYPT---RPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITID 550

Query: 412 KLNVSMKPQKIAPKFPGTVRQ---LFFKKIRGQF---LNPQFQTDVVK------------ 453
             ++S    K   +  G V+Q   L    I+      L  +   D ++            
Sbjct: 551 DQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFV 610

Query: 454 ---PLRIDDIIDQEVQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVI 510
              P   D II      LSGG+ QR+AI  AL     I ++DE ++ LD E     +  +
Sbjct: 611 TKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTL 670

Query: 511 RRFILHNKKTAFIVEH 526
            + +   + T   + H
Sbjct: 671 GKLMKSKELTIISIAH 686

 Score = 33.9 bits (76), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 34/64 (53%), Gaps = 1/64 (1%)

Query: 222 LSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAAQIIRSLLAPTKY-VICVEHD 280
           LSGG+ QR AI  + +++  + + DE +S LDV+        +  L+   +  +I + H 
Sbjct: 628 LSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKELTIISIAHR 687

Query: 281 LSVL 284
           LS +
Sbjct: 688 LSTI 691

>YPL270W (MDL2) [5181] chr16 (30482..32803) Member of the
           ATP-binding cassette (ABC) superfamily of membrane
           transporters, represents a half-sized ABC protein [2322
           bp, 773 aa]
          Length = 773

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 49/173 (28%), Positives = 69/173 (39%), Gaps = 29/173 (16%)

Query: 353 AFSYPSLKKTQGDFVLNVEEGEFSDSEILVMMGENGTGKTTLIKLLAGALKPDEG----- 407
           +FSYP+    Q    LN +    S    + ++G +G GK+T+  LL     P  G     
Sbjct: 452 SFSYPTRPSVQIFKNLNFKIAPGSS---VCIVGPSGRGKSTIALLLLRYYNPTTGTITID 508

Query: 408 -QDIPKLNVSMKPQKIA------PKFPGTVRQLF------------FKKIRGQFLNPQFQ 448
            QDI KLN     + I           GT+R                + +  Q     F 
Sbjct: 509 NQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFI 568

Query: 449 TDVVKPLRIDDIIDQEVQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSE 501
           T    P   D +I      LSGG+ QR+AI  AL     I ++DE ++ LD E
Sbjct: 569 TKF--PNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE 619

 Score = 34.3 bits (77), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 36/67 (53%), Gaps = 7/67 (10%)

Query: 222 LSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQR----LNAAQIIRSLLAPTKYVICV 277
           LSGG+ QR AI  + +++  + + DE +S LDV+          Q+++S    +  ++ +
Sbjct: 586 LSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKS---KSMTIVSI 642

Query: 278 EHDLSVL 284
            H LS +
Sbjct: 643 AHRLSTI 649

>Scas_693.42
          Length = 1512

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 65/132 (49%), Gaps = 15/132 (11%)

Query: 379 EILVMMGENGTGKTTLIKLLAGALKPDEGQDIPKLNVSMKPQKIAPKFPGTVRQLFFKKI 438
           E+  ++G+ G+GK+ +I+ + G L   +G      NV+   Q +A    GTV++     +
Sbjct: 654 ELTCIVGKVGSGKSAMIQSILGDLFRVKGFATIHGNVAYVSQ-VAWIMNGTVKE---NIL 709

Query: 439 RGQFLNPQFQTDVVKP--LRID---------DIIDQEVQHLSGGELQRVAIVLALGIPAD 487
            G   +  F    +K   L ID          ++ ++   LSGG+  R+++  A+   AD
Sbjct: 710 FGHKYDEDFYQKTIKACALTIDLAVLMDGDQTLVGEKGISLSGGQKARLSLARAVYSRAD 769

Query: 488 IYLIDEPSAYLD 499
            YL+D+P A +D
Sbjct: 770 TYLLDDPLAAVD 781

 Score = 31.6 bits (70), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 45/92 (48%), Gaps = 5/92 (5%)

Query: 467  HLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEH 526
            +LS G+ Q + +  AL +P+ I L+DE +A +D E   +  + IR       +T   + H
Sbjct: 1407 NLSVGQRQLLCLARALLVPSKILLLDEATAAVDVETDKVIQETIRTAF--KDRTILTIAH 1464

Query: 527  DFIMATYLADKVIVFEGIPSKNAHARAPESLL 558
              I     +D++IV +    K     +PE LL
Sbjct: 1465 R-INTIMDSDRIIVLDNGTIKEFD--SPEKLL 1493

 Score = 30.4 bits (67), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 39/78 (50%), Gaps = 9/78 (11%)

Query: 222 LSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAAQIIRSLLAP-----TKYVIC 276
           LSGG+  R ++  +    AD Y+ D+P + +D      A  ++  +L P     TK  + 
Sbjct: 750 LSGGQKARLSLARAVYSRADTYLLDDPLAAVDEHV---ARHLVEHVLGPNGLLHTKTKVL 806

Query: 277 VEHDLSVLDYLSDFVCII 294
             + +SVL  ++D V ++
Sbjct: 807 ATNKVSVLS-IADSVSLL 823

>KLLA0B09702g complement(842245..846801) highly similar to sp|Q02785
            Saccharomyces cerevisiae YPL058c PDR12 multidrug
            resistance transporter, start by similarity
          Length = 1518

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 44/193 (22%), Positives = 87/193 (45%), Gaps = 34/193 (17%)

Query: 101  RPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRF---------DDPPEWQEIIKYFRGSE 151
            +PG++  L+G +G GK+T L +LA  Q+ ++G           D P  +     Y   S+
Sbjct: 870  KPGKMTALMGESGAGKTTLLNVLA--QRISVGVITGDMLVNAKDLPLSFNRSCGYVAQSD 927

Query: 152  LQNYFTKMLEDDIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKSPEDVKRYIKILQL 211
                   M E  ++  ++       P+++  P+Q+             + V++ I +L +
Sbjct: 928  -----NHMGELSVRESLRFAAELRQPKSV--PLQE-----------KYDYVEKIISLLGM 969

Query: 212  ENVLKRDIEKLSGG----ELQRFAIGMSCVQEADVYMF-DEPSSYLDVKQRLNAAQIIRS 266
            E   +  I K   G    + ++ +IG+  V +  + +F DEP+S LD +   +  Q +R+
Sbjct: 970  EKYAEAIIGKTGRGLNVEQRKKLSIGVELVAKPSLLLFLDEPTSGLDSQSAWSIVQFMRA 1029

Query: 267  LLAPTKYVICVEH 279
            L    + ++C  H
Sbjct: 1030 LADSGQSILCTIH 1042

 Score = 37.4 bits (85), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 46/186 (24%), Positives = 80/186 (43%), Gaps = 25/186 (13%)

Query: 95  HRLPTPRPGQVLGLVGTNGIGKSTALKILAGKQKPNL---GRFD-DPPEWQEIIKYFRGS 150
           H +     G++L +VG  G G ST LK ++G+    +   G F  D     E+++ F+G 
Sbjct: 167 HCVGVVESGEMLFVVGRPGAGCSTLLKCVSGETSELVEVTGDFSYDGLSQAEMMEKFKGY 226

Query: 151 -----ELQNYFTKMLEDDIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKSPEDVKRY 205
                EL  +F K+    +K  I      +     K P  ++  L + +   +  D+  +
Sbjct: 227 VIYCPELDFHFPKI---TVKETI------DFALKCKTPRVRIDHLSRNQYVDNMRDL--W 275

Query: 206 IKILQLE-----NVLKRDIEKLSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNA 260
             +  L      NV    +  +SGGE +R ++  +    A +Y +D  +  LD    L  
Sbjct: 276 CTVFGLRHTYATNVGNDVVRGVSGGERKRVSLVEALAMSASIYSWDNATRGLDASTALEF 335

Query: 261 AQIIRS 266
           AQ IR+
Sbjct: 336 AQAIRT 341

 Score = 35.4 bits (80), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 29/47 (61%)

Query: 465 VQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIR 511
           V+ +SGGE +RV++V AL + A IY  D  +  LD+   +  ++ IR
Sbjct: 294 VRGVSGGERKRVSLVEALAMSASIYSWDNATRGLDASTALEFAQAIR 340

>KLLA0F08833g 822039..822860 similar to sp|P43569 Saccharomyces
           cerevisiae YFL028c CAF16 ATP-binding cassette
           transporter family member singleton, start by similarity
          Length = 273

 Score = 39.3 bits (90), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 47/188 (25%), Positives = 81/188 (43%), Gaps = 40/188 (21%)

Query: 341 ATEDLQNDSASRAFSYPSLKKTQ-GDFVLNVEEGEFSDSEILVMMGENGTGKTTLIKLLA 399
           A+ DL  +     +++P  K++   D  L+VE     + ++LV+ G NG GK+TL+KLL+
Sbjct: 2   ASNDLAVEVHDLTYAFPGSKRSAIHDLSLSVE----WNKKVLVV-GNNGAGKSTLLKLLS 56

Query: 400 GA---------------LKPDEGQD----IPKLNVSMKPQKIAPKFPGTVR-----QLFF 435
           G                  P+  Q+       L        I  +  G +       L  
Sbjct: 57  GKHLCLGGNIKVGNKNPFAPNNDQESVILTTYLGTEWASMAIVHRDIGVLELLESIGLSH 116

Query: 436 KKIRGQFLNPQFQTDVVKPLRIDDIIDQEVQHLSGGELQRVAIVLALGIPADIYLIDEPS 495
            + RG+        ++V+ L +D  I+  +  LS G+ +RV + + L  P  + L+DE +
Sbjct: 117 YRARGE--------ELVRILEVD--INWRMFKLSDGQKRRVQLCMGLLKPFKVLLLDEVT 166

Query: 496 AYLDSEQR 503
             LD   R
Sbjct: 167 VDLDVVAR 174

 Score = 31.2 bits (69), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 13/20 (65%), Positives = 16/20 (80%)

Query: 108 LVGTNGIGKSTALKILAGKQ 127
           +VG NG GKST LK+L+GK 
Sbjct: 40  VVGNNGAGKSTLLKLLSGKH 59

>Scas_468.1
          Length = 691

 Score = 39.7 bits (91), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 47/175 (26%), Positives = 73/175 (41%), Gaps = 33/175 (18%)

Query: 353 AFSYPSLKKTQ--GDFVLNVEEGEFSDSEILVMMGENGTGKTTLIKLLAGALKPD----- 405
           +FSYP+  + Q   +    +E G       + ++G +G GK+T+  LL     P      
Sbjct: 396 SFSYPTRPQNQIFKNLNFKIEPGSN-----VCIVGPSGKGKSTIALLLLHYYNPTSGQIL 450

Query: 406 -EGQDIPKLNVSMKPQKIA------PKFPGTVRQLF------------FKKIRGQFLNPQ 446
            +GQDI K+N     +K+           G++R                +K+  Q     
Sbjct: 451 IDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHN 510

Query: 447 FQTDVVKPLRIDDIIDQEVQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSE 501
           F T    P   D  I      LSGG+ QR+AI  AL    +I ++DE ++ LD E
Sbjct: 511 FITKF--PHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVE 563

 Score = 35.4 bits (80), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 35/65 (53%), Gaps = 3/65 (4%)

Query: 222 LSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAAQIIRSLLAPTK--YVICVEH 279
           LSGG+ QR AI  + +++ ++ + DE +S LDV+    A       L  TK   ++ + H
Sbjct: 530 LSGGQKQRIAIARALIKKPNILILDEATSALDVESE-GAINYTFGQLMKTKSMTIVSIAH 588

Query: 280 DLSVL 284
            LS +
Sbjct: 589 RLSTI 593

>KLLA0D03476g 296287..300969 similar to sp|P33302 Saccharomyces
            cerevisiae YOR153w PDR5 pleiotropic drug resistance
            protein, start by similarity
          Length = 1560

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 45/198 (22%), Positives = 85/198 (42%), Gaps = 34/198 (17%)

Query: 101  RPGQVLGLVGTNGIGKSTALKILAGKQKPNL--------GRFDDPPEWQEIIKYFRGSEL 152
            +PG +  L+G++G GK+T L  LA +    +        GR  D   +Q    Y +  +L
Sbjct: 921  KPGTLTALMGSSGAGKTTLLDALADRISTGVITGDVLVNGRPTDA-SFQRSTGYCQQQDL 979

Query: 153  QNYFTKMLED-DIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKSPEDVKRYIKILQL 211
                  + E     A ++  Y  N+ +                 ++  E V+  I++L++
Sbjct: 980  HGRTQTVREALTFSAYLRQPY--NVSK-----------------KEKDEYVETIIRLLEM 1020

Query: 212  ENVLKRDI----EKLSGGELQRFAIGMSCVQEADVYMF-DEPSSYLDVKQRLNAAQIIRS 266
            E      +    E L+  + +R  IG+  V +  + +F DEP+S LD +   +  Q++R 
Sbjct: 1021 ETYADALVGVTGEGLNVEQRKRLTIGVELVAKPKLLLFLDEPTSGLDSQTAWSVCQLMRK 1080

Query: 267  LLAPTKYVICVEHDLSVL 284
            L    + ++C  H  S +
Sbjct: 1081 LANHGQAILCTIHQPSAI 1098

>ABR125C [717] [Homologous to ScYDR011W (SNQ2 ) - NSH; ScYNR070W -
           NSH] (623887..628353) [4467 bp, 1488 aa]
          Length = 1488

 Score = 39.7 bits (91), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 49/217 (22%), Positives = 90/217 (41%), Gaps = 20/217 (9%)

Query: 101 RPGQVLGLVGTNGIGKSTALKILAGKQK-----PNLGRFDDPPEWQEIIKYFRGSELQNY 155
           RPG+++ ++G  G G ++ LK +AG+            +D  P+ +E+++ +R   + N 
Sbjct: 186 RPGEMVLVLGRPGAGCTSLLKTVAGETDQFHSVEGAISYDGIPQ-REMMRRYRAEVVYN- 243

Query: 156 FTKMLEDDIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKSPEDVKRYIKILQLENVL 215
               ++     +   Q +D    A K P  +V  +   R E      + Y  +  L +  
Sbjct: 244 --SEIDVHFPHLTVKQTLD-FALACKTPHMRVNNVS--RAEYITLMRELYATVFGLRHTY 298

Query: 216 KRD-----IEKLSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAAQIIR---SL 267
                   I  +SGGE +R +I  +    A VY +D  +  LD    L  AQ +R   +L
Sbjct: 299 DTKVGNDYIRGVSGGERKRVSIAEALAANASVYCWDNATRGLDASTALEYAQAMRIMTNL 358

Query: 268 LAPTKYVICVEHDLSVLDYLSDFVCIIYGVPSVYGVV 304
           L  T  V   +   ++ +     + +  G    +G V
Sbjct: 359 LQSTSLVTLYQASENIYETFDKVLVLFEGRQIYFGDV 395

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 44/83 (53%), Gaps = 6/83 (7%)

Query: 465 VQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIV 524
           ++ +SGGE +RV+I  AL   A +Y  D  +  LD+   +  ++ +R      + T+ + 
Sbjct: 307 IRGVSGGERKRVSIAEALAANASVYCWDNATRGLDASTALEYAQAMRIMTNLLQSTSLVT 366

Query: 525 EH---DFIMATYLADKVIV-FEG 543
            +   + I  T+  DKV+V FEG
Sbjct: 367 LYQASENIYETF--DKVLVLFEG 387

>Scas_40.1
          Length = 203

 Score = 38.1 bits (87), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 50/201 (24%), Positives = 86/201 (42%), Gaps = 43/201 (21%)

Query: 69  AIQIINL---PTNLEAHVTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTALKILAG 125
           A+Q+ NL    T     + H  S +      LP+   G ++ +VG +G GK+T L +LA 
Sbjct: 19  AVQVRNLSIIATKSNKTIVHDVSMD------LPS---GSIMAIVGGSGSGKTTLLNVLAS 69

Query: 126 KQKPNL---GRFDDPPEWQEIIKYFRGSELQNYFTKMLEDDIKAIIKPQYVDNIPRAIKG 182
           K    L   G ++   +         GS  Q+  T        A +  Q V +    ++ 
Sbjct: 70  KISRGLKMEGSYEFVADG--------GSRQQDITT--------AYLAQQDVSSPKLTVRE 113

Query: 183 PVQKVGELLKLRMEKSPEDVKRYIKILQLENVLKR-------DIEK--LSGGELQRFAIG 233
            +    +L   +++   ++ +R ++ L  E  LK        D E   LSGGE +R +IG
Sbjct: 114 TLSYAADL---KLKAPRQERRRLVEELIAELGLKECSDTRVGDSEHRGLSGGEKRRLSIG 170

Query: 234 MSCVQEADVYMFDEPSSYLDV 254
           +  +    +   DEP++ LD 
Sbjct: 171 VQMISNPSLLFLDEPTTGLDA 191

>KLLA0C14234g 1234598..1238962 similar to sp|P53049 Saccharomyces
           cerevisiae YGR281w YOR1 ATP-binding cassette transporter
           protein, start by similarity
          Length = 1454

 Score = 39.3 bits (90), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 57/240 (23%), Positives = 106/240 (44%), Gaps = 43/240 (17%)

Query: 338 IADATEDLQNDSASRAFSYPSLKKTQGDFVLNVEEGEFSDSEILVMMGENGTGKTTLIKL 397
           I+D     + + AS        +   G    +V+E EF     +++ G  GTGK++L+  
Sbjct: 568 ISDKVSTTETEKASSEIEQTPFRGFHG-LNFDVKENEF-----IIITGPIGTGKSSLLNA 621

Query: 398 LAGALKPDEGQDIPKLNVSMKPQKIAPKFP----GTVR-QLFFKKIRGQFLNPQFQTDV- 451
           LAG ++   G      ++++K   +   +P     TV+  + F      F  P++Q  + 
Sbjct: 622 LAGFMRRSSG------SMTIKGDLLLCGYPWVQNATVKDNILFG---SPFDKPKYQKVIE 672

Query: 452 VKPLRID-DI--------IDQEVQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQ 502
           +  L+ D DI        I +    LSGG+  R+A+  ++    DIYL D+  + +DS  
Sbjct: 673 ICSLQADLDILPAGDRTEIGERGITLSGGQKARIALARSVYKDMDIYLFDDVLSAVDSR- 731

Query: 503 RIICSKVIRRFILHNKKTAFIVEHDFIMATY---LADKV--IVFEGIPSKNAHARAPESL 557
             +C  ++   ++      ++ +   I+AT+   L DK   ++F G+         PE L
Sbjct: 732 --VCKHIVDECMM-----GYLKQKTRILATHQLSLIDKASRVIFLGLDGSFDIGTVPELL 784

 Score = 35.0 bits (79), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 29/127 (22%), Positives = 55/127 (43%), Gaps = 16/127 (12%)

Query: 222 LSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAAQIIRSLLAPTKYVICVEHDL 281
           LSGG+  R A+  S  ++ D+Y+FD+  S +D +   +            K  I   H L
Sbjct: 698 LSGGQKARIALARSVYKDMDIYLFDDVLSAVDSRVCKHIVDECMMGYLKQKTRILATHQL 757

Query: 282 SVLDYLSDFVCIIYGVPSVYGVVTLPASVREGINIFLDGHIPAENLRFRTEALQFRIADA 341
           S++D  S    I  G+   + + T+P  ++                   ++ +QF+ +  
Sbjct: 758 SLIDKASR--VIFLGLDGSFDIGTVPELLKRNTGF--------------SDLMQFQNSAP 801

Query: 342 TEDLQND 348
            E+L++D
Sbjct: 802 AEELEDD 808

>Kwal_56.23844
          Length = 1494

 Score = 38.9 bits (89), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 47/185 (25%), Positives = 84/185 (45%), Gaps = 33/185 (17%)

Query: 343 EDLQNDSASRAFSYPSLKKTQGDFVLNV-EEGEF-------------------SDSEILV 382
           E+LQ DS  R    P + KT G+  +NV  +  F                      E+  
Sbjct: 590 EELQRDSVQRK---PKVTKT-GEVAINVGADATFLWQRKPEYKVALKNINFQAKKGELTC 645

Query: 383 MMGENGTGKTTLIKLLAGALKPDEGQDIPKLNVSMKPQKIAPKFPGTVRQ--LFFKKIRG 440
           ++G+ G+GK+ LI+ + G L   +G      +++   Q +     GTV++  LF  K   
Sbjct: 646 IVGKVGSGKSALIQGILGDLFRVKGFASVHGSIAYVSQ-VPWIMNGTVKENILFGHKYDA 704

Query: 441 QFLNPQFQT-----DV-VKPLRIDDIIDQEVQHLSGGELQRVAIVLALGIPADIYLIDEP 494
            F +   +      D+ + P   + ++ ++   LSGG+  R+++  A+   AD YL+D+P
Sbjct: 705 DFYDTTLRACALAVDLSILPKGDETLVGEKGISLSGGQKARISLARAVYARADTYLLDDP 764

Query: 495 SAYLD 499
            A +D
Sbjct: 765 LAAVD 769

 Score = 38.1 bits (87), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 54/237 (22%), Positives = 103/237 (43%), Gaps = 26/237 (10%)

Query: 343  EDLQNDSASRAFSYPSLKKTQGDFVLNVEEGEFSDSEILVMMGENGTGKTTLIKLLAGAL 402
            ED     A +  +Y +  + + D  L     +    E + ++G  G GK++L   L   +
Sbjct: 1244 EDWPTHGAIKFENYSARYRPELDLSLRNINIDIKPQERIGIVGRTGAGKSSLTLALFRII 1303

Query: 403  KPDEGQ----DIPKLNVSMKPQK----IAPK----FPGTVRQ------LFFKKIRGQFLN 444
            +  EG+     +P  ++ ++  +    I P+    F GTVR+       +  +     L 
Sbjct: 1304 EAAEGRIIIDGVPTDSIGLRDLRHHLSIIPQDSQVFEGTVRENIDPTNEYTDEEIWHALE 1363

Query: 445  PQFQTDVVKPL---RIDDIIDQEVQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSE 501
                 D +K L    ++ ++ +   +LS G+ Q + +  AL IP  I ++DE +A +D E
Sbjct: 1364 LAHLKDHIKSLGKDELESMLTEGGGNLSVGQRQLMCLARALLIPTRILVLDEATAAVDVE 1423

Query: 502  QRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIVFEGIPSKNAHARAPESLL 558
               +  + IR       +T   + H  I     +D+++V +    K A   +PE+LL
Sbjct: 1424 TDQVIQETIR--TAFKNRTILTIAHR-INTILDSDRILVLD--SGKIAEFDSPEALL 1475

>CAGL0C03289g 328799..333745 similar to sp|P32386 Saccharomyces
           cerevisiae YLL048c YBT1 yeast bile transporter,
           hypothetical start
          Length = 1648

 Score = 38.9 bits (89), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 54/201 (26%), Positives = 91/201 (45%), Gaps = 25/201 (12%)

Query: 366 FVLNVEEGEFSDSEILVMMGENGTGKTTLIKLLAGALKPDEGQDI-PKLNVSMKPQKIAP 424
           FVL   + EF   ++ V++G  G+GKT+++  L G ++  EG+ I P L+   + Q  A 
Sbjct: 722 FVLRNLDIEFMTGKLNVIVGATGSGKTSILMGLLGEMQLSEGKIIVPSLSPRHEYQSQAG 781

Query: 425 ------KFPGTVRQLFFKKIRGQFL-NPQF---QTDVV----------KPLRIDDI--ID 462
                  +      L    +R   L N  F   + D V          + L+  D   I 
Sbjct: 782 VINDSIAYCSQAAWLLNDTVRNNILFNAPFDQARYDAVVEACSLKRDFQILKAGDSTEIG 841

Query: 463 QEVQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRI-ICSKVIRRFILHNKKTA 521
           ++   LSGG+ QRV++  AL   A   L+D+  + +DS   + I  K I   ++   +T 
Sbjct: 842 EKGITLSGGQKQRVSLARALYSSAGHLLLDDCLSAVDSHTALWIYDKCISGPLMEG-RTC 900

Query: 522 FIVEHDFIMATYLADKVIVFE 542
            +V H+  +    AD V++ E
Sbjct: 901 ILVTHNIALTMKNADFVVMIE 921

 Score = 30.4 bits (67), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 47/209 (22%), Positives = 77/209 (36%), Gaps = 35/209 (16%)

Query: 99   TPRPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTK 158
            T  P + +G+VG  G GKST +  L    + + G                G  + N   K
Sbjct: 1395 TIEPLEKVGIVGRTGAGKSTIITALFRFLEADTGSIK-----------LDGVNIANIDLK 1443

Query: 159  MLEDDIKAIIKPQ---------------YVDNIPRAIKGPVQKVGELLKLRMEKSPEDV- 202
             L   I  I  PQ               Y +     I   +++V  +    ME S  ++ 
Sbjct: 1444 RLRRSITII--PQDPTLFAGSIRSNLDPYDEYSDEEIFTALKRVNLVSTEEMEASTSEIQ 1501

Query: 203  ----KRYIKILQLENVLKRDIEKLSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRL 258
                K   K L LE+ +       S G+ Q   +  S ++   V + DE ++ +D     
Sbjct: 1502 SNSSKNVNKFLNLESEIAEGGSNFSQGQRQLMCLARSLLRMPKVILLDEATASIDYNSDA 1561

Query: 259  NAAQIIRSLLAPTKYVICVEHDL-SVLDY 286
               + IR     +  V+ + H L S++DY
Sbjct: 1562 KIQETIRQEFNNST-VLTIAHRLRSIVDY 1589

>Sklu_2343.3 YPL270W, Contig c2343 2058-4382
          Length = 774

 Score = 38.5 bits (88), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 45/176 (25%), Positives = 71/176 (40%), Gaps = 35/176 (19%)

Query: 353 AFSYPSLKKTQGDFVLNVEEGEFSDSEILVMMGENGTGKTTLIKLLAGALKPD------E 406
           +FSYP+    Q   + N           + ++G +G GK+T+  LL     P       +
Sbjct: 479 SFSYPTRSANQ---IFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITID 535

Query: 407 GQDIPKLNVSMKPQKIAPKFPGTVRQ---LFFKKIRGQFLNPQFQTDVVKPLR------- 456
           GQDI K++      K   +  G V+Q   L    IR         T  +  +R       
Sbjct: 536 GQDISKISA-----KSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCF 590

Query: 457 -----------IDDIIDQEVQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSE 501
                       + +I  +   LSGG+ QR+AI  AL    +I ++DE ++ LD E
Sbjct: 591 CHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVE 646

 Score = 34.7 bits (78), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 34/64 (53%), Gaps = 1/64 (1%)

Query: 222 LSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAAQIIRSLLAPTK-YVICVEHD 280
           LSGG+ QR AI  + +++ ++ + DE +S LDV+        +  L+      +I + H 
Sbjct: 613 LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRDITIISIAHR 672

Query: 281 LSVL 284
           LS +
Sbjct: 673 LSTI 676

>YFL028C (CAF16) [1655] chr6 complement(79342..80211) Protein that
           associates with Ccr4p, member of the non-transporter
           group of the ATP-binding cassette (ABC) superfamily [870
           bp, 289 aa]
          Length = 289

 Score = 37.7 bits (86), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 60/241 (24%), Positives = 103/241 (42%), Gaps = 46/241 (19%)

Query: 108 LVGTNGIGKSTALKILAGKQ---------------KP-NLGRFDDPPEWQEIIKYFRGSE 151
           +VG NG GKST LK+L+GK                 P ++ + DD    ++   Y   + 
Sbjct: 39  VVGANGAGKSTLLKLLSGKHLCLDGKILVNGLDPFSPLSMNQVDDDESVEDSTNYQTTTY 98

Query: 152 LQNYFTKMLEDDIKAIIKPQYVDNIPRAIKGPVQKVGELLK-LRMEKSPEDVKRYIKILQ 210
           L   +  M      +II         R I      V ELLK +  +   E  +R ++IL 
Sbjct: 99  LGTEWCHM------SIIN--------RDI-----GVLELLKSIGFDHFRERGERLVRILD 139

Query: 211 LENVLKRDIEKLSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAAQIIRSLLAP 270
           ++  ++  + +LS G+ +R  + M  ++   V + DE +  LDV  R   A+++  L   
Sbjct: 140 ID--VRWRMHRLSDGQKRRVQLAMGLLKPWRVLLLDEVTVDLDVIAR---ARLLEFLKWE 194

Query: 271 TKYVIC-VEHDLSVLDYLSDFVCIIYGVPSVYGVVTL----PASVREGINIFLDGHIPAE 325
           T+   C V +   + D L+ +   +Y + S   V  L         E +N  ++G +  E
Sbjct: 195 TETRRCSVVYATHIFDGLAKWPNQVYHMKSGKIVDNLDYQKDVEFSEVVNAKVNGQVAFE 254

Query: 326 N 326
           N
Sbjct: 255 N 255

>KLLA0A00286g complement(22024..25866) similar to sp|P47037
            Saccharomyces cerevisiae YJL074c SMC3 required for
            structural maintenance of chromosomes, start by
            similarity
          Length = 1280

 Score = 38.1 bits (87), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 28/53 (52%), Gaps = 4/53 (7%)

Query: 465  VQHLSGGELQRVAIVLALGI----PADIYLIDEPSAYLDSEQRIICSKVIRRF 513
            V+ LSGG+    AI L L I    PA  YL DE  A LD + RI  ++ I+  
Sbjct: 1173 VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRIAVARTIKNL 1225

>YLR188W (MDL1) [3591] chr12 (528302..530389) Member of the
           ATP-binding cassette (ABC) superfamily, equivalent to a
           "half-sized" ABC protein with one ATP-binding domain and
           one transmembrane domain, involved in release of
           peptides from mitochondria [2088 bp, 695 aa]
          Length = 695

 Score = 38.1 bits (87), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 55/231 (23%), Positives = 94/231 (40%), Gaps = 36/231 (15%)

Query: 99  TPRPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPE---------WQEIIKYFRG 149
           T +PG+ +  VG +G GKST   +L      N G  +   E         ++ +I Y + 
Sbjct: 456 TIKPGEHVCAVGPSGSGKSTIASLLLRYYDVNSGSIEFGDEDIRNFNLRKYRRLIGYVQQ 515

Query: 150 SELQNYFTKMLEDDIKAIIKPQYV---DNIPRAI-KGPVQKVGELLKLRMEKSPEDVKRY 205
             L   F   + D+I   I P+     D I RAI K    K        +   P+     
Sbjct: 516 EPL--LFNGTILDNILYCIPPEIAEQDDRIRRAIGKANCTKF-------LANFPDG---- 562

Query: 206 IKILQLENVLKRDIEKLSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAAQIIR 265
                L+ ++     +LSGG+ QR A+  + + +  V + DE +S LD +     A+ ++
Sbjct: 563 -----LQTMVGARGAQLSGGQKQRIALARAFLLDPAVLILDEATSALDSQSEEIVAKNLQ 617

Query: 266 SLLAPTKYVICVEHDLSVLDYLSDFVCIIYGVPSVYGVVTLPASVREGINI 316
             +      I + H LS + + +  + +       +G V    S R+ I I
Sbjct: 618 RRVERGFTTISIAHRLSTIKHSTRVIVL-----GKHGSVVETGSFRDLIAI 663

 Score = 37.0 bits (84), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 47/191 (24%), Positives = 83/191 (43%), Gaps = 41/191 (21%)

Query: 353 AFSYPSLKKTQ--GDFVLNVEEGEFSDSEILVMMGENGTGKTTLIKLLAGALKPDEG--- 407
           +F+YP+  K Q   D  + ++ GE      +  +G +G+GK+T+  LL      + G   
Sbjct: 438 SFTYPTRPKHQIFKDLNITIKPGEH-----VCAVGPSGSGKSTIASLLLRYYDVNSGSIE 492

Query: 408 ---QDIPKLNVSMKPQKIAPKFPGTVRQ---LFFKKIRGQFLN---PQF--QTDVVK--- 453
              +DI   N+    + I     G V+Q   LF   I    L    P+   Q D ++   
Sbjct: 493 FGDEDIRNFNLRKYRRLI-----GYVQQEPLLFNGTILDNILYCIPPEIAEQDDRIRRAI 547

Query: 454 ------------PLRIDDIIDQEVQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSE 501
                       P  +  ++      LSGG+ QR+A+  A  +   + ++DE ++ LDS+
Sbjct: 548 GKANCTKFLANFPDGLQTMVGARGAQLSGGQKQRIALARAFLLDPAVLILDEATSALDSQ 607

Query: 502 QRIICSKVIRR 512
              I +K ++R
Sbjct: 608 SEEIVAKNLQR 618

>Kwal_27.9666
          Length = 1474

 Score = 37.7 bits (86), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 45/193 (23%), Positives = 83/193 (43%), Gaps = 24/193 (12%)

Query: 101  RPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRFD-------DPPEWQEIIKYFRGSELQ 153
            +PG +  L+G +G GK+T L  LA +    +   D           +   I Y +  +L 
Sbjct: 854  KPGTLTALMGASGAGKTTLLDCLASRVTTGVVTGDILINGNKRDASFARSIGYCQQQDL- 912

Query: 154  NYFTKMLEDDIKAIIKPQYVDNIPRAIKGPVQKVGELLK-LRMEKSPEDVKRYIKILQLE 212
            +  T  + + ++     +   ++P + K   + V E++K L MEK  + V          
Sbjct: 913  HLQTATVRESLRFAAHLRQPQSVPSSEKD--KYVDEVIKILEMEKYADAV---------- 960

Query: 213  NVLKRDIEKLSGGELQRFAIGMSCVQEADVYMF-DEPSSYLDVKQRLNAAQIIRSLLAPT 271
              +    E L+  + +R  IG+       + +F DEP+S LD +   +  Q++R L    
Sbjct: 961  --VGVAGEGLNVEQRKRLTIGVELAARPKLLLFLDEPTSGLDSQTAWSICQLMRKLANHG 1018

Query: 272  KYVICVEHDLSVL 284
            + ++C  H  S L
Sbjct: 1019 QAILCTIHQPSAL 1031

>YDR135C (YCF1) [981] chr4 complement(722998..727545) Vacuolar
           glutathione S-conjugate transporter, member of the
           ATP-binding cassette (ABC) superfamily [4548 bp, 1515
           aa]
          Length = 1515

 Score = 37.7 bits (86), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 34/128 (26%), Positives = 62/128 (48%), Gaps = 15/128 (11%)

Query: 383 MMGENGTGKTTLIKLLAGALKPDEGQDIPKLNVSMKPQKIAPKFPGTVRQLFFKKIRGQF 442
           ++G+ G+GKT L+  + G L   +G      +V+   Q +     GTV++     + G  
Sbjct: 661 IVGKVGSGKTALLSCMLGDLFRVKGFATVHGSVAYVSQ-VPWIMNGTVKE---NILFGHR 716

Query: 443 LNPQFQTDVVKP--LRID---------DIIDQEVQHLSGGELQRVAIVLALGIPADIYLI 491
            + +F    +K   L ID          ++ ++   LSGG+  R+++  A+   AD YL+
Sbjct: 717 YDAEFYEKTIKACALTIDLAILMDGDKTLVGEKGISLSGGQKARLSLARAVYARADTYLL 776

Query: 492 DEPSAYLD 499
           D+P A +D
Sbjct: 777 DDPLAAVD 784

 Score = 32.0 bits (71), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 53/229 (23%), Positives = 99/229 (43%), Gaps = 32/229 (13%)

Query: 355  SYPSLKKTQGDFVLNVEEGEFSDSEILVMMGENGTGKTTLIKLLAGALKPDEGQ---DIP 411
            +Y +  + + D VL         +E + ++G  G GK++L   L   ++  EG    D  
Sbjct: 1276 NYSTRYRPELDLVLKHINIHIKPNEKVGIVGRTGAGKSSLTLALFRMIEASEGNIVIDNI 1335

Query: 412  KLN----------VSMKPQKIAPKFPGTVRQ------LFFKKIRGQFLNPQFQTDVVKPL 455
             +N          +S+ PQ  +  F GTVR+       +  +   + L      + V  +
Sbjct: 1336 AINEIGLYDLRHKLSIIPQD-SQVFEGTVRENIDPINQYTDEAIWRALELSHLKEHVLSM 1394

Query: 456  RIDDIIDQEVQ---HLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRR 512
              D +  Q  +   +LS G+ Q + +  A+ +P+ I ++DE +A +D E   +  + IR 
Sbjct: 1395 SNDGLDAQLTEGGGNLSVGQRQLLCLARAMLVPSKILVLDEATAAVDVETDKVVQETIRT 1454

Query: 513  FILHNKKTAFIVEH--DFIMATYLADKVIVFEGIPSKNAHARAPESLLT 559
                  +T   + H  + IM +   D++IV +    K A   +P  LL+
Sbjct: 1455 --AFKDRTILTIAHRLNTIMDS---DRIIVLDN--GKVAEFDSPGQLLS 1496

 Score = 30.0 bits (66), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 25/49 (51%), Gaps = 3/49 (6%)

Query: 222 LSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAAQIIRSLLAP 270
           LSGG+  R ++  +    AD Y+ D+P + +D      A  +I  +L P
Sbjct: 753 LSGGQKARLSLARAVYARADTYLLDDPLAAVDEHV---ARHLIEHVLGP 798

>KLLA0F21692g complement(2014152..2018729)
            gi|14571818|gb|AAK67294.1|AF245358_1 Kluyveromyces lactis
            multidrug pump KlPDR5, start by similarity
          Length = 1525

 Score = 37.7 bits (86), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 51/228 (22%), Positives = 99/228 (43%), Gaps = 27/228 (11%)

Query: 101  RPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKML 160
            +PG +  L+G++G GK+T L  LA +    +   D          +  G    N F + +
Sbjct: 887  KPGTLTALMGSSGAGKTTLLDCLASRVTMGVITGD---------MFVNGHLRDNSFPRSI 937

Query: 161  EDDIKAIIKPQYVDNIPRAIKGPVQKVGELLK---LRMEKSPEDVKRYIKILQLEN---- 213
                    + Q +      ++  ++    L +   + +E+    V+  I IL+++     
Sbjct: 938  -----GYCQQQDLHLSTSTVRESLRFSAYLRQPSSVSIEEKNNYVEDVINILEMQQYADA 992

Query: 214  VLKRDIEKLSGGELQRFAIGMSCVQEADVYMF-DEPSSYLDVKQRLNAAQIIRSLLAPTK 272
            V+    E L+  + +R  IG+    +  + +F DEP+S LD +   +  Q++R L    +
Sbjct: 993  VVGVAGEGLNVEQRKRLTIGVELAAKPKLLLFLDEPTSGLDSQTAWSVCQLMRKLADHGQ 1052

Query: 273  YVICVEHDLSVLDYLSDFVCIIY---GVPSVYGVVTLPASVREGINIF 317
             ++C  H  S L  + +F  +++   G  +VY    L    +E IN F
Sbjct: 1053 AILCTIHQPSAL-LMQEFDILLFLQKGGKTVY-FGNLGEGCQEMINYF 1098

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 39/178 (21%), Positives = 74/178 (41%), Gaps = 29/178 (16%)

Query: 367  VLNVEEGEFSDSEILVMMGENGTGKTTLIKLLA-----GALKPD-------EGQDIPK-- 412
            +L+  +G      +  +MG +G GKTTL+  LA     G +  D            P+  
Sbjct: 878  ILSNVDGWVKPGTLTALMGSSGAGKTTLLDCLASRVTMGVITGDMFVNGHLRDNSFPRSI 937

Query: 413  -------LNVSMKPQKIAPKFPGTVRQLFFKKIRGQFLNPQFQTDVVKPLRIDDIIDQEV 465
                   L++S    + + +F   +RQ     I  +     +  DV+  L +    D  V
Sbjct: 938  GYCQQQDLHLSTSTVRESLRFSAYLRQPSSVSIEEK---NNYVEDVINILEMQQYADAVV 994

Query: 466  ----QHLSGGELQRVAIVLALGI-PADIYLIDEPSAYLDSEQRIICSKVIRRFILHNK 518
                + L+  + +R+ I + L   P  +  +DEP++ LDS+      +++R+   H +
Sbjct: 995  GVAGEGLNVEQRKRLTIGVELAAKPKLLLFLDEPTSGLDSQTAWSVCQLMRKLADHGQ 1052

>YLL015W (BPT1) [3404] chr12 (116431..121110) Membrane transporter
           of the ATP-binding cassette (ABC) superfamily, mediates
           transport of glutathione conjugates into the vacuole
           [4680 bp, 1559 aa]
          Length = 1559

 Score = 37.4 bits (85), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 45/179 (25%), Positives = 83/179 (46%), Gaps = 20/179 (11%)

Query: 369 NVEEGEFSDSEILVMMGENGTGKTTLIKLLAGALKPDEGQDI---PKLNVSMKPQKIAPK 425
           N++  E    +++ ++G  G GK+T +K + G L    G      PKL +         +
Sbjct: 656 NIDHFEAKRGDLVCVVGRVGAGKSTFLKAILGQLPCMSGSRDSIPPKLIIRSSSVAYCSQ 715

Query: 426 ----FPGTVRQ--LFFKKIRGQFLNPQFQTDVVKP-LRI-----DDIIDQEVQHLSGGEL 473
                  +VR+  LF  K    + +   +   + P L+I     + ++ ++   LSGG+ 
Sbjct: 716 ESWIMNASVRENILFGHKFDQDYYDLTIKACQLLPDLKILPDGDETLVGEKGISLSGGQK 775

Query: 474 QRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMAT 532
            R+++  A+   ADIYL+D+  + +D+E     SK I  ++L   KTA +     I+ T
Sbjct: 776 ARLSLARAVYSRADIYLLDDILSAVDAE----VSKNIIEYVLIG-KTALLKNKTIILTT 829

 Score = 32.3 bits (72), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 17/68 (25%), Positives = 35/68 (51%), Gaps = 3/68 (4%)

Query: 222 LSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAAQII---RSLLAPTKYVICVE 278
           LSGG+  R ++  +    AD+Y+ D+  S +D +   N  + +   ++ L   K +I   
Sbjct: 770 LSGGQKARLSLARAVYSRADIYLLDDILSAVDAEVSKNIIEYVLIGKTALLKNKTIILTT 829

Query: 279 HDLSVLDY 286
           + +S+L +
Sbjct: 830 NTVSILKH 837

 Score = 30.0 bits (66), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 55/226 (24%), Positives = 93/226 (41%), Gaps = 42/226 (18%)

Query: 355  SYPSLKKTQGDFVLNVEEGEFSDSEILVMMGENGTGKTTLIKLLAGALKPDEGQDIP--- 411
            +Y +  +   D VLN    +    E + ++G  G GK+TL   L   L+P EG+ I    
Sbjct: 1306 NYSTKYRENLDPVLNNINVKIEPCEKVGIVGRTGAGKSTLSLALFRILEPTEGKIIIDGI 1365

Query: 412  ----------KLNVSMKPQKIAPKFPGTVRQLF--FKKIRGQFLNPQFQTDVVKPL---- 455
                      + ++++ PQ  A  F GTV+     F +     L    +   +KP     
Sbjct: 1366 DISDIGLFDLRSHLAIIPQD-AQAFEGTVKTNLDPFNRYSEDELKRAVEQAHLKPHLEKM 1424

Query: 456  ---------------RIDDIIDQEVQ----HLSGGELQRVAIVLALGIPADIYLIDEPSA 496
                            ++DI+D ++     +LS G+ Q + +  AL   + I ++DE +A
Sbjct: 1425 LHSKPRGDDSNEEDGNVNDILDVKINENGSNLSVGQRQLLCLARALLNRSKILVLDEATA 1484

Query: 497  YLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIVFE 542
             +D E   I    IRR      +T   + H  I     +DK+IV +
Sbjct: 1485 SVDMETDKIIQDTIRR--EFKDRTILTIAHR-IDTVLDSDKIIVLD 1527

>Scas_622.9
          Length = 1657

 Score = 37.4 bits (85), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 49/207 (23%), Positives = 89/207 (42%), Gaps = 33/207 (15%)

Query: 365 DFVLNVEEGEFSDSEILVMMGENGTGKTTLIKLLAGALKPDEGQDI-PKLNVSMKPQK-- 421
           DF L     EF    + V++G  G+GKT+L+  L G +  ++G+ I P LN    P++  
Sbjct: 726 DFKLRDLNIEFKPGALNVVIGPTGSGKTSLLLALLGEMCLEKGEIIVPALN----PRQDL 781

Query: 422 IAPKFPGTVRQLFFKKIRGQFLNPQFQTDV-----------------------VKPLRID 458
           +  KF G    + +       LN   + ++                       +K L+  
Sbjct: 782 VIDKF-GLTNSIAYCSQAAWLLNETVRNNILFNSPYNEERYNAVIDACGLRRDLKILKAS 840

Query: 459 DI--IDQEVQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILH 516
           D+  I ++   LSGG+ QRV++  AL   +   L+D+  + +DS   +          L 
Sbjct: 841 DMTEIGEKGITLSGGQKQRVSLARALYSNSKHVLLDDCLSAVDSHTALWIYDNCITGPLM 900

Query: 517 NKKTAFIVEHDFIMATYLADKVIVFEG 543
           + +T  +V H+  +    A+ V++ E 
Sbjct: 901 SGRTCILVSHNIALTLKNAELVVILEN 927

 Score = 33.1 bits (74), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 45/197 (22%), Positives = 83/197 (42%), Gaps = 19/197 (9%)

Query: 102  PGQVLGLVGTNGIGKSTALKILAGKQKPNLG--RFDDPPEWQEIIKYFRGSELQNYFTKM 159
            P   +G+VG  G GKST +  +     P  G  + DD       I     ++L+   T +
Sbjct: 1412 PKTKIGIVGRTGAGKSTIITAMFRFLNPESGYIKIDDVN-----IASINLTKLRRSITII 1466

Query: 160  LED------DIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKSPEDV---KRYIKILQ 210
             +D       IK  + P Y +    AI   +++V  + +  ++ +       +   K L 
Sbjct: 1467 PQDPTLFTGTIKLNLDP-YNEFTDDAIFEALKRVNLVTEEELQNNGTQTGTSENANKFLN 1525

Query: 211  LENVLKRDIEKLSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAAQIIRSLLAP 270
            LEN +      LS G+ Q   +  S ++   + + DE ++ +D        + IR   + 
Sbjct: 1526 LENEITEGGSNLSHGQRQLVCLARSLLRNPKIILLDEATASIDYASDAKIQETIRKEFSQ 1585

Query: 271  TKYVICVEHDL-SVLDY 286
            +  ++ + H L SV+DY
Sbjct: 1586 ST-ILTIAHRLRSVIDY 1601

>Scas_587.8
          Length = 715

 Score = 37.4 bits (85), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 44/188 (23%), Positives = 81/188 (43%), Gaps = 41/188 (21%)

Query: 353 AFSYPSLKKTQGDFVLNVEEGEFSDSEILVMMGENGTGKTTLIKLL-------AGALKPD 405
           +F+YP+ + T    +LN         E + ++G +G+GK+T+  LL        G++K D
Sbjct: 449 SFAYPT-RPTHS--ILNNLSISIQPGEHVCIVGPSGSGKSTVSSLLLRYYDVSTGSIKID 505

Query: 406 EGQDIPKLNVSMKPQKIAPKFPGTVRQ---LFFKKIRGQFLNPQFQTDVVK--------- 453
            GQ+I + N+     +   +  G V+Q   LF   I    L      + +          
Sbjct: 506 -GQNIKEFNL-----RKYRRLLGVVQQEPMLFNGTILDNILYAVLSKETLTANSPDVKRA 559

Query: 454 -------------PLRIDDIIDQEVQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDS 500
                        P  ++ ++      LSGG+ QR+A+  A  +   + ++DE ++ LDS
Sbjct: 560 LEQANCTKFLKNFPEGVNTLVGPRGTQLSGGQKQRIALARAFLLHPALLILDEATSALDS 619

Query: 501 EQRIICSK 508
           +   I +K
Sbjct: 620 QSEEIVAK 627

 Score = 30.0 bits (66), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 44/204 (21%), Positives = 83/204 (40%), Gaps = 25/204 (12%)

Query: 101 RPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKML 160
           +PG+ + +VG +G GKST   +L      + G      +    IK F   + +     + 
Sbjct: 469 QPGEHVCIVGPSGSGKSTVSSLLLRYYDVSTGSIKIDGQN---IKEFNLRKYRRLLGVVQ 525

Query: 161 EDDIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKSPEDVKRYIKILQLENVLKRDIE 220
           ++ +  +     +DNI  A+         L K  +  +  DVKR ++       LK   E
Sbjct: 526 QEPM--LFNGTILDNILYAV---------LSKETLTANSPDVKRALEQANCTKFLKNFPE 574

Query: 221 -----------KLSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAAQIIRSLLA 269
                      +LSGG+ QR A+  + +    + + DE +S LD +     A+ +   + 
Sbjct: 575 GVNTLVGPRGTQLSGGQKQRIALARAFLLHPALLILDEATSALDSQSEEIVAKNLSERVE 634

Query: 270 PTKYVICVEHDLSVLDYLSDFVCI 293
                I + H LS + + +  + +
Sbjct: 635 LGLTTISIAHRLSTIKHSTRVIVL 658

>ACR022W [1070] [Homologous to ScYPL270W (MDL2) - SH]
           complement(395427..397691) [2265 bp, 754 aa]
          Length = 754

 Score = 37.0 bits (84), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 52/202 (25%), Positives = 81/202 (40%), Gaps = 37/202 (18%)

Query: 353 AFSYPSLKKTQGDFVLNVEEGEFSDSEILVMMGENGTGKTTLIKLL-------AGALKPD 405
           +FSYP+   +Q   +        +    + ++G +G GK+T+  LL       +G +  D
Sbjct: 463 SFSYPTRPTSQ---IFKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILID 519

Query: 406 EGQDIPKLNVSMKPQKIAPKFPGTVRQ---LFFKKIRGQFLNPQFQTDVVKPLRI----- 457
            GQDI K  VS K  +   K  G V+Q   L    IR         T  +  +R      
Sbjct: 520 -GQDISK--VSAKSLR---KHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIRAVAKKC 573

Query: 458 -------------DDIIDQEVQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRI 504
                        D +I      LSGG+ QR+AI  AL     I ++DE ++ LD E   
Sbjct: 574 FCHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVESEG 633

Query: 505 ICSKVIRRFILHNKKTAFIVEH 526
             +  + R +   + T   + H
Sbjct: 634 AINYTLGRLMRSKEITIVSIAH 655

 Score = 34.3 bits (77), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 37/73 (50%), Gaps = 1/73 (1%)

Query: 222 LSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAAQIIRSLLAPTK-YVICVEHD 280
           LSGG+ QR AI  + +++  + + DE +S LDV+        +  L+   +  ++ + H 
Sbjct: 597 LSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHR 656

Query: 281 LSVLDYLSDFVCI 293
           LS +    + V +
Sbjct: 657 LSTIRRSENIVVL 669

>CAGL0A01133g 112037..114442 similar to sp|P33311 Saccharomyces
           cerevisiae YPL270w MDL2, hypothetical start
          Length = 801

 Score = 37.0 bits (84), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 57/258 (22%), Positives = 107/258 (41%), Gaps = 45/258 (17%)

Query: 275 ICVEHDLSVLDYLSDFVCIIYGVPSVYGVVTLPASVREGIN----IF-LDGHIPAENLRF 329
           + +++ L++ D  +  +   Y   S++G+ T  + + +G      +F L   +P+ +   
Sbjct: 399 LVLQNSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDRVPSIS--- 455

Query: 330 RTEALQFRIADATEDLQNDSASRAFSYPSLKKTQ--GDFVLNVEEGEFSDSEILVMMGEN 387
            T+ ++++  +   + +N S    F+YP+        +    +E G       + ++G +
Sbjct: 456 TTKGVKYKPGNGEIEFKNVS----FAYPTRPSNMIFKNLNFKIEAGSN-----VCIVGPS 506

Query: 388 GTGKTTLIKLLAGALKPD------EGQDIPKLNVSMKPQKIAPK------FPGTVRQLF- 434
           G GK+T+  LL    KP       +GQ+I  LN     + I           GT+R    
Sbjct: 507 GRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIV 566

Query: 435 -----------FKKIRGQFLNPQFQTDVVKPLRIDDIIDQEVQHLSGGELQRVAIVLALG 483
                       +++  Q     F T        D +I      LSGG+ QR+AI  AL 
Sbjct: 567 YGLTEMPTKDEIRQVAKQCFCHNFITRFQSSY--DTVIGPHGTLLSGGQKQRIAIARALI 624

Query: 484 IPADIYLIDEPSAYLDSE 501
               I ++DE ++ LD E
Sbjct: 625 KKPRILILDEATSALDVE 642

 Score = 33.1 bits (74), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 33/64 (51%), Gaps = 1/64 (1%)

Query: 222 LSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAAQIIRSLLAPTKY-VICVEHD 280
           LSGG+ QR AI  + +++  + + DE +S LDV+           L+   +  ++ + H 
Sbjct: 609 LSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAHR 668

Query: 281 LSVL 284
           LS +
Sbjct: 669 LSTI 672

>Kwal_23.5161
          Length = 1489

 Score = 37.0 bits (84), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 48/191 (25%), Positives = 83/191 (43%), Gaps = 33/191 (17%)

Query: 102  PGQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLE 161
            PG +  L+G +G GK+T L  LA +   N+G          II    G  L N   K ++
Sbjct: 873  PGSLTALMGESGAGKTTLLNTLAQR---NVG----------IIT---GDMLVN--GKPID 914

Query: 162  DDIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKS---PED-----VKRYIKILQLEN 213
               +   +  YV      +K    +       RM +    PE      V++ I+IL +E+
Sbjct: 915  ASFER--RTGYVQQQDVHVKEMTVRESFQFAARMRRPQSIPESEKLAYVEKIIEILDMED 972

Query: 214  VLKRDIEKLSGG----ELQRFAIGMSCVQEADVYMF-DEPSSYLDVKQRLNAAQIIRSLL 268
              +  I  +  G    + ++ +IG+    + D+ +F DEP+S LD +      Q++R L 
Sbjct: 973  YAEALIGDVGYGLNVEQRKKVSIGVELAAKPDLLLFLDEPTSGLDSQSSWAIVQLMRRLA 1032

Query: 269  APTKYVICVEH 279
               + ++C  H
Sbjct: 1033 EAGQSILCTIH 1043

 Score = 33.1 bits (74), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 29/60 (48%)

Query: 465 VQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIV 524
           V+ +SGGE +RV+I  AL     IY  D  +  LD+   +  ++ IR      K  A + 
Sbjct: 296 VRGVSGGERKRVSIAEALAARGSIYCWDNATRGLDASTALEFAQAIRTMTNLQKSIALVT 355

>YDR406W (PDR15) [1232] chr4 (1279198..1283787) Member of ATP-binding
            cassette (ABC) superfamily [4590 bp, 1529 aa]
          Length = 1529

 Score = 37.0 bits (84), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 47/194 (24%), Positives = 83/194 (42%), Gaps = 26/194 (13%)

Query: 101  RPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKML 160
            +PG +  L+G +G GK+T L  LA  ++  +G              F    L++      
Sbjct: 911  KPGTLTALMGASGAGKTTLLDCLA--ERVTMGVITG--------NIFVDGRLRD------ 954

Query: 161  EDDIKAIIKPQYVD-NIPRAIKGPVQKVGELLKLRMEKSPEDVKRY----IKILQLEN-- 213
            E   ++I   Q  D ++  A      +    L+     S E+  RY    IKIL+++   
Sbjct: 955  ESFPRSIGYCQQQDLHLKTATVRESLRFSAYLRQPSSVSIEEKNRYVEEVIKILEMQQYS 1014

Query: 214  --VLKRDIEKLSGGELQRFAIGMSCVQEADVYMF-DEPSSYLDVKQRLNAAQIIRSLLAP 270
              V+    E L+  + +R  IG+       + +F DEP+S LD +   +  Q++R L   
Sbjct: 1015 DAVVGVAGEGLNVEQRKRLTIGVELAARPKLLVFLDEPTSGLDSQTAWDTCQLMRKLATH 1074

Query: 271  TKYVICVEHDLSVL 284
             + ++C  H  S +
Sbjct: 1075 GQAILCTIHQPSAI 1088

>Kwal_14.2435
          Length = 1247

 Score = 37.0 bits (84), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 35/80 (43%), Gaps = 13/80 (16%)

Query: 465  VQHLSGGELQRVAIVLALGI----PADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKT 520
            V+ LSGG+    AI L L I    PA  YL DE  A LD + R   +  I+    H +  
Sbjct: 1140 VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTSVANTIKELSAHAQ-- 1197

Query: 521  AFIVEHDFIMATYLADKVIV 540
                   FI  T+  D + V
Sbjct: 1198 -------FICTTFRTDMLQV 1210

>Scas_455.1
          Length = 925

 Score = 37.0 bits (84), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 49/206 (23%), Positives = 87/206 (42%), Gaps = 23/206 (11%)

Query: 358 SLKKTQGDFVLNVEEGEFSDSEILVMMGENGTGKTTLIKLLAGALKPDEGQDI-PKLN-- 414
           S   +  DF L     +F   ++ V++G  G+GKT+L+  L G +K  EG+ I P L+  
Sbjct: 720 SWDSSAQDFKLKDLNIDFKIGKLNVVIGPTGSGKTSLLMALLGEMKIMEGEIIVPSLDPR 779

Query: 415 ----VSMKPQKIAPKFPGTVRQLFFKKIRGQFL-----NPQFQTDVVKP---------LR 456
               V       +  +      L    +R   L     N    T V++          L+
Sbjct: 780 EDLVVDENGTTNSIAYCSQAAWLLNDTVRNNILFNSPYNEARYTSVIEACGLKRDFEILK 839

Query: 457 IDDI--IDQEVQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFI 514
             D+  I ++   LSGG+ QRV++  A+   +   L+D+  + +DS   +          
Sbjct: 840 AGDMTEIGEKGITLSGGQKQRVSLARAMYSNSRHILLDDCLSAVDSHTALWIYDNCITGP 899

Query: 515 LHNKKTAFIVEHDFIMATYLADKVIV 540
           L + +T  +V H+  +    AD V++
Sbjct: 900 LMDGRTCILVSHNIALTLKNADLVVI 925

>Scas_643.1
          Length = 1289

 Score = 37.0 bits (84), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 46/193 (23%), Positives = 88/193 (45%), Gaps = 26/193 (13%)

Query: 344 DLQNDSASRA---------FSYPSLKKTQGDFVLNVEEGEFSDSEILVMMGENGTGKTTL 394
           D+QN+S + +          S+ ++  T GD  L      F  S +  +MGE+G GKTTL
Sbjct: 726 DMQNNSGTLSESVETQKHLISWKNINYTIGDKKLINNVSGFIGSGLTALMGESGAGKTTL 785

Query: 395 IKLLAGALKPDEGQDIPKLNVSMKPQKIAPKFPGTVRQLFFKKIRGQFLNPQFQTDVVKP 454
           + +LA   + + G    +L +  KP      F  ++  +  + +    L  +   ++   
Sbjct: 786 LNVLAQ--RIESGVVTGELLIDGKPLTNENAFRRSIGFVQQQDLHLDLLTVKESLEISCR 843

Query: 455 LRID-DI-------------IDQEVQHLSGGELQRVAIVLALGI-PADIYLIDEPSAYLD 499
           LR D D+             +++ V  LS  + + ++I + L   P+ +  +DEP++ LD
Sbjct: 844 LRGDGDMKYLETISSLLKLPMNKLVAKLSPTQKKLLSIGVELVTKPSLLLFLDEPTSGLD 903

Query: 500 SEQRIICSKVIRR 512
           SE  +   K +++
Sbjct: 904 SEAALTIVKFLKK 916

 Score = 32.7 bits (73), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 36/69 (52%), Gaps = 1/69 (1%)

Query: 211 LENVLKRD-IEKLSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAAQIIRSLLA 269
           ++ V+  D +  +SGGE +R +I  + +    VY++D  +  LD    L+   I++ +  
Sbjct: 171 MDTVVGNDFVRGVSGGERKRISIIETFIANGSVYLWDNSTKGLDSSTALDFLSILKKMTE 230

Query: 270 PTKYVICVE 278
            TK V  V+
Sbjct: 231 ATKSVNLVK 239

 Score = 32.7 bits (73), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 44/90 (48%), Gaps = 3/90 (3%)

Query: 215 LKRDIEKLSGGELQRFAIGMSCVQEADVYMF-DEPSSYLDVKQRLNAAQIIRSLLAPTKY 273
           + + + KLS  + +  +IG+  V +  + +F DEP+S LD +  L   + ++ L    + 
Sbjct: 864 MNKLVAKLSPTQKKLLSIGVELVTKPSLLLFLDEPTSGLDSEAALTIVKFLKKLSQQGQA 923

Query: 274 VICVEH--DLSVLDYLSDFVCIIYGVPSVY 301
           + C  H    SV+ Y  +   +  G  SV+
Sbjct: 924 IFCTIHQPSKSVISYFDNIFLLKRGGESVF 953

>Scas_711.39
          Length = 1227

 Score = 37.0 bits (84), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 34/76 (44%), Gaps = 13/76 (17%)

Query: 465  VQHLSGGELQRVAIVLALGI----PADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKT 520
            V+ LSGG+    AI L L I    PA  YL DE  A LD + R   + +I++        
Sbjct: 1120 VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTAVANIIKQ-------- 1171

Query: 521  AFIVEHDFIMATYLAD 536
               V   FI  T+  D
Sbjct: 1172 -LSVNAQFICTTFRTD 1186

>YOR328W (PDR10) [5109] chr15 (931798..936492) Member of ATP-binding
            cassette (ABC) superfamily [4695 bp, 1564 aa]
          Length = 1564

 Score = 37.0 bits (84), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 44/194 (22%), Positives = 87/194 (44%), Gaps = 26/194 (13%)

Query: 101  RPGQVLGLVGTNGIGKSTALKILAGKQKPNL--------GRFDDPPEWQEIIKYFRGSEL 152
            +PG +  L+G +G GK+T L  LA +    L        GR  D   +   I Y +  +L
Sbjct: 950  KPGTLTALIGASGAGKTTLLDCLAERTTMGLITGDVFVDGRPRDQ-SFPRSIGYCQQQDL 1008

Query: 153  QNYFTKMLEDDIKAIIKPQYVDNIPRAIKGP-VQKVGELLKLRMEKSPEDVKRYIKILQL 211
             +  T  + + ++     +  D++    K   V++V E+L+++              L  
Sbjct: 1009 -HLKTATVRESLRFSAYLRQADDVSIEEKDKYVEEVIEVLEMK--------------LYA 1053

Query: 212  ENVLKRDIEKLSGGELQRFAIGMSCVQEADVYMF-DEPSSYLDVKQRLNAAQIIRSLLAP 270
            + ++    E L+  + +R  IG+    +  + +F DEP+S LD +   +  Q+++ L + 
Sbjct: 1054 DAIVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWSTCQLMKKLASR 1113

Query: 271  TKYVICVEHDLSVL 284
             + ++C  H  S L
Sbjct: 1114 GQAILCTIHQPSAL 1127

>CAGL0F02717g 261361..265989 tr|O74208 Candida glabrata ATP-binding
            cassette transporter, identified start
          Length = 1542

 Score = 36.6 bits (83), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 43/197 (21%), Positives = 82/197 (41%), Gaps = 32/197 (16%)

Query: 101  RPGQVLGLVGTNGIGKSTALKILAGKQKPNL--------GRFDDPPEWQEIIKYFRGSEL 152
            +PG +  L+G +G GK+T L  LA +    +        GR  D   +   I Y +  +L
Sbjct: 912  KPGTLTALMGASGAGKTTLLDCLAERTTMGVITGDVMVNGRPRDT-SFSRSIGYCQQQDL 970

Query: 153  QNYFTKMLEDDIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKSPEDVKRYIKILQLE 212
                  +    ++  ++       P ++              +E+  E V+  IKIL++E
Sbjct: 971  H-----LKTATVRESLRFSAYLRQPSSVS-------------IEEKNEYVEAVIKILEME 1012

Query: 213  NVLKRDI----EKLSGGELQRFAIGMSCVQEADVYMF-DEPSSYLDVKQRLNAAQIIRSL 267
                  +    E L+  + +R  IG+    +  + +F DEP+S LD +      Q+++ L
Sbjct: 1013 TYADAVVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWATCQLMKKL 1072

Query: 268  LAPTKYVICVEHDLSVL 284
                + ++C  H  S +
Sbjct: 1073 ANHGQAILCTIHQPSAM 1089

 Score = 31.6 bits (70), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 41/187 (21%), Positives = 79/187 (42%), Gaps = 35/187 (18%)

Query: 361  KTQGDFVLNVEEGEFSDSEILVMMGENGTGKTTLIKLLA-----GALKPD---------- 405
            KT+   +LN  +G      +  +MG +G GKTTL+  LA     G +  D          
Sbjct: 897  KTEVRRILNNVDGWVKPGTLTALMGASGAGKTTLLDCLAERTTMGVITGDVMVNGRPRDT 956

Query: 406  ---------EGQDIPKLNVSMKPQKIAPKFPGTVRQLFFKKIRGQFLNPQFQTDVVKPLR 456
                     + QD   L++     + + +F   +RQ     I  +    ++   V+K L 
Sbjct: 957  SFSRSIGYCQQQD---LHLKTATVRESLRFSAYLRQPSSVSIEEK---NEYVEAVIKILE 1010

Query: 457  IDDIIDQEV----QHLSGGELQRVAIVLALGI-PADIYLIDEPSAYLDSEQRIICSKVIR 511
            ++   D  V    + L+  + +R+ I + L   P  +  +DEP++ LDS+      ++++
Sbjct: 1011 METYADAVVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWATCQLMK 1070

Query: 512  RFILHNK 518
            +   H +
Sbjct: 1071 KLANHGQ 1077

>AGL346W [3966] [Homologous to ScYGR281W (YOR1) - SH]
           complement(61232..65434) [4203 bp, 1400 aa]
          Length = 1400

 Score = 36.6 bits (83), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 35/148 (23%), Positives = 70/148 (47%), Gaps = 23/148 (15%)

Query: 365 DFVLNVEEGEFSDSEILVMMGENGTGKTTLIKLLAGALKPDEGQ----------DIPKL- 413
           D + ++++GEF     ++++G  GTGKT+L+  +AG +K   G            +P + 
Sbjct: 553 DLLFSIKKGEF-----IIVIGAIGTGKTSLLNAVAGYMKKTTGSVHVNGSLLFCGVPWIQ 607

Query: 414 NVSMKPQKIAPKFPGTVRQLFFKK-IRGQFLNPQFQTDVVKPLRIDDIIDQEVQHLSGGE 472
           N +++   I   F  +  Q  + + +    L   F+   + P      + +    LSGG+
Sbjct: 608 NATIRDNII---FGSSFDQTRYDEVVNACALEADFK---IFPAGDKTEVGERGITLSGGQ 661

Query: 473 LQRVAIVLALGIPADIYLIDEPSAYLDS 500
             R+++  A+    DIYL D+  + +D+
Sbjct: 662 KARISLARAIYKDRDIYLFDDIISAVDA 689

 Score = 33.1 bits (74), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 61/139 (43%), Gaps = 25/139 (17%)

Query: 385  GENGTGKTT-------LIKLLAGALKPDEGQDIPKLNVS--MKPQKIAPK----FPGTVR 431
            G  G GKT+       L +L +G++K D G DI  L +        I P+    F GTVR
Sbjct: 1179 GRTGAGKTSVTTALYRLSELESGSIKID-GVDIATLGLHDLRSALSIIPQDPLLFRGTVR 1237

Query: 432  QL---FFKKIRGQFLNPQFQTDVV--------KPLRIDDIIDQEVQHLSGGELQRVAIVL 480
            +    F +   G   +   ++ VV            +D  +D+   + S GE Q +A+  
Sbjct: 1238 KNLDPFAEHTDGTLWSALVRSGVVPAGVVPTSHKFHLDQEVDEGGANFSLGERQLLALAR 1297

Query: 481  ALGIPADIYLIDEPSAYLD 499
            AL     I ++DE ++ +D
Sbjct: 1298 ALVRSTRILILDEATSSVD 1316

>YKR104W (NFT1) [3355] chr11 (656472..657392) Member of the
           ATP-binding cassette (ABC) superfamily [921 bp, 306 aa]
          Length = 306

 Score = 35.8 bits (81), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 53/239 (22%), Positives = 96/239 (40%), Gaps = 40/239 (16%)

Query: 70  IQIINLPTNLEAHVTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTALKILAGKQKP 129
           +++ NL      H +      SFK+      + G  +G+VG  G GKS+   I+A     
Sbjct: 33  VELKNLSLRYSPHSSKALDNVSFKV------KAGTKVGIVGRTGAGKSS---IIAA---- 79

Query: 130 NLGRFDDPPEWQEIIKYFRGSELQNYFTKMLEDDIKAIIK-PQYVDNIPRA--------- 179
            + R  D   W+         ++++   + L + I  I + P   D   R+         
Sbjct: 80  -IYRLSD---WENGTITIDNKDIKHIPLERLRNSISCIPQDPTLFDGTVRSNLDPFDRYS 135

Query: 180 ---IKGPVQKVG------ELLKLRMEKSPEDVKRYIK--ILQLENVLKRDIEKLSGGELQ 228
              I G + KVG      EL  +  ++ P      ++   + L  V+K     LS G+ Q
Sbjct: 136 DVQIYGVLSKVGLIEECDELCLIFEQEQPNFSSHKLRNRFIDLNTVVKSGGSNLSQGQRQ 195

Query: 229 RFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAAQIIRSLLAPTKYVICVEHDL-SVLDY 286
              +  S +   ++ + DE ++ +D        + IR  +  T  ++ + H L SV+DY
Sbjct: 196 LLCLARSMLGARNIMLIDEATASIDYISDAKIQKTIRETMKNTT-ILTIAHRLRSVIDY 253

>YGR281W (YOR1) [2226] chr7 (1052829..1057262) Oligomycin-resistance
           factor, member of the ATP-binding cassette (ABC)
           superfamily [4434 bp, 1477 aa]
          Length = 1477

 Score = 36.2 bits (82), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 46/176 (26%), Positives = 80/176 (45%), Gaps = 39/176 (22%)

Query: 340 DATEDLQNDSASRAFSYPSLKKTQGDFVLNVEEGEFSDSEILVMMGENGTGKTTLIKLLA 399
           D  EDL+  S  R F          D   ++++GEF     +++ G  GTGK++L+  +A
Sbjct: 591 DGPEDLEKTSF-RGFK---------DLNFDIKKGEF-----IMITGPIGTGKSSLLNAMA 635

Query: 400 GALKPDEGQDIPKLNVSMKPQKIAPKFP----GTVRQLFFKKIRGQFLNPQFQTDVVK-- 453
           G+++  +G+      V +    +   +P     +VR      I G   N +   +VV+  
Sbjct: 636 GSMRKTDGK------VEVNGDLLMCGYPWIQNASVRD---NIIFGSPFNKEKYDEVVRVC 686

Query: 454 PLRID-DI--------IDQEVQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDS 500
            L+ D DI        I +    LSGG+  R+ +  ++    DIYL D+  + +DS
Sbjct: 687 SLKADLDILPAGDMTEIGERGITLSGGQKARINLARSVYKKKDIYLFDDVLSAVDS 742

 Score = 31.2 bits (69), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 18/72 (25%), Positives = 35/72 (48%)

Query: 222 LSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAAQIIRSLLAPTKYVICVEHDL 281
           LSGG+  R  +  S  ++ D+Y+FD+  S +D +   +      + +   K  I   H L
Sbjct: 710 LSGGQKARINLARSVYKKKDIYLFDDVLSAVDSRVGKHIMDECLTGMLANKTRILATHQL 769

Query: 282 SVLDYLSDFVCI 293
           S+++  S  + +
Sbjct: 770 SLIERASRVIVL 781

 Score = 30.0 bits (66), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 42/173 (24%), Positives = 80/173 (46%), Gaps = 32/173 (18%)

Query: 101  RPGQVLGLVGTNGIGKSTALKIL-------AGK------QKPNLGRFDDPPEWQEIIK-- 145
            + G+ +G+ G  G GKST +  L       AGK          LG FD   +   I +  
Sbjct: 1238 KSGEKIGICGRTGAGKSTIMSALYRLNELTAGKILIDNVDISQLGLFDLRRKLAIIPQDP 1297

Query: 146  -YFRGSELQNY--FTKMLEDDIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKSPEDV 202
              FRG+  +N   F +  +D++         D + R   G + K  +L +++++K P++ 
Sbjct: 1298 VLFRGTIRKNLDPFNERTDDEL--------WDALVRG--GAIAK-DDLPEVKLQK-PDEN 1345

Query: 203  KRYIKI--LQLENVLKRDIEKLSGGELQRFAIGMSCVQEADVYMFDEPSSYLD 253
              + K+    L+  ++ +    S GE Q  A+  + V+++ + + DE +S +D
Sbjct: 1346 GTHGKMHKFHLDQAVEEEGSNFSLGERQLLALTRALVRQSKILILDEATSSVD 1398

>Scas_714.42
          Length = 1520

 Score = 36.2 bits (82), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 41/178 (23%), Positives = 77/178 (43%), Gaps = 29/178 (16%)

Query: 367  VLNVEEGEFSDSEILVMMGENGTGKTTLIKLLA-----GALKPD-------EGQDIPK-- 412
            +LN  +G      +  +MG +G GKTTL+  LA     G +  D         Q  P+  
Sbjct: 888  ILNNVDGWVKPGTLTALMGASGAGKTTLLDCLAERVTMGVITGDVLVNGRPRDQSFPRSI 947

Query: 413  -------LNVSMKPQKIAPKFPGTVRQLFFKKIRGQFLNPQFQTDVVKPLRIDDIIDQEV 465
                   L++     + + +F   +RQ     I  +    Q+  DV+K L ++   D  V
Sbjct: 948  GYCQQQDLHLKTSTVRESLRFSAYLRQPADVSIEEK---NQYVEDVIKILEMEAYADAVV 1004

Query: 466  ----QHLSGGELQRVAIVLALGI-PADIYLIDEPSAYLDSEQRIICSKVIRRFILHNK 518
                + L+  + +R+ I + L   P  +  +DEP++ LDS+      +++++   H +
Sbjct: 1005 GVAGEGLNVEQRKRLTIGVELTAKPKLLVFLDEPTSGLDSQTAWSICQLMKKLADHGQ 1062

 Score = 34.3 bits (77), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 46/207 (22%), Positives = 87/207 (42%), Gaps = 52/207 (25%)

Query: 101  RPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKML 160
            +PG +  L+G +G GK+T L  LA  ++  +G                          ++
Sbjct: 897  KPGTLTALMGASGAGKTTLLDCLA--ERVTMG--------------------------VI 928

Query: 161  EDDIKAIIKPQYVDNIPRAIKGPVQK--------VGELLKLR----------MEKSPEDV 202
              D+    +P+   + PR+I    Q+        V E L+            +E+  + V
Sbjct: 929  TGDVLVNGRPR-DQSFPRSIGYCQQQDLHLKTSTVRESLRFSAYLRQPADVSIEEKNQYV 987

Query: 203  KRYIKILQLEN----VLKRDIEKLSGGELQRFAIGMSCVQEADVYMF-DEPSSYLDVKQR 257
            +  IKIL++E     V+    E L+  + +R  IG+    +  + +F DEP+S LD +  
Sbjct: 988  EDVIKILEMEAYADAVVGVAGEGLNVEQRKRLTIGVELTAKPKLLVFLDEPTSGLDSQTA 1047

Query: 258  LNAAQIIRSLLAPTKYVICVEHDLSVL 284
             +  Q+++ L    + ++C  H  S +
Sbjct: 1048 WSICQLMKKLADHGQAILCTIHQPSAI 1074

>CAGL0H02805g complement(256682..260341) similar to sp|P47037
            Saccharomyces cerevisiae YJL074c SMC3 required for
            structural maintenance of chromosomes, start by
            similarity
          Length = 1219

 Score = 35.8 bits (81), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 47/112 (41%), Gaps = 16/112 (14%)

Query: 465  VQHLSGGELQRVAIVLALGI----PADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKT 520
            V+ LSGG+    AI L L I    PA  YL DE  A LD + R   ++ I +  L N   
Sbjct: 1112 VEQLSGGQKTVCAIALILAIQMVEPAPFYLFDEIDAALDKQYRRAVAQTISQ--LSNN-- 1167

Query: 521  AFIVEHDFIMATYLADKVIV---FEGIPSKNAHARAPESLLTGCNRFLKNLN 569
                   FI  T+ +D V     F  +  +N  +   E       RF+K  N
Sbjct: 1168 -----AQFICTTFRSDMVDAANKFYRVKYENKQSSVIEVTKEEAKRFIKGGN 1214

>YLL048C (YBT1) [3375] chr12 complement(41279..46264) Protein with
           similarity to mammalian ATP-dependent bile acid
           transporter, member of the ATP-binding cassette (ABC)
           superfamily [4986 bp, 1661 aa]
          Length = 1661

 Score = 35.8 bits (81), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 49/214 (22%), Positives = 90/214 (42%), Gaps = 35/214 (16%)

Query: 358 SLKKTQGDFVLNVEEGEFSDSEILVMMGENGTGKTTLIKLLAGALKPDEGQDIPKLNVSM 417
           S  K   DF L     EF   ++ V++G  G+GKT+L+  L G +    G+ +     ++
Sbjct: 702 SWDKDNQDFKLKDLNIEFKTGKLNVVIGPTGSGKTSLLMALLGEMYLLNGKVVVP---AL 758

Query: 418 KP-QKIAPKFPGTVRQLFFKKIRGQFLNPQFQTDVV-----------------------K 453
           +P Q++     GT   + +       LN   + +++                       +
Sbjct: 759 EPRQELIVDANGTTNSIAYCSQAAWLLNDTVKNNILFNSPFNEARYKAVVEACGLKRDFE 818

Query: 454 PLRIDDI--IDQEVQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIR 511
            L+  D+  I ++   LSGG+ QRV++  AL   A   L+D+  + +DS      S +  
Sbjct: 819 ILKAGDLTEIGEKGITLSGGQKQRVSLARALYSNARHVLLDDCLSAVDSHT---ASWIYD 875

Query: 512 RFI---LHNKKTAFIVEHDFIMATYLADKVIVFE 542
             I   L   +T  +V H+  +    A+ V++ E
Sbjct: 876 NCITGPLMEDRTCILVSHNIALTLRNAELVVLLE 909

>KLLA0E00462g complement(39173..44125) similar to sp|P32386
           Saccharomyces cerevisiae YLL048c YBT1 yeast bile
           transporter, start by similarity
          Length = 1650

 Score = 35.8 bits (81), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 46/211 (21%), Positives = 88/211 (41%), Gaps = 29/211 (13%)

Query: 358 SLKKTQGDFVLNVEEGEFSDSEILVMMGENGTGKTTLIKLLAGALKPDEGQD-IPKLNVS 416
           +  K   DF L     +F   ++ V++G  G+GKT+L+  L G ++   G+  +P LN  
Sbjct: 707 TWDKNNQDFKLKNLTIDFKIGKLNVIVGPTGSGKTSLLMGLLGEMELLNGKVFVPSLN-- 764

Query: 417 MKPQKIAPKFPGTVRQLFFKKIRGQFLNPQFQTDVV-----KPLRIDDII-------DQE 464
              +++  +  G    + +       LN   + +++        R + +I       D E
Sbjct: 765 -PREELVVEADGMTNSIAYCSQAAWLLNDTVRNNILFNAPYNENRYNAVISACGLKRDFE 823

Query: 465 VQH-------------LSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIR 511
           +               LSGG+ QRV++  +L   +   L+D+  + +DS   +   +   
Sbjct: 824 ILSAGDQTEIGEKGITLSGGQKQRVSLARSLYSSSRHLLLDDCLSAVDSHTALWIYENCI 883

Query: 512 RFILHNKKTAFIVEHDFIMATYLADKVIVFE 542
              L   +T  +V H+  +    AD VI+ E
Sbjct: 884 TGPLMEGRTCVLVSHNVALTLKNADWVIIME 914

>Sklu_1870.3 YFL028C, Contig c1870 3336-4133
          Length = 265

 Score = 35.0 bits (79), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 47/158 (29%), Positives = 72/158 (45%), Gaps = 28/158 (17%)

Query: 108 LVGTNGIGKSTALKILAGKQKPNLGRF----DDPPEWQEIIKYFRGSELQNYFTKMLED- 162
           +VG+NG GKST LK+L+GK     GR      DP         F  + +Q    K  ED 
Sbjct: 37  VVGSNGAGKSTLLKLLSGKHLCLNGRILVNGLDP---------FSPTSMQ----KDAEDC 83

Query: 163 DIKAIIKPQY--VDNIPRAIKGPVQKVGELLK-LRMEKSPEDVKRYIKILQLENVLKRDI 219
            I   +  ++  +  I R I      + ELL  +  E   E  +  I IL ++  L+  +
Sbjct: 84  QITTYLGTEWCHMSIINRDI-----GILELLNSIGFEHYRERGEELISILDID--LEWRM 136

Query: 220 EKLSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQR 257
            +LS G+ +R  + M  ++   V + DE +  LDV  R
Sbjct: 137 HRLSDGQKRRVQLTMGLLKPWKVLLLDEVTVDLDVVAR 174

 Score = 33.9 bits (76), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 47/217 (21%), Positives = 87/217 (40%), Gaps = 39/217 (17%)

Query: 353 AFSYP-SLKKTQGDFVLNVEEGEFSDSEILVMMGENGTGKTTLIKLLAG----------- 400
            +S+P + K +  +  LN+     +     +++G NG GK+TL+KLL+G           
Sbjct: 11  TYSFPHTTKPSLANITLNIPWNTRT-----LVVGSNGAGKSTLLKLLSGKHLCLNGRILV 65

Query: 401 -ALKP----------DEGQDIPKLNVSMKPQKIAPKFPGTVRQL---FFKKIRGQFLNPQ 446
             L P          ++ Q    L        I  +  G +  L    F+  R      +
Sbjct: 66  NGLDPFSPTSMQKDAEDCQITTYLGTEWCHMSIINRDIGILELLNSIGFEHYR------E 119

Query: 447 FQTDVVKPLRIDDIIDQEVQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIIC 506
              +++  L ID  ++  +  LS G+ +RV + + L  P  + L+DE +  LD   R   
Sbjct: 120 RGEELISILDID--LEWRMHRLSDGQKRRVQLTMGLLKPWKVLLLDEVTVDLDVVARSKL 177

Query: 507 SKVIRRFILHNKKTAFIVEHDFIMATYLADKVIVFEG 543
              + +     + +     H F   ++  D+VI  +G
Sbjct: 178 LDFLEKETRTRRCSVVYATHIFDGLSHWPDRVIHIKG 214

>YJL074C (SMC3) [2838] chr10 complement(299073..302765) Cohesin,
            coiled-coil protein of the SMC family involved in
            chromosome condensation and segregation [3693 bp, 1230
            aa]
          Length = 1230

 Score = 35.4 bits (80), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 31/63 (49%), Gaps = 7/63 (11%)

Query: 465  VQHLSGGELQRVAIVLALGI----PADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKT 520
            V+ LSGG+    AI L L I    PA  YL DE  A LD + R   + +++     +K  
Sbjct: 1123 VEQLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAALDKQYRTAVATLLKEL---SKNA 1179

Query: 521  AFI 523
             FI
Sbjct: 1180 QFI 1182

>Scas_567.1
          Length = 810

 Score = 35.4 bits (80), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 44/179 (24%), Positives = 77/179 (43%), Gaps = 27/179 (15%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNL---GRFD-DPPEWQEIIKYFRGS-----ELQ 153
           G++L +VG  G G ST LK ++G+    +   G F  D  +  E++  ++G      EL 
Sbjct: 180 GEMLFVVGRPGAGCSTLLKTISGETSDMVEVQGDFSYDGLDQAEMMSKYKGYVVYCPELD 239

Query: 154 NYFTKMLEDDIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKSPEDVK------RYIK 207
            +F K+    +K  I      +     K P  ++  + +     S  D+       R+  
Sbjct: 240 FHFPKI---TVKETI------DFALKCKTPRTRIDNMSRAEYVDSLRDMWCTVFGLRHTY 290

Query: 208 ILQLENVLKRDIEKLSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAAQIIRS 266
             ++ N   R +   SGGE +R ++  +    A +Y +D  +  LD    L  AQ IR+
Sbjct: 291 ATKVGNDFVRGV---SGGERKRVSLVEAQAMGASIYSWDNATRGLDASTALEFAQAIRT 346

 Score = 32.7 bits (73), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 28/47 (59%)

Query: 465 VQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIR 511
           V+ +SGGE +RV++V A  + A IY  D  +  LD+   +  ++ IR
Sbjct: 299 VRGVSGGERKRVSLVEAQAMGASIYSWDNATRGLDASTALEFAQAIR 345

>KLLA0E19074g complement(1691643..1692623) highly similar to
           sp|P52920 Saccharomyces cerevisiae YGL091c NBP35
           nucleotide-binding protein, start by similarity
          Length = 326

 Score = 34.7 bits (78), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 39/79 (49%), Gaps = 3/79 (3%)

Query: 379 EILVMMGENGTGKTTLIKLLAGALKPDEGQDIPKLNVSMKPQKIAPKFPGTVRQLFFKKI 438
           +IL++ G+ G GK+T   +L+ AL  DE   +  +++ +    + P   G VR+   +  
Sbjct: 72  KILILSGKGGVGKSTFTTMLSWALSADEDLQVGAMDLDICGPSL-PHMLGCVRETIHESN 130

Query: 439 RGQFLNPQFQTDVVKPLRI 457
            G    P + TD +  + I
Sbjct: 131 TG--WTPVYVTDNLATMSI 147

>YOR153W (PDR5) [4952] chr15 (619840..624375) Drug-efflux pump
            involved in resistance to multiple drugs, member of the
            ATP-binding cassette (ABC) superfamily [4536 bp, 1511 aa]
          Length = 1511

 Score = 35.0 bits (79), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 48/207 (23%), Positives = 84/207 (40%), Gaps = 52/207 (25%)

Query: 101  RPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKML 160
            +PG +  L+G +G GK+T L  LA  ++  +G                          ++
Sbjct: 896  KPGTLTALMGASGAGKTTLLDCLA--ERVTMG--------------------------VI 927

Query: 161  EDDIKAIIKPQYVDNIPRAIKGPVQ--------------KVGELLKLRMEKSPEDVKRY- 205
              DI     P+   + PR+I    Q              +    L+   E S E+  RY 
Sbjct: 928  TGDILVNGIPR-DKSFPRSIGYCQQQDLHLKTATVRESLRFSAYLRQPAEVSIEEKNRYV 986

Query: 206  ---IKILQLEN----VLKRDIEKLSGGELQRFAIGMSCVQEADVYMF-DEPSSYLDVKQR 257
               IKIL++E     V+    E L+  + +R  IG+    +  + +F DEP+S LD +  
Sbjct: 987  EEVIKILEMEKYADAVVGVAGEGLNVEQRKRLTIGVELTAKPKLLVFLDEPTSGLDSQTA 1046

Query: 258  LNAAQIIRSLLAPTKYVICVEHDLSVL 284
             +  Q+++ L    + ++C  H  S +
Sbjct: 1047 WSICQLMKKLANHGQAILCTIHQPSAI 1073

>YNR070W (YNR070W) [4653] chr14 (765372..769373) Probable multidrug
           resistance protein of the ATP-binding cassette (ABC)
           family, has similarity to Snq2p, Pdr5p and Candida
           albicans Cdr1p [4002 bp, 1333 aa]
          Length = 1333

 Score = 35.0 bits (79), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 38/83 (45%), Gaps = 11/83 (13%)

Query: 429 TVRQLFFKKIRGQFLNPQFQTDVVKPLRIDDIIDQEVQHLSGGELQRVAIVLALGIPADI 488
           T  + F+ KI G  L   F T V      +D I      +SGGE +RV+I  AL     I
Sbjct: 152 TANREFYAKIFG--LTHTFDTKVG-----NDFISG----VSGGERKRVSIAEALAAKGSI 200

Query: 489 YLIDEPSAYLDSEQRIICSKVIR 511
           Y  D  +  LDS   +  ++ IR
Sbjct: 201 YCWDNATRGLDSSTALEFARAIR 223

 Score = 34.3 bits (77), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 43/207 (20%), Positives = 80/207 (38%), Gaps = 65/207 (31%)

Query: 102 PGQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLE 161
           PG +  L+G +G GK+T L  LA                                    +
Sbjct: 757 PGTLTALIGESGAGKTTLLNTLA------------------------------------Q 780

Query: 162 DDIKAIIKPQYVDNIP-----RAIKGPVQK----VGEL-------LKLRMEK-------- 197
            ++  I     VD +P     +   G VQ+    V EL          RM +        
Sbjct: 781 RNVGTITGDMLVDGLPMDASFKRRTGYVQQQDLHVAELTVKESLQFSARMRRPQSIPDAE 840

Query: 198 SPEDVKRYIKILQLENVLKRDIEKLSGG----ELQRFAIGMSCVQEADVYMF-DEPSSYL 252
             E V++ I IL+++   +  + ++  G    + ++ +IG+  V + D+ +F DEP+S L
Sbjct: 841 KMEYVEKIISILEMQEFSEALVGEIGYGLNVEQRKKLSIGVELVGKPDLLLFLDEPTSGL 900

Query: 253 DVKQRLNAAQIIRSLLAPTKYVICVEH 279
           D +      ++++ L    + ++C  H
Sbjct: 901 DSQSAWAVVKMLKRLALAGQSILCTIH 927

 Score = 32.7 bits (73), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 43/164 (26%), Positives = 71/164 (43%), Gaps = 34/164 (20%)

Query: 380 ILVMMGENGTGKTTLIKLLA----GALKPDEGQDIPKLNVSMKPQKIAPKFPGTVRQ--- 432
           +  ++GE+G GKTTL+  LA    G +  D   D   ++ S K +       G V+Q   
Sbjct: 760 LTALIGESGAGKTTLLNTLAQRNVGTITGDMLVDGLPMDASFKRRT------GYVQQQDL 813

Query: 433 ----LFFK---KIRGQFLNPQFQTDVVKPLRIDDIID----QEVQHLSGGEL-------- 473
               L  K   +   +   PQ   D  K   ++ II     QE      GE+        
Sbjct: 814 HVAELTVKESLQFSARMRRPQSIPDAEKMEYVEKIISILEMQEFSEALVGEIGYGLNVEQ 873

Query: 474 -QRVAIVLAL-GIPADIYLIDEPSAYLDSEQRIICSKVIRRFIL 515
            ++++I + L G P  +  +DEP++ LDS+      K+++R  L
Sbjct: 874 RKKLSIGVELVGKPDLLLFLDEPTSGLDSQSAWAVVKMLKRLAL 917

>AAL182W [5] [Homologous to ScYJL074C (SMC3) - SH]
            complement(16155..19850) [3696 bp, 1231 aa]
          Length = 1231

 Score = 34.7 bits (78), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 35/80 (43%), Gaps = 13/80 (16%)

Query: 465  VQHLSGGELQRVAIVLALGI----PADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKT 520
            V+ LSGG+    AI L L I    PA  YL DE  A LD + R   +  +++        
Sbjct: 1123 VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTAVAATVKQ-------- 1174

Query: 521  AFIVEHDFIMATYLADKVIV 540
                +  FI  T+  D + V
Sbjct: 1175 -LSSQAQFICTTFRGDMIAV 1193

>Scas_552.4
          Length = 720

 Score = 34.3 bits (77), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 46/195 (23%), Positives = 81/195 (41%), Gaps = 37/195 (18%)

Query: 383 MMGENGTGKTTLIKLLAGALKPDEGQ------DIPKLNVS--MKPQKIAPK----FPGTV 430
           ++G  G GK+T+I  L   L P+ G       DI  +N++   +   I P+    F GT+
Sbjct: 483 IVGRTGAGKSTIITALFRFLDPETGYIKIDNIDITSINLNKLRRSINIIPQDPTLFTGTI 542

Query: 431 R-----------QLFFKKIRGQFLNPQ-----------FQTDVVKPLRIDDIIDQEVQHL 468
           +           +  F  +R   L P+              +V K L +++ I +   +L
Sbjct: 543 KSNLDPYGEYSDEDMFTALRRVNLVPEDVSSNIETESISSQNVNKFLNLNNEISEGGSNL 602

Query: 469 SGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDF 528
           S G+ Q V +  +L     I L+DE +A +D        + IR+    N  T   + H  
Sbjct: 603 SQGQRQLVCLARSLLRSPKIMLLDEATASIDYNSDAKIQETIRK--EFNSSTILTIAHR- 659

Query: 529 IMATYLADKVIVFEG 543
           + +    DK++V + 
Sbjct: 660 LRSVIDYDKILVMDA 674

 Score = 34.3 bits (77), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 52/217 (23%), Positives = 77/217 (35%), Gaps = 53/217 (24%)

Query: 99  TPRPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTK 158
           T  P   +G+VG  G GKST +  L         RF DP               +  + K
Sbjct: 474 TVAPKAKIGIVGRTGAGKSTIITALF--------RFLDP---------------ETGYIK 510

Query: 159 MLEDDIKAI----------IKPQYVDNIPRAIKGPVQKVGELLK-------LRMEKSPED 201
           +   DI +I          I PQ        IK  +   GE           R+   PED
Sbjct: 511 IDNIDITSINLNKLRRSINIIPQDPTLFTGTIKSNLDPYGEYSDEDMFTALRRVNLVPED 570

Query: 202 VKRYI-----------KILQLENVLKRDIEKLSGGELQRFAIGMSCVQEADVYMFDEPSS 250
           V   I           K L L N +      LS G+ Q   +  S ++   + + DE ++
Sbjct: 571 VSSNIETESISSQNVNKFLNLNNEISEGGSNLSQGQRQLVCLARSLLRSPKIMLLDEATA 630

Query: 251 YLDVKQRLNAAQIIRSLLAPTKYVICVEHDL-SVLDY 286
            +D        + IR     +  ++ + H L SV+DY
Sbjct: 631 SIDYNSDAKIQETIRKEFNSST-ILTIAHRLRSVIDY 666

>CAGL0M01760g 203616..208115 highly similar to sp|P33302 Saccharomyces
            cerevisiae YOR153w PDR5 or sp|Q04182 Saccharomyces
            cerevisiae YDR406w PDR15 or sp|P51533 Saccharomyces
            cerevisiae YOR328w, hypothetical start
          Length = 1499

 Score = 34.3 bits (77), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 45/204 (22%), Positives = 86/204 (42%), Gaps = 46/204 (22%)

Query: 101  RPGQVLGLVGTNGIGKSTALKILA---------------GKQKPNLGRFDDPPEWQEIIK 145
            +PG +  L+G +G GK+T L  LA               GKQ+      DD   +   I 
Sbjct: 884  KPGTLTALMGASGAGKTTLLDCLAERVTMGVITGEVSVDGKQR------DD--SFARSIG 935

Query: 146  YFRGSELQNYFTKMLEDDIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKSPEDVKRY 205
            Y +  +L +  T  + + ++              ++ P         + +E+  + V+  
Sbjct: 936  YCQQQDL-HLKTSTVRESLR----------FSAYLRQPAD-------VSIEEKNQYVEDV 977

Query: 206  IKILQLENVLKRDI----EKLSGGELQRFAIGMSCVQEADVYMF-DEPSSYLDVKQRLNA 260
            IKIL++E      +    E L+  + +R  IG+    +  + +F DEP+S LD +   + 
Sbjct: 978  IKILEMEQYADAVVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWSI 1037

Query: 261  AQIIRSLLAPTKYVICVEHDLSVL 284
             Q+++ L    + ++C  H  S +
Sbjct: 1038 CQLMKKLANHGQAILCTIHQPSAI 1061

 Score = 31.6 bits (70), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 33/68 (48%), Gaps = 7/68 (10%)

Query: 367 VLNVEEGEFSDSEILVMMGENGTGKTTLIKLLAGALKPDEGQDIPKLNV----SMKPQKI 422
           +L   EG  +  E+LV++G  G+G TTL+K ++       G +I K +      M P  I
Sbjct: 164 ILKSMEGAVNPGELLVVLGRPGSGCTTLLKSIS---SNTHGFNIAKESTISYSGMTPNDI 220

Query: 423 APKFPGTV 430
              F G V
Sbjct: 221 RKHFRGEV 228

>Scas_716.82
          Length = 675

 Score = 33.9 bits (76), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 21/89 (23%), Positives = 46/89 (51%), Gaps = 5/89 (5%)

Query: 196 EKSPEDVKRYIKILQLENVLKRDIEKLSGG----ELQRFAIGMSCVQEADVYMF-DEPSS 250
           E+    V++ I +L ++   +  + ++  G    + ++ +IG+  V + D+ +F DEP+S
Sbjct: 138 EEKMAYVEKIIHVLDMQEYAEALVGEIGRGLNVEQRKKLSIGVELVAKPDLLLFLDEPTS 197

Query: 251 YLDVKQRLNAAQIIRSLLAPTKYVICVEH 279
            LD +      Q++R L    + ++C  H
Sbjct: 198 GLDSQSSWAIIQLLRKLAQAGQSILCTIH 226

>Scas_472.1*
          Length = 393

 Score = 33.9 bits (76), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 30/51 (58%), Gaps = 4/51 (7%)

Query: 465 VQHLSGGELQRVAIVLALGIPADIYLI--DEPSAYLDSEQRIICSKVIRRF 513
           ++ LSGG  Q+V +VLA G     +LI  DEP+ YLD +     SK ++ F
Sbjct: 243 IRGLSGG--QKVKLVLAAGTWQRPHLIVLDEPTNYLDRDSLGALSKALKAF 291

 Score = 32.7 bits (73), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 29/57 (50%), Gaps = 8/57 (14%)

Query: 354 FSYPSLKKTQGDFVLNVEEGEF--SDSEILVMMGENGTGKTTLIKLLAGALKPDEGQ 408
           F YP   K Q      + +  F  S S  + ++G NG GK+TLI +L G L P  G+
Sbjct: 23  FQYPGTTKPQ------ISDVSFQCSLSSRIAVIGPNGAGKSTLINVLTGELLPTTGE 73

 Score = 32.7 bits (73), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 38/86 (44%), Gaps = 3/86 (3%)

Query: 209 LQLENVLKRDIEKLSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAAQIIRSLL 268
           L  E V    I  LSGG+  +  +     Q   + + DEP++YLD   R +   + ++L 
Sbjct: 233 LDAELVSHSRIRGLSGGQKVKLVLAAGTWQRPHLIVLDEPTNYLD---RDSLGALSKALK 289

Query: 269 APTKYVICVEHDLSVLDYLSDFVCII 294
           A    VI + H       L++ V  +
Sbjct: 290 AFEGGVIIITHSAEFTKNLTEEVWAV 315

>Kwal_26.6702
          Length = 617

 Score = 33.9 bits (76), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 44/88 (50%), Gaps = 5/88 (5%)

Query: 202 VKRYIKILQLEN----VLKRDIEKLSGGELQRFAIGMSCVQEADVYMF-DEPSSYLDVKQ 256
           V   IKIL+++     V+    E L+  + +R  IG+    +  + +F DEP+S LD + 
Sbjct: 83  VDEVIKILEMQKYADAVVGVAGEGLNVEQRKRLTIGVELAAKPKLLLFLDEPTSGLDSQT 142

Query: 257 RLNAAQIIRSLLAPTKYVICVEHDLSVL 284
             +  Q++R L    + ++C  H  S L
Sbjct: 143 AWSICQLMRRLANHGQAILCTIHQPSAL 170

>YIL013C (PDR11) [2652] chr9 complement(328205..332440) Membrane
           transporter of the ATP-binding cassette (ABC)
           superfamily, plays a role in sterol uptake and anaerobic
           growth [4236 bp, 1411 aa]
          Length = 1411

 Score = 33.9 bits (76), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 31/57 (54%)

Query: 343 EDLQNDSASRAFSYPSLKKTQGDFVLNVEEGEFSDSEILVMMGENGTGKTTLIKLLA 399
           E +  ++     S+ ++  T GD  L  +   +  S +  +MGE+G GKTTL+ +L+
Sbjct: 740 ESVAMETQKHVISWKNINYTIGDKKLINDASGYISSGLTALMGESGAGKTTLLNVLS 796

 Score = 33.5 bits (75), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 47/98 (47%), Gaps = 7/98 (7%)

Query: 211 LENVLKRDIEKL----SGGELQRFAIGMSCVQEADVYMF-DEPSSYLDVKQRLNAAQIIR 265
           + N+L+   EKL    S  + +  +IG+  V +  + +F DEP+S LD +  L   Q ++
Sbjct: 862 VSNLLRLPSEKLVADLSPTQRKLLSIGVELVTKPSLLLFLDEPTSGLDAEAALTIVQFLK 921

Query: 266 SLLAPTKYVICVEH--DLSVLDYLSDFVCIIYGVPSVY 301
            L    + ++C  H    SV+ Y  +   +  G   VY
Sbjct: 922 KLSMQGQAILCTIHQPSKSVISYFDNIYLLKRGGECVY 959

>YHL035C (YHL035C) [2251] chr8 complement(27976..32754) Member of the
            ATP-binding cassette (ABC) superfamily [4779 bp, 1592 aa]
          Length = 1592

 Score = 33.9 bits (76), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 48/196 (24%), Positives = 84/196 (42%), Gaps = 38/196 (19%)

Query: 383  MMGENGTGKTTLIKLLAGALKP------DEGQDIPKLNVSM--KPQKIAPK----FPGTV 430
            ++G  G GK+T+I  L   L+P       +GQDI K+++    +   I P+    F GT+
Sbjct: 1355 IVGRTGAGKSTIITALFRLLEPITGCIKIDGQDISKIDLVTLRRSITIIPQDPILFAGTI 1414

Query: 431  R-----------QLFFKKIRG----------QFLNPQ--FQTDVVKPLRIDDIIDQEVQH 467
            +           +  FK +            + LN +  F +   K L +   I +   +
Sbjct: 1415 KSNVDPYDEYDEKKIFKALSQVNLISSHEFEEVLNSEERFNSTHNKFLNLHTEIAEGGLN 1474

Query: 468  LSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHD 527
            LS GE Q + I  +L     I L+DE ++ +D +   +   +IR     NK T   + H 
Sbjct: 1475 LSQGERQLLFIARSLLREPKIILLDEATSSIDYDSDHLIQGIIRS--EFNKSTILTIAHR 1532

Query: 528  FIMATYLADKVIVFEG 543
             + +    D++IV + 
Sbjct: 1533 -LRSVIDYDRIIVMDA 1547

 Score = 32.0 bits (71), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 52/198 (26%), Positives = 83/198 (41%), Gaps = 20/198 (10%)

Query: 102  PGQVLGLVGTNGIGKSTALKILAGKQKPNLG--RFDDPPEWQEIIKYFRGSELQNYFTKM 159
            P   +G+VG  G GKST +  L    +P  G  + D     Q+I K      L+   T +
Sbjct: 1349 PQSKIGIVGRTGAGKSTIITALFRLLEPITGCIKIDG----QDISK-IDLVTLRRSITII 1403

Query: 160  LED------DIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKSPEDVKRYI----KIL 209
             +D       IK+ + P Y +   + I   + +V  +     E+     +R+     K L
Sbjct: 1404 PQDPILFAGTIKSNVDP-YDEYDEKKIFKALSQVNLISSHEFEEVLNSEERFNSTHNKFL 1462

Query: 210  QLENVLKRDIEKLSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAAQIIRSLLA 269
             L   +      LS GE Q   I  S ++E  + + DE +S +D         IIRS   
Sbjct: 1463 NLHTEIAEGGLNLSQGERQLLFIARSLLREPKIILLDEATSSIDYDSDHLIQGIIRSEFN 1522

Query: 270  PTKYVICVEHDL-SVLDY 286
             +  ++ + H L SV+DY
Sbjct: 1523 KST-ILTIAHRLRSVIDY 1539

>CAGL0E03982g 378205..383184 similar to sp|P32386 Saccharomyces
            cerevisiae YLL048c YBT1 yeast bile transporter, start by
            similarity
          Length = 1659

 Score = 33.9 bits (76), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 39/81 (48%), Gaps = 2/81 (2%)

Query: 207  KILQLENVLKRDIEKLSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAAQIIRS 266
            K L LEN +      LS G+ Q   +  + ++   V + DE ++ +D        Q IR+
Sbjct: 1524 KFLNLENEITEGGNNLSQGQKQLMCLARALLRNPKVILLDEATASIDYASDAKIQQTIRN 1583

Query: 267  LLAPTKYVICVEHDL-SVLDY 286
            +   +  V+ + H L SV+DY
Sbjct: 1584 VFDKST-VLTIAHRLRSVIDY 1603

>Scas_469.1
          Length = 609

 Score = 33.5 bits (75), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 42/76 (55%), Gaps = 10/76 (13%)

Query: 327 LRFRTEALQFRIADATEDLQ-NDSASRAFS--YPSLKKTQGDFVLNVEEGEF----SDSE 379
           +R +T A Q   A+A E+ Q N    R F+  Y  + K + D  ++ +  EF     +++
Sbjct: 91  VRHQTTAEQ---AEALENAQVNPFTGRDFTPKYFDILKIRRDLPVHAQRAEFLKIYQENQ 147

Query: 380 ILVMMGENGTGKTTLI 395
           I+V +GE G+GKTT I
Sbjct: 148 IMVFVGETGSGKTTQI 163

>Scas_707.8
          Length = 294

 Score = 33.1 bits (74), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 17/32 (53%), Positives = 21/32 (65%), Gaps = 1/32 (3%)

Query: 96  RLPTPRPGQVLGLVGTNGIGKSTALKILAGKQ 127
           +L  P   + L +VG NG GKST LK+LAGK 
Sbjct: 27  KLQVPWHTRTL-VVGANGAGKSTLLKLLAGKH 57

 Score = 33.1 bits (74), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 38/143 (26%), Positives = 61/143 (42%), Gaps = 26/143 (18%)

Query: 382 VMMGENGTGKTTLIKLLAG------------ALKP----DEGQDIPKLNVSMKPQKIAPK 425
           +++G NG GK+TL+KLLAG             L P       QD  K     K  ++   
Sbjct: 37  LVVGANGAGKSTLLKLLAGKHLCLNGKILVNGLDPFSPLSMYQDNDKTTAEDKDWQVTT- 95

Query: 426 FPGTV--------RQLFFKKIRGQFLNPQFQTDVVKPLRIDDI-IDQEVQHLSGGELQRV 476
           + GT         R +   ++        ++    K + I DI I+  +  LS G+ +RV
Sbjct: 96  YLGTEWCHMSIINRDIGVLELLESIGLAHYRDRGNKLIEILDININWRMHRLSDGQKRRV 155

Query: 477 AIVLALGIPADIYLIDEPSAYLD 499
            + + L  P  + L+DE +  LD
Sbjct: 156 QLAMGLLKPWRVLLLDEVTVDLD 178

>YGL091C (NBP35) [1892] chr7 complement(342057..343043) Putative
           nucleotide-binding protein, has similarity to bacterial
           partitioning ATPases [987 bp, 328 aa]
          Length = 328

 Score = 33.1 bits (74), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 20/81 (24%), Positives = 40/81 (49%), Gaps = 3/81 (3%)

Query: 377 DSEILVMMGENGTGKTTLIKLLAGALKPDEGQDIPKLNVSMKPQKIAPKFPGTVRQLFFK 436
           + +ILV+ G+ G GK+T   +L+ AL  DE   +  +++ +    + P   G +++   +
Sbjct: 72  EHKILVLSGKGGVGKSTFAAMLSWALSADEDLQVGAMDLDICGPSL-PHMLGCIKETVHE 130

Query: 437 KIRGQFLNPQFQTDVVKPLRI 457
              G    P + TD +  + I
Sbjct: 131 SNSG--WTPVYVTDNLATMSI 149

>Scas_586.3
          Length = 1531

 Score = 33.5 bits (75), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 40/170 (23%), Positives = 76/170 (44%), Gaps = 25/170 (14%)

Query: 367  VLNVEEGEFSDSEILVMMGENGTGKTTLIKLLA-----GALKPD-------EGQDIPKLN 414
            +LN  +G      +  +MG +G GKTTL+  LA     G +  D         +  P+  
Sbjct: 885  ILNNIDGWVKPGTLTALMGASGAGKTTLLDCLAQRVTVGTITGDVFVNGCLRDESFPRSI 944

Query: 415  VSMKPQKIAPKFPGTVRQ--LFFKKIRGQFLNP-----QFQTDVVKPLRIDDIIDQEV-- 465
               + Q +  K   TVR+   F   +R  F  P     ++  +++K L ++   D  V  
Sbjct: 945  GYCQQQDLHLK-TSTVRESLRFSAYLRQPFDVPVEEKNKYVEEIIKTLEMETYADAVVGV 1003

Query: 466  --QHLSGGELQRVAIVLALGI-PADIYLIDEPSAYLDSEQRIICSKVIRR 512
              + L+  + +R+ I + L   P  +  +DEP++ LDS+      +++++
Sbjct: 1004 PGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWATCQLMKK 1053

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 47/207 (22%), Positives = 82/207 (39%), Gaps = 52/207 (25%)

Query: 101  RPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKML 160
            +PG +  L+G +G GK+T L  LA  Q+  +G                G    N     L
Sbjct: 894  KPGTLTALMGASGAGKTTLLDCLA--QRVTVGTIT-------------GDVFVN---GCL 935

Query: 161  EDDIKAIIKPQYVDNIPRAIKGPVQK--------VGELLKLR----------MEKSPEDV 202
             D+           + PR+I    Q+        V E L+            +E+  + V
Sbjct: 936  RDE-----------SFPRSIGYCQQQDLHLKTSTVRESLRFSAYLRQPFDVPVEEKNKYV 984

Query: 203  KRYIKILQLENVLKRDI----EKLSGGELQRFAIGMSCVQEADVYMF-DEPSSYLDVKQR 257
            +  IK L++E      +    E L+  + +R  IG+    +  + +F DEP+S LD +  
Sbjct: 985  EEIIKTLEMETYADAVVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTA 1044

Query: 258  LNAAQIIRSLLAPTKYVICVEHDLSVL 284
                Q+++ L    + ++C  H  S +
Sbjct: 1045 WATCQLMKKLAQNGQAILCTIHQPSAI 1071

>YOR011W (AUS1) [4826] chr15 (349678..353862) Protein involved in
           sterol uptake and anaerobic growth, member of the
           ATP-binding cassette (ABC) superfamily of membrane
           transporters [4185 bp, 1394 aa]
          Length = 1394

 Score = 33.1 bits (74), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 35/65 (53%), Gaps = 1/65 (1%)

Query: 211 LENVLKRDIEK-LSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAAQIIRSLLA 269
           L+ ++  D  + +SGGE +R +I  + +    VY++D  +  LD    L+  +I+R +  
Sbjct: 160 LKTIVGNDFFRGVSGGERKRISIIETFIANGSVYLWDNSTKGLDSATALDFLEILRKMAK 219

Query: 270 PTKYV 274
            T+ V
Sbjct: 220 ATRSV 224

 Score = 30.8 bits (68), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 25/45 (55%)

Query: 355 SYPSLKKTQGDFVLNVEEGEFSDSEILVMMGENGTGKTTLIKLLA 399
           S+ ++  T G   L      F  S +  +MGE+G GKTTL+ +L+
Sbjct: 752 SWKNINYTVGTKKLINNASGFISSGLTALMGESGAGKTTLLNVLS 796

>Scas_717.6*
          Length = 1400

 Score = 33.1 bits (74), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 34/122 (27%), Positives = 57/122 (46%), Gaps = 14/122 (11%)

Query: 207 KILQL-ENVLKRDIEKLSGGELQRFAIGMSCVQEADVYMF-DEPSSYLDVKQRLNAAQII 264
           K+L+L  N L  D   L+  E +  +IG+  V +  + +F DEP+S LD +  L   Q +
Sbjct: 861 KLLKLPANTLVAD---LTPTEKKLLSIGVELVTKPSLLLFLDEPTSGLDAEAALTIVQFL 917

Query: 265 RSLLAPTKYVICVEH--DLSVLDYLSDFVCIIYGVPSVYGVVTLPASVREGINIFL--DG 320
           + L    + ++C  H    SV+ Y  +   +  G   VY        + +G + FL  D 
Sbjct: 918 KKLSLQGQAILCTIHQPSKSVIKYFDNIYLLKRGGECVYF-----GHIDDGCDYFLTHDE 972

Query: 321 HI 322
           H+
Sbjct: 973 HL 974

 Score = 30.8 bits (68), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 15/56 (26%), Positives = 29/56 (51%)

Query: 219 IEKLSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAAQIIRSLLAPTKYV 274
           +  +SGGE +R +I  + +    VY++D  +  LD    L    I++++   T+ V
Sbjct: 175 VRGVSGGERKRISIIETFIANGSVYLWDNSTKGLDSSTALEFLSILQTMARTTRSV 230

 Score = 30.0 bits (66), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 25/44 (56%)

Query: 363 QGDFVLNVEEGEFSDSEILVMMGENGTGKTTLIKLLAGALKPDE 406
           +GD  L  +   F  S +  +MGE+G GKTTL+ +L+  +   E
Sbjct: 757 EGDKQLINDCSGFISSGLTALMGESGAGKTTLLNVLSQRVTSGE 800

>CAGL0K12474g 1217183..1218067 similar to sp|P43569 Saccharomyces
           cerevisiae YFL028c CAF16 ATP-binding cassette
           transporter family member, start by similarity
          Length = 294

 Score = 32.3 bits (72), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 52/210 (24%), Positives = 87/210 (41%), Gaps = 34/210 (16%)

Query: 108 LVGTNGIGKSTALKILAGKQKPNLGRFD----DPPEWQEIIKYFRGSELQN--YFTKMLE 161
           +VG NG GKST LK+L+GK     G       DP     +      + ++N   F    E
Sbjct: 38  VVGANGAGKSTLLKLLSGKHLCLTGNIKVNGLDPFSPLSMTTSIDNTLIENDDGFGNKGE 97

Query: 162 DDIKAIIKPQY--VDNIPRAIKGPVQKVGELLKLRMEKSPEDVKRYIKILQLENVLKRDI 219
             +   +  ++  +  I R I   V ++ + +  +  K   D  R I IL ++  +   +
Sbjct: 98  CQVSTYLGTEWCHMSIINRDI--GVLELLDSIGYQFFKQRGD--RLIDILDID--VNWRM 151

Query: 220 EKLSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLN------------------AA 261
            +LS G+ +R  + M  ++   V + DE +  LDV  R+                   A 
Sbjct: 152 HRLSDGQKRRVQLAMGLLKPWRVLLLDEVTVDLDVIARMRLLDFLKWETTNRKCSVVYAT 211

Query: 262 QIIRSLLAPTKYVICVEHD--LSVLDYLSD 289
            I   L A   YV+ ++    +S LDY +D
Sbjct: 212 HIFDGLAAWPDYVLHMQSGKIVSKLDYKND 241

>CAGL0L07150g complement(795321..795743) similar to sp|P38985
           Saccharomyces cerevisiae YDL092w SRP14 signal
           recognition particle subunit, start by similarity
          Length = 140

 Score = 31.2 bits (69), Expect = 0.94,   Method: Composition-based stats.
 Identities = 20/61 (32%), Positives = 32/61 (52%), Gaps = 3/61 (4%)

Query: 184 VQKVGELLKLRMEKSPE---DVKRYIKILQLENVLKRDIEKLSGGELQRFAIGMSCVQEA 240
           +QK GEL K   EK       +KRYIK  Q+E  L++D  K    ++ + A  ++  + +
Sbjct: 14  LQKAGELFKTANEKKVTVHISIKRYIKDDQVEGNLEKDATKAPEYDVSKMARNIATKESS 73

Query: 241 D 241
           D
Sbjct: 74  D 74

>Kwal_27.11147
          Length = 323

 Score = 32.0 bits (71), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 35/84 (41%), Gaps = 4/84 (4%)

Query: 344 DLQNDSASRAFSYPSLKKTQGDFVLNVEEGEFSDSEILVMMGENGTGKTTLIKLLAGALK 403
           D  N  A++       K    D  L  E     D ++LV+ G+ G GK+T   LL  AL 
Sbjct: 34  DACNGCANKEICESLPKGPDPDIPLITENLSQIDHKVLVLSGKGGVGKSTFTSLLCWALS 93

Query: 404 PDEGQDIPKLNVSMKPQKIAPKFP 427
            DE   +  +++ +      P  P
Sbjct: 94  SDEDLQVGAMDLDI----CGPSLP 113

>Sklu_2062.2 YGL091C, Contig c2062 3197-4183
          Length = 328

 Score = 32.0 bits (71), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 21/101 (20%), Positives = 50/101 (49%), Gaps = 3/101 (2%)

Query: 379 EILVMMGENGTGKTTLIKLLAGALKPDEGQDIPKLNVSMKPQKIAPKFPGTVRQLFFKKI 438
           ++LV+ G+ G GK+T   +L+ AL  DE   +  +++ +    + P+  G V++   +  
Sbjct: 74  KVLVLSGKGGVGKSTFTTMLSWALSADEDLQVGAMDLDICGPSL-PRMLGCVKETVHESN 132

Query: 439 RGQFLNPQFQTDVVKPLRIDDIIDQEVQHLSGGELQRVAIV 479
            G    P +  D +  + I  ++ ++   +    L++ A++
Sbjct: 133 TG--WTPVYVADNLATMSIQFMLPEDDSAIIWRGLKKNALI 171

>YFR031C (SMC2) [1711] chr6 complement(216582..220094) Subunit of
            condensin protein complex required for chromosome
            condensation and segregation, coiled-coil protein of the
            SMC family [3513 bp, 1170 aa]
          Length = 1170

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 38/74 (51%), Gaps = 8/74 (10%)

Query: 209  LQLENVLKRDIEKLSGGELQRFAIGMSCVQE------ADVYMFDEPSSYLDVKQRLNAAQ 262
            ++L N+ K  + +LSGG  QR  I +S +        A +Y+ DE  + LD+    N   
Sbjct: 1071 VKLGNIWKESLIELSGG--QRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGH 1128

Query: 263  IIRSLLAPTKYVIC 276
            +I++    +++++ 
Sbjct: 1129 LIKTRFKGSQFIVV 1142

>CAGL0F01419g complement(142623..146819) highly similar to tr|Q08409
           Saccharomyces cerevisiae YOR011w AUS1, start by
           similarity
          Length = 1398

 Score = 32.3 bits (72), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 44/198 (22%), Positives = 87/198 (43%), Gaps = 20/198 (10%)

Query: 107 GLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLEDDIKA 166
            L+G +G GK+T L +L+ + +  +          EI+   +    +N F + +      
Sbjct: 784 ALMGESGAGKTTLLNVLSQRTESGVVS-------GEILIDGKPLTNENAFRRSI-----G 831

Query: 167 IIKPQYVDNIPRAIKGPVQKVGELLKLRMEKSPEDVKRYIKILQLENVLKRDIEKLSGGE 226
            ++ Q +      +K  ++   E   LR +   E V+   ++L+L   L   + +L+  +
Sbjct: 832 FVQQQDIHLELLTVKESLEISSE---LRGDGDMEYVESISELLKLP--LDSLVRELNPTQ 886

Query: 227 LQRFAIGMSCVQEADVYMF-DEPSSYLDVKQRLNAAQIIRSLLAPTKYVICVEH--DLSV 283
            +  +IG+  V +  + +F DEP+S LD +  L   Q ++ L    + + C  H    SV
Sbjct: 887 RKLLSIGVELVTKPSLLLFLDEPTSGLDAEAALTIVQFLKKLSLQGQAIFCTIHQPSKSV 946

Query: 284 LDYLSDFVCIIYGVPSVY 301
           + Y  +   +  G   VY
Sbjct: 947 ISYFDNIYLLKRGGECVY 964

 Score = 32.0 bits (71), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 34/156 (21%), Positives = 74/156 (47%), Gaps = 17/156 (10%)

Query: 378 SEILVMMGENGTGKTTLIKLLAGALKPDEGQDIPKLNVSMKPQKIAPKFPGTVRQLFFKK 437
           S +  +MGE+G GKTTL+ +L+   + + G    ++ +  KP      F  ++  +  + 
Sbjct: 780 SGLTALMGESGAGKTTLLNVLSQ--RTESGVVSGEILIDGKPLTNENAFRRSIGFVQQQD 837

Query: 438 IRGQFLNPQFQTDVVKPLRID-DI-------------IDQEVQHLSGGELQRVAIVLALG 483
           I  + L  +   ++   LR D D+             +D  V+ L+  + + ++I + L 
Sbjct: 838 IHLELLTVKESLEISSELRGDGDMEYVESISELLKLPLDSLVRELNPTQRKLLSIGVELV 897

Query: 484 I-PADIYLIDEPSAYLDSEQRIICSKVIRRFILHNK 518
             P+ +  +DEP++ LD+E  +   + +++  L  +
Sbjct: 898 TKPSLLLFLDEPTSGLDAEAALTIVQFLKKLSLQGQ 933

 Score = 30.0 bits (66), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 15/53 (28%), Positives = 28/53 (52%)

Query: 222 LSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAAQIIRSLLAPTKYV 274
           +SGGE +R +I  + +    VY++D  +  LD    L+   I++ +   T+ V
Sbjct: 181 VSGGERKRISIIETFIANGSVYLWDNSTKGLDSSTALDFLTILQKMARTTRSV 233

>AAR180C [368] [Homologous to ScYGL120C (PRP43) - SH]
           (665711..668011) [2301 bp, 766 aa]
          Length = 766

 Score = 32.0 bits (71), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 39/74 (52%), Gaps = 8/74 (10%)

Query: 328 RFRTEALQFRIADATEDLQNDSASRAFS--YPSLKKTQGDFVLNVEEGEF----SDSEIL 381
           R +T A Q R  +  E+  N    + FS  Y  + K + D  ++ +  EF     +++++
Sbjct: 55  RHKTTASQARQLEDGEN--NPFTGKPFSENYVKILKVRRDLPVHAQRDEFLKMYQENQVM 112

Query: 382 VMMGENGTGKTTLI 395
           V +GE G+GKTT I
Sbjct: 113 VFVGETGSGKTTQI 126

>Kwal_14.1242
          Length = 269

 Score = 31.6 bits (70), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 12/20 (60%), Positives = 17/20 (85%)

Query: 108 LVGTNGIGKSTALKILAGKQ 127
           ++G+NG GKST LK+L+GK 
Sbjct: 37  IIGSNGAGKSTLLKLLSGKH 56

 Score = 29.6 bits (65), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 11/19 (57%), Positives = 17/19 (89%)

Query: 382 VMMGENGTGKTTLIKLLAG 400
           +++G NG GK+TL+KLL+G
Sbjct: 36  LIIGSNGAGKSTLLKLLSG 54

>Scas_612.11*
          Length = 1506

 Score = 32.0 bits (71), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 37/153 (24%), Positives = 66/153 (43%), Gaps = 33/153 (21%)

Query: 365 DFVLNVEEGEFSDSEILVMMGENGTGKTTLIKLLAGALKPDEGQ----------DIPKL- 413
           D    +++GEF     ++M+G  GTGKT+L+   AG +    G+            P + 
Sbjct: 651 DLNFEIKKGEF-----IIMVGPIGTGKTSLLNAFAGFMNKVSGRIQINGDLLLCGYPWIQ 705

Query: 414 NVSMKPQKI------APKFPGTVRQLFFKKIRGQFLNPQFQTDVVKPLRIDDIIDQEVQH 467
           N S+K   I        K+   +R    K             D++    + +I ++ +  
Sbjct: 706 NASVKDNIIFGSPYNKAKYDEVIRVCSLKS----------DLDILPAGDLTEIGERGIT- 754

Query: 468 LSGGELQRVAIVLALGIPADIYLIDEPSAYLDS 500
           LSGG+  R+ +  ++    DIYL D+  + +DS
Sbjct: 755 LSGGQKARINLARSVYKQKDIYLFDDVLSAVDS 787

 Score = 30.8 bits (68), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 45/193 (23%), Positives = 76/193 (39%), Gaps = 23/193 (11%)

Query: 101 RPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKML 160
           + G+ + +VG  G GK++ L   AG      GR               G  L   +  + 
Sbjct: 657 KKGEFIIMVGPIGTGKTSLLNAFAGFMNKVSGRIQ-----------INGDLLLCGYPWIQ 705

Query: 161 EDDIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKSPEDVKRYIKILQLENVLKRDIE 220
              +K        DNI         K  E++++   KS  D+   +    L  + +R I 
Sbjct: 706 NASVK--------DNIIFGSPYNKAKYDEVIRVCSLKSDLDI---LPAGDLTEIGERGI- 753

Query: 221 KLSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAAQIIRSLLAPTKYVICVEHD 280
            LSGG+  R  +  S  ++ D+Y+FD+  S +D +   +        L   K  I   H 
Sbjct: 754 TLSGGQKARINLARSVYKQKDIYLFDDVLSAVDSRVGKHIMDECFLGLLKDKTRILATHQ 813

Query: 281 LSVLDYLSDFVCI 293
           LS+L+  S  + +
Sbjct: 814 LSLLERASRVIVL 826

>CAGL0D05258g 500858..504370 similar to sp|P38989 Saccharomyces
            cerevisiae YFR031c SMC2 chromosome segregation protein,
            start by similarity
          Length = 1170

 Score = 32.0 bits (71), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 38/74 (51%), Gaps = 8/74 (10%)

Query: 209  LQLENVLKRDIEKLSGGELQRFAIGMSCVQE------ADVYMFDEPSSYLDVKQRLNAAQ 262
            ++L N+ K  + +LSGG  QR  I +S +        A +Y+ DE  + LD+    N   
Sbjct: 1071 VKLGNLWKESLVELSGG--QRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGH 1128

Query: 263  IIRSLLAPTKYVIC 276
            +I++    +++++ 
Sbjct: 1129 LIKTRFKGSQFIVV 1142

>AFR152C [3344] [Homologous to ScYFL028C (CAF16) - SH]
           (710017..710829) [813 bp, 270 aa]
          Length = 270

 Score = 31.2 bits (69), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 13/20 (65%), Positives = 16/20 (80%)

Query: 108 LVGTNGIGKSTALKILAGKQ 127
           L G+NG GKST LK+L+GK 
Sbjct: 39  LCGSNGAGKSTLLKLLSGKH 58

 Score = 30.8 bits (68), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 45/193 (23%), Positives = 81/193 (41%), Gaps = 23/193 (11%)

Query: 381 LVMMGENGTGKTTLIKLLAGA-------LKPDEGQDIPKLNVSMKPQKIAPKFPGT---- 429
           +++ G NG GK+TL+KLL+G        ++ D        N +     +   + GT    
Sbjct: 37  MLLCGSNGAGKSTLLKLLSGKHLCRSGNIRVDGRDPFAPANTADPADVMVTAYLGTEWCH 96

Query: 430 ----VRQLFFKKIRGQFLNPQFQTDVVKPLRIDDI-IDQEVQHLSGGELQRVAIVLALGI 484
                R +  +++        F+    + LRI D+ +   +  LS G+ +RV + + L  
Sbjct: 97  MAIVHRDIGVQELLDSIGLQHFRERGTELLRILDVDLRWRMHRLSDGQKRRVQLCMGLLK 156

Query: 485 PADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIVFEGI 544
           P  + L+DE +  LD   R   +K++    L  ++     E   I AT++ D +  +   
Sbjct: 157 PFKLLLLDEVTVDLDVVAR---TKLLHFLRLETERR----ECSIIYATHIFDGLADWPDR 209

Query: 545 PSKNAHARAPESL 557
               AH R    L
Sbjct: 210 VVHIAHGRVLADL 222

>Kwal_34.15770
          Length = 1436

 Score = 32.0 bits (71), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 46/211 (21%), Positives = 85/211 (40%), Gaps = 29/211 (13%)

Query: 358 SLKKTQGDFVLNVEEGEFSDSEILVMMGENGTGKTTLIKLLAGALKPDEGQDIPKLNVSM 417
           S  +   DF L     EF   ++ V++G  G+GKT+L+  L G +   EG+        +
Sbjct: 483 SWDRKNPDFKLKNMSIEFRLGKLNVVIGPTGSGKTSLLMGLLGEMDLLEGKVYAP---CL 539

Query: 418 KPQK-IAPKFPGTVRQLFFKKIRGQFLNPQFQTDVV-----KPLRIDDII-------DQE 464
            P++ +  +  G    + +       LN   + +++        R D ++       D E
Sbjct: 540 DPREDLIVENDGMTNSIAYCSQGAWLLNDTVKNNILFSSPFNEARYDAVVEACGLKRDFE 599

Query: 465 VQH-------------LSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIR 511
           +               LSGG+ QRV++  AL   +   L+D+  + +DS   +   +   
Sbjct: 600 ILSAGDQTEIGEKGITLSGGQKQRVSLARALYSSSRHLLLDDCLSAVDSHTALWIYENCI 659

Query: 512 RFILHNKKTAFIVEHDFIMATYLADKVIVFE 542
              L   +T  +V H+  +    AD V+  E
Sbjct: 660 TGPLMEGRTCILVSHNVALTLKNADWVVFME 690

 Score = 32.0 bits (71), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 39/81 (48%), Gaps = 2/81 (2%)

Query: 207  KILQLENVLKRDIEKLSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAAQIIRS 266
            K L+L+N +      LS G+ Q   +  S ++   V + DE ++ +D        Q IR 
Sbjct: 1301 KFLRLDNEITEGGANLSQGQRQLVCLARSLLRSPKVMLLDEATASIDYTSDARIQQTIRG 1360

Query: 267  LLAPTKYVICVEHDL-SVLDY 286
              + +  ++ + H L S++DY
Sbjct: 1361 EFSNST-ILTIAHRLRSIIDY 1380

>Kwal_56.22710
          Length = 348

 Score = 31.6 bits (70), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 44/87 (50%), Gaps = 10/87 (11%)

Query: 302 GVVTLPASVREGINI-------FLDGHIPAENLRFRTEALQFRIADATEDLQNDSASRAF 354
           GVVT P+  ++ +N+       F   ++PA ++ +R E L F+    T D +   +S   
Sbjct: 227 GVVTSPS--QKAVNVSLSPESSFFGDYVPASSIMWRKERL-FKNVSTTPDAERFQSSVQG 283

Query: 355 SYPSLKKTQGDFVLNVEEGEFSDSEIL 381
           +Y SLK+T     L + + E   +E+L
Sbjct: 284 AYDSLKETSEKDFLTLTKNEKKIAELL 310

>KLLA0E14410g 1268901..1270691 similar to sp|P25808 Saccharomyces
           cerevisiae YFL002c SPB4 ATP-dependent RNA helicase of
           DEAH box family, start by similarity
          Length = 596

 Score = 31.6 bits (70), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 39/72 (54%), Gaps = 6/72 (8%)

Query: 254 VKQRLNAAQIIRS-----LLAPTKYVICVEHDLSVLDYLSDFVCIIYGVPSVYGVVTLPA 308
           +K+  N+A+  +S     +++PT+ +    HD+ + D+L  +   +Y + S   V T  A
Sbjct: 70  IKEEANSAKFKKSHFHSLIISPTRELASQIHDV-IEDFLKYYPDNLYPIRSQLLVGTSSA 128

Query: 309 SVREGINIFLDG 320
           SVR+ IN F D 
Sbjct: 129 SVRDDINSFTDN 140

>Kwal_56.23638
          Length = 4922

 Score = 31.6 bits (70), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 29/43 (67%), Gaps = 4/43 (9%)

Query: 378 SEILVMMGENGTGKTTLIKLLAGALKPDEGQDIPKLNVSMKPQ 420
           SE ++++GE GTGKTT+++ +A A+     Q +  +NVS + +
Sbjct: 649 SEPVLLVGETGTGKTTVVQQVAKAV----NQRLTVINVSQQTE 687

>CAGL0G00242g complement(20428..24861) highly similar to sp|P53049
           Saccharomyces cerevisiae YGR281w YOR1 ATP-binding
           cassette transporter protein, hypothetical start
          Length = 1477

 Score = 31.2 bits (69), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 36/66 (54%), Gaps = 4/66 (6%)

Query: 222 LSGGELQRFAIGMSCVQEADVYMFDEPSSYLD--VKQRLNAAQIIRSLLAPTKYVICVEH 279
           LSGG+  R  +  S  +  D+Y+FD+  S +D  V + +     +++L + T+  I   H
Sbjct: 723 LSGGQKARINLARSVYKNKDIYLFDDVLSAVDSRVGKHIMDECFLQTLQSKTR--ILATH 780

Query: 280 DLSVLD 285
            LS+++
Sbjct: 781 QLSLIE 786

>Sklu_2140.2 YER173W, Contig c2140 1850-3868
          Length = 672

 Score = 30.8 bits (68), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 19/29 (65%)

Query: 376 SDSEILVMMGENGTGKTTLIKLLAGALKP 404
           SD  IL++ G  G  K+TLIKLLA  L P
Sbjct: 112 SDCRILLLTGPAGCSKSTLIKLLAEELIP 140

>Scas_565.6
          Length = 1170

 Score = 30.8 bits (68), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 18/74 (24%), Positives = 38/74 (51%), Gaps = 8/74 (10%)

Query: 209  LQLENVLKRDIEKLSGGELQRFAIGMSCVQE------ADVYMFDEPSSYLDVKQRLNAAQ 262
            ++L N+ K  + +LSGG  QR  + +S +        A +Y+ DE  + LD+    N   
Sbjct: 1071 VKLGNLWKDSLVELSGG--QRSLVALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGH 1128

Query: 263  IIRSLLAPTKYVIC 276
            +I++    +++++ 
Sbjct: 1129 LIKTRFKGSQFIVV 1142

>Scas_720.7
          Length = 332

 Score = 30.0 bits (66), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 19/79 (24%), Positives = 37/79 (46%), Gaps = 3/79 (3%)

Query: 379 EILVMMGENGTGKTTLIKLLAGALKPDEGQDIPKLNVSMKPQKIAPKFPGTVRQLFFKKI 438
           +ILV+ G+ G GK+T   +L+ AL  DE   +  +++ +    + P   G   ++  +  
Sbjct: 78  KILVLSGKGGVGKSTFTTMLSWALSADEDLQVGAMDLDICGPSL-PHMLGCTAEVVHESN 136

Query: 439 RGQFLNPQFQTDVVKPLRI 457
            G    P +  D +  + I
Sbjct: 137 SG--WTPVYVADNLAAMSI 153

>KLLA0B00561g 42284..44587 highly similar to sp|P53131 Saccharomyces
           cerevisiae YGL120c PRP43 involved in spliceosome
           disassembly, start by similarity
          Length = 767

 Score = 30.4 bits (67), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 36/67 (53%), Gaps = 11/67 (16%)

Query: 339 ADATEDLQNDS------ASRAFSYPSLKKTQGDFVLNVEEGEF----SDSEILVMMGENG 388
           ADA E L+N S       S +  Y  + K + D  ++ +  EF     +++I+V +GE G
Sbjct: 60  ADA-ERLENGSVNPFTGGSLSEKYFGILKVRRDLPVHAQRDEFLKIYQENQIMVFVGETG 118

Query: 389 TGKTTLI 395
           +GKTT I
Sbjct: 119 SGKTTQI 125

>CAGL0F07139g complement(698363..700669) highly similar to sp|P53131
           Saccharomyces cerevisiae YGL120c PRP43, start by
           similarity
          Length = 768

 Score = 30.4 bits (67), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 26/44 (59%), Gaps = 4/44 (9%)

Query: 356 YPSLKKTQGDFVLNVEEGEF----SDSEILVMMGENGTGKTTLI 395
           Y  + K + D  ++ +  EF     +++I+V +GE G+GKTT I
Sbjct: 86  YFGILKVRKDLPVHAQRAEFLKIYQENQIMVFVGETGSGKTTQI 129

>ACL072C [977] [Homologous to ScYLL048C (YBT1) - SH; ScYHL035C - SH]
           (224562..229445) [4884 bp, 1627 aa]
          Length = 1627

 Score = 30.4 bits (67), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 42/195 (21%), Positives = 82/195 (42%), Gaps = 29/195 (14%)

Query: 374 EFSDSEILVMMGENGTGKTTLIKLLAGALKPDEGQ-DIPKLNVSMKPQKIAPKFPGTVRQ 432
           EF   ++ V  G  GTGK++L+  L G +   EG+  +P L+     + +  +  G    
Sbjct: 696 EFMIGKLNVAFGPTGTGKSSLLLGLLGEMTLQEGKIYVPSLD---PREDLVIQADGLTNS 752

Query: 433 LFFKKIRGQFLNPQFQTDVV-----KPLRIDDI--------------------IDQEVQH 467
           + +       LN   +++++        R +D+                    I ++   
Sbjct: 753 IAYCSQSAWLLNDTARSNILFNSPYNEQRYNDVLEACGLKKDFEILSGGDLTQIGEKGMT 812

Query: 468 LSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHD 527
           LSGG+ QR+++  AL   A   L+D+  + +DS   ++  +      L   +T  +V H+
Sbjct: 813 LSGGQKQRISLARALYSSARHLLLDDCLSAVDSHTALLIYENCIIGPLMEGRTCVLVSHN 872

Query: 528 FIMATYLADKVIVFE 542
             +    AD V++ E
Sbjct: 873 VALTMRNADWVVILE 887

>YNR011C (PRP2) [4594] chr14 complement(644319..646949) Pre-mRNA
           splicing factor and RNA-dependent ATPase of DEAH box
           family, required for first catalytic event of pre-mRNA
           splicing [2631 bp, 876 aa]
          Length = 876

 Score = 30.0 bits (66), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 31/51 (60%), Gaps = 4/51 (7%)

Query: 374 EFSDSEILVMMGENGTGKTTLIKLLAGALKPDEGQDIPKLNVSM-KPQKIA 423
           E   +++L++MGE G+GKTT    L   L  D   D  KL +++ +P+++A
Sbjct: 235 EIKKNQVLIIMGETGSGKTT---QLPQYLVEDGFTDQGKLQIAITQPRRVA 282

>YER013W (PRP22) [1436] chr5 (178840..182277) Pre-mRNA splicing
           factor of DEAH box family, required for release of
           mature mRNA from the spliceosome [3438 bp, 1145 aa]
          Length = 1145

 Score = 30.0 bits (66), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 30/136 (22%), Positives = 63/136 (46%), Gaps = 20/136 (14%)

Query: 377 DSEILVMMGENGTGKTTLIKLLAGALKPDEGQDIPKLNVSMKPQKIAPKFPGTVRQLFFK 436
           D++ LV++GE G+GKTT I         +EG     +    +P+++A         +   
Sbjct: 498 DNQFLVIVGETGSGKTTQITQYLD----EEGFSNYGMIGCTQPRRVAA--------VSVA 545

Query: 437 KIRGQFLNPQFQTDVVKPLRIDDII--DQEVQHLSGGELQRVAIVLALGIPADIYLIDEP 494
           K   + +  +   DV   +R +D+   D  +++++ G LQR A++        + ++DE 
Sbjct: 546 KRVAEEVGCKVGHDVGYTIRFEDVTGPDTRIKYMTDGMLQREALLDPEMSKYSVIMLDE- 604

Query: 495 SAYLDSEQRIICSKVI 510
                + +R + + V+
Sbjct: 605 -----AHERTVATDVL 615

>Sklu_2035.3 YBR186W, Contig c2035 2344-3764 reverse complement
          Length = 474

 Score = 29.6 bits (65), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 48/104 (46%), Gaps = 12/104 (11%)

Query: 322 IPAENLRFRTEALQFRIADATEDLQNDSASRAFSYP--SLKKTQGDFVLNVEEGEFSDSE 379
           +P+  +    E+L F         +++   + FSY   SLK +Q     ++     ++++
Sbjct: 202 LPSNTIEGMWESLYF---------EDNVKQKLFSYATISLKMSQMS-TKSISSTLIANNK 251

Query: 380 ILVMMGENGTGKTTLIKLLAGALKPDEGQDIPKLNVSMKPQKIA 423
           +L++ G  GTGKTT+ K L   L   + + I  L  +  P  I 
Sbjct: 252 LLLVHGPPGTGKTTVCKALCQKLAIRQNESIDSLKTNCHPTIIV 295

>Kwal_14.1591
          Length = 640

 Score = 30.0 bits (66), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 31/66 (46%), Gaps = 10/66 (15%)

Query: 67  FDAIQIINLPTNLEAHVTHRYSANSFKLHRLPTPRPGQV----LGLVGTNGIGKSTALKI 122
            D IQI+ +   LE     +  AN      L  P PGQ     +GLVG   +GKS+ +  
Sbjct: 304 LDKIQILKI-DQLEELFLSKAPANP-----LQAPLPGQSPIIQIGLVGYPNVGKSSTINA 357

Query: 123 LAGKQK 128
           L G +K
Sbjct: 358 LVGSKK 363

>YLR106C (MDN1) [3521] chr12 complement(349007..363739) Nuclear
           protein that may act as a chaperone [14733 bp, 4910 aa]
          Length = 4910

 Score = 29.6 bits (65), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 28/43 (65%), Gaps = 4/43 (9%)

Query: 378 SEILVMMGENGTGKTTLIKLLAGALKPDEGQDIPKLNVSMKPQ 420
           +E ++++GE GTGKTT+++ LA  L     + +  +NVS + +
Sbjct: 646 TEPVLLVGETGTGKTTVVQQLAKML----AKKLTVINVSQQTE 684

>Kwal_33.13308
          Length = 706

 Score = 29.6 bits (65), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 38/73 (52%)

Query: 221 KLSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAAQIIRSLLAPTKYVICVEHD 280
           +LSGG+ QR A+  + + + D+ + DE +S LD +     A+ + S     K  I + H 
Sbjct: 581 QLSGGQKQRIALARAFLLDPDLLILDEATSALDSRSEEVVARALYSRSTRGKTTISIAHR 640

Query: 281 LSVLDYLSDFVCI 293
           +S + + S  + +
Sbjct: 641 VSTIQHSSRVIVL 653

>Kwal_26.9532
          Length = 1471

 Score = 29.6 bits (65), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 12/34 (35%), Positives = 21/34 (61%)

Query: 222 LSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVK 255
           LSGG+  R  +  S  ++ D+Y+FD+  S +D +
Sbjct: 700 LSGGQKARINLARSVYKKKDIYLFDDVLSAVDAR 733

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.321    0.139    0.403 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 19,826,016
Number of extensions: 901856
Number of successful extensions: 3744
Number of sequences better than 10.0: 185
Number of HSP's gapped: 3650
Number of HSP's successfully gapped: 442
Length of query: 598
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 491
Effective length of database: 12,891,983
Effective search space: 6329963653
Effective search space used: 6329963653
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 64 (29.3 bits)