Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YDR089W86985443280.0
Scas_636.1283789612041e-152
Kwal_56.2341082587411521e-145
CAGL0C03696g83187510501e-130
KLLA0F14509g8519019121e-109
AGR160W8368939031e-108
AGR223W1321109850.063
Sklu_2202.81367111840.086
Kwal_23.374131290790.19
KLLA0F00660g137434760.62
Kwal_27.1229221733721.1
CAGL0K07073g112098741.1
YPL110C1223112731.5
YPL019C (VTC3)83566731.5
CAGL0J07040g124533731.7
Kwal_23.506083595722.2
Kwal_27.127511093154694.3
AFR326W1309154677.6
KLLA0E20317g614109678.0
Scas_625.24588115678.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YDR089W
         (854 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YDR089W (YDR089W) [941] chr4 (622106..624715) Protein containing...  1671   0.0  
Scas_636.12                                                           468   e-152
Kwal_56.23410                                                         448   e-145
CAGL0C03696g complement(367135..369630) similar to sp|P38966 Sac...   409   e-130
KLLA0F14509g complement(1345334..1347889) weakly similar to sp|P...   355   e-109
AGR160W [4471] [Homologous to ScYDR089W - SH] complement(1045983...   352   e-108
AGR223W [4534] [Homologous to ScYPL110C - SH] complement(1167870...    37   0.063
Sklu_2202.8 YPL110C, Contig c2202 8829-12932                           37   0.086
Kwal_23.3741                                                           35   0.19 
KLLA0F00660g 54232..58356 similar to sgd|S0006031 Saccharomyces ...    34   0.62 
Kwal_27.12292                                                          32   1.1  
CAGL0K07073g complement(693824..697186) similar to sp|P38329 Sac...    33   1.1  
YPL110C (YPL110C) [5334] chr16 complement(341067..344738) Member...    33   1.5  
YPL019C (VTC3) [5418] chr16 complement(514507..517014) Subunit o...    33   1.5  
CAGL0J07040g 675389..679126 similar to tr|Q02979 Saccharomyces c...    33   1.7  
Kwal_23.5060                                                           32   2.2  
Kwal_27.12751                                                          31   4.3  
AFR326W [3518] [Homologous to ScYDR011W (SNQ2 ) - NSH; ScYNR070W...    30   7.6  
KLLA0E20317g complement(1796579..1798423) weakly similar to sp|P...    30   8.0  
Scas_625.24                                                            30   8.1  

>YDR089W (YDR089W) [941] chr4 (622106..624715) Protein containing a
           SYG1, Pho81 and XPR1 (SPX) N-terminal domain, which may
           be involved in G protein associated signal transduction,
           has weak similarity to uncharacterized C. albicans
           Orf6.8826p [2610 bp, 869 aa]
          Length = 869

 Score = 1671 bits (4328), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 830/854 (97%), Positives = 830/854 (97%)

Query: 1   MKFEDRILNKSIPEWKFYNINYEKLKVAIKKVTAYDYDNPNDSGMEKLLNQCSVAFDQEF 60
           MKFEDRILNKSIPEWKFYNINYEKLKVAIKKVTAYDYDNPNDSGMEKLLNQCSVAFDQEF
Sbjct: 1   MKFEDRILNKSIPEWKFYNINYEKLKVAIKKVTAYDYDNPNDSGMEKLLNQCSVAFDQEF 60

Query: 61  QNVNLFVSLKIKEISTRILSVESSIIDFSKGLNKTSRNRFNLRKLKIINAHVDDCNFELQ 120
           QNVNLFVSLKIKEISTRILSVESSIIDFSKGLNKTSRNRFNLRKLKIINAHVDDCNFELQ
Sbjct: 61  QNVNLFVSLKIKEISTRILSVESSIIDFSKGLNKTSRNRFNLRKLKIINAHVDDCNFELQ 120

Query: 121 LLSRFLIIQRIALRKLFKKLLNEFPQDSENPLTASEYVTSIRNSESLRNGHEGISFMKLD 180
           LLSRFLIIQRIALRKLFKKLLNEFPQDSENPLTASEYVTSIRNSESLRNGHEGISFMKLD
Sbjct: 121 LLSRFLIIQRIALRKLFKKLLNEFPQDSENPLTASEYVTSIRNSESLRNGHEGISFMKLD 180

Query: 181 LDPYLLEVSLIVDVLHDLENKLEDATEPAVEQRSLNRSDESAHTSSSPEANNSSLPASPR 240
           LDPYLLEVSLIVDVLHDLENKLEDATEPAVEQRSLNRSDESAHTSSSPEANNSSLPASPR
Sbjct: 181 LDPYLLEVSLIVDVLHDLENKLEDATEPAVEQRSLNRSDESAHTSSSPEANNSSLPASPR 240

Query: 241 SIPLLSNKKTSKMIDSSLEFDTALIDKAENLGRFLLSSEDIEGLKFMLLNIGFRIIDDSI 300
           SIPLLSNKKTSKMIDSSLEFDTALIDKAENLGRFLLSSEDIEGLKFMLLNIGFRIIDDSI
Sbjct: 241 SIPLLSNKKTSKMIDSSLEFDTALIDKAENLGRFLLSSEDIEGLKFMLLNIGFRIIDDSI 300

Query: 301 ISTSKEILDTTDNINSAGNKSIRSAKSFNDLQHTLSLSKQKNILPSAVQSNEKYVSISIL 360
           ISTSKEILDTTDNINSAGNKSIRSAKSFNDLQHTLSLSKQKNILPSAVQSNEKYVSISIL
Sbjct: 301 ISTSKEILDTTDNINSAGNKSIRSAKSFNDLQHTLSLSKQKNILPSAVQSNEKYVSISIL 360

Query: 361 DTVGNEGSPLLLTDDNINQHPNMIVSSTAEDTCIVMCHVGGLRNHVVTNDLLLRDVKNIL 420
           DTVGNEGSPLLLTDDNINQHPNMIVSSTAEDTCIVMCHVGGLRNHVVTNDLLLRDVKNIL
Sbjct: 361 DTVGNEGSPLLLTDDNINQHPNMIVSSTAEDTCIVMCHVGGLRNHVVTNDLLLRDVKNIL 420

Query: 421 SAMRSGNDTKNISALINSLDPSPISKIALEWIQSHRLKTIEPKLDFKRTRFISADNGDIY 480
           SAMRSGNDTKNISALINSLDPSPISKIALEWIQSHRLKTIEPKLDFKRTRFISADNGDIY
Sbjct: 421 SAMRSGNDTKNISALINSLDPSPISKIALEWIQSHRLKTIEPKLDFKRTRFISADNGDIY 480

Query: 481 LIALDESITIGNVSTLPFPILEIKKLSRSSGLSQTAINEDNKFKQLMKSVVTNEFQCSLI 540
           LIALDESITIGNVSTLPFPILEIKKLSRSSGLSQTAINEDNKFKQLMKSVVTNEFQCSLI
Sbjct: 481 LIALDESITIGNVSTLPFPILEIKKLSRSSGLSQTAINEDNKFKQLMKSVVTNEFQCSLI 540

Query: 541 PPDLTTWKICLELVHSNELQNDLFQLLLRDQYKLNSDDSLSPDEFFQLGKDRLEEEFDLT 600
           PPDLTTWKICLELVHSNELQNDLFQLLLRDQYKLNSDDSLSPDEFFQLGKDRLEEEFDLT
Sbjct: 541 PPDLTTWKICLELVHSNELQNDLFQLLLRDQYKLNSDDSLSPDEFFQLGKDRLEEEFDLT 600

Query: 601 GPINNSQGSVDSGRRVRIHKKSKQSDNETKKKPIRYWNEFDEQEEDNLDNAFYIDTNGSR 660
           GPINNSQGSVDSGRRVRIHKKSKQSDNETKKKPIRYWNEFDEQEEDNLDNAFYIDTNGSR
Sbjct: 601 GPINNSQGSVDSGRRVRIHKKSKQSDNETKKKPIRYWNEFDEQEEDNLDNAFYIDTNGSR 660

Query: 661 STTDNEESLLLRNSPPDYGFILFSRNFINRTYDFCEKLRNLIRHDKKTSPDLFQNSKHPH 720
           STTDNEESLLLRNSPPDYGFILFSRNFINRTYDFCEKLRNLIRHDKKTSPDLFQNSKHPH
Sbjct: 661 STTDNEESLLLRNSPPDYGFILFSRNFINRTYDFCEKLRNLIRHDKKTSPDLFQNSKHPH 720

Query: 721 CSSTNYGSVASFGSQSTSASYDDVQRYLQYQQQDIEDSQSIYEYRHDEVVTFLYLSALLT 780
           CSSTNYGSVASFGSQSTSASYDDVQRYLQYQQQDIEDSQSIYEYRHDEVVTFLYLSALLT
Sbjct: 721 CSSTNYGSVASFGSQSTSASYDDVQRYLQYQQQDIEDSQSIYEYRHDEVVTFLYLSALLT 780

Query: 781 SCIMASVCLGIVLSLFRGQSNNEIDLEIQNXXXXXXXXXXXXXXXXXXXXXXXXFSRFTL 840
           SCIMASVCLGIVLSLFRGQSNNEIDLEIQN                        FSRFTL
Sbjct: 781 SCIMASVCLGIVLSLFRGQSNNEIDLEIQNILIAIIIISLLVSLILICACLLLLFSRFTL 840

Query: 841 APIWHYVGCFTMFF 854
           APIWHYVGCFTMFF
Sbjct: 841 APIWHYVGCFTMFF 854

>Scas_636.12
          Length = 837

 Score =  468 bits (1204), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 327/896 (36%), Positives = 482/896 (53%), Gaps = 118/896 (13%)

Query: 1   MKFEDRILNKSIPEWKFYNINYEKLKVAIKKVTAYDYDNPNDSGMEKLLNQCSVAFDQEF 60
           M F   +L+KS+P+WK  N+ Y+KLK AI + T               L      F ++F
Sbjct: 1   MNFSSHVLDKSVPQWKHQNLEYDKLKKAIMRHTR--------------LETLDAMFKEQF 46

Query: 61  QNVNLFVSLKIKEISTRILSVESSIIDFSKGLNKTSRNRFNLRKLKIINAHVDDCNFELQ 120
           QN+NLFVSLKIKEISTRI+SVE+SI+   + + K   N       KI+ +HV+DCN ELQ
Sbjct: 47  QNINLFVSLKIKEISTRIMSVEASIL--QQTMRKGPSN------FKIVFSHVNDCNEELQ 98

Query: 121 LLSRFLIIQRIALRKLFKKLLNEFPQDSENPLTASEYVTSIRNSESLRNGHEGISFMKLD 180
           +LSR+LI+Q++A++KL ++L++      +      E+VT +  S+  +NG++G+SF KLD
Sbjct: 99  MLSRYLIVQKLAVKKLLRRLISS----HDGSAVVEEWVTELYQSDDYQNGYQGVSFAKLD 154

Query: 181 LDPYLLEVSLIVDVLHDLENKLEDATEPAVEQRSLNRSDESAHTSSSPEANNSSLPASPR 240
           LDPYL+E+SLIVDVL+DL+ K        V   + N    +  TS   E  N     +P 
Sbjct: 155 LDPYLIEISLIVDVLNDLKLK--------VTTNNNNDVSSTLLTSKHNETLNLRSNENPP 206

Query: 241 SIPLLSNKKTSKMIDSSLEFDTALIDKAENLGRFLLSSEDIEGLKFMLLNIGFRIIDDSI 300
           SI          +I S+++FDT  +DK   L R ++S+E+IE  KFMLL+  FRI+DD +
Sbjct: 207 SI----QNNGEDIIRSAIDFDTIFMDKCLPLHRLIVSNENIEEFKFMLLSNEFRIVDDQL 262

Query: 301 ISTSKEILDTTD----NINSAGNKSIRSAKSFNDLQHTLSLSKQKN---------ILPSA 347
           ISTSK+I+ +T+    N+N    KS+ S +SF   Q   S +KQ+N          LPS 
Sbjct: 263 ISTSKDIIVSTEQNRPNLNVK--KSMASIRSFQTFQ---SSTKQRNNSATSTSHGGLPS- 316

Query: 348 VQSNEKYVSISILDTVGNEGSPLLLTDDNINQHPNMIVS---STAEDTCIVMCHVGGLRN 404
           ++ ++  +SIS+LD +   G P  + DD  NQ P +++    +     CI+MCH+GGLR+
Sbjct: 317 LRLSQNMLSISLLD-LDPTGVPRFMKDDAFNQSPTLLIHLQDTNISPNCILMCHMGGLRD 375

Query: 405 HVVTNDLLLRDVKNILSAMRSGNDTKNISALINSLDPS-----PISKIALEWIQSHRLKT 459
           H+VTN++ L  +  +LS    G           S+ PS     PI  +ALEWI + +L+ 
Sbjct: 376 HLVTNNIPLEVINQVLSQDVKG-----------SIPPSNSNFNPIDNMALEWIMNQKLRH 424

Query: 460 IEPKLDFKRTRFISADNGDIYLIALDESITIG-NVSTLPFP--ILEIKKLSRSSGLSQTA 516
              K+D KRTR I +     YLI++DE I I  N     FP  I+EIK LS+ S  S  A
Sbjct: 425 TGMKIDIKRTRLIFSTEEFTYLISIDEKICITFNDEKFYFPHSIVEIKLLSKKSPSSMHA 484

Query: 517 INEDN-------KFKQLMKSVVTNEFQCSLIPPDLTTWKICLELVH-SNELQNDLFQLLL 568
            N +N       K + + + V     QC  +  + T WKIC  +    N   NDLF+LLL
Sbjct: 485 NNINNPTKSMNEKLQHIFREVYEKNIQCFSLDRNWTLWKICYSICQLPNVNDNDLFKLLL 544

Query: 569 RDQYKLNSDDSLSPDEFFQLGKDRLEEEFDLTGP-----INNSQGSVDSGRRVRIHKKSK 623
           +  Y L  +DSLS +EFF LG D + E   L  P     I N   S  +    + H  ++
Sbjct: 545 QCDYTLPPNDSLSTEEFFALGHDGILE---LCYPPFQEEIRNKSQSQSTHSNFKPHPYNE 601

Query: 624 QSDNETKKKPIRYWNEFDEQEEDNLDNAFYIDTNGSRSTTDNEESLLLRNSPPDYGFILF 683
              N+ K++  RYWNEFD       D+   I+        D +ES+    S  D+G + F
Sbjct: 602 SKANKQKERTFRYWNEFD-------DDQASINRENQHFYQDEDESIC---SQEDHGLVTF 651

Query: 684 SRNFINRTYDFCEKLRNLIRHDKKTSPDLFQNSKHPHCSSTN-YGSVASFGSQST----S 738
           +R FI+  +D  + ++++I       P   +  K      T+ YGS    GS+ST     
Sbjct: 652 NRPFIDSMFDKFKSIKSMI------IPRKRKQRKKRQQDGTSIYGSTYVLGSRSTLTLSP 705

Query: 739 ASYDDVQRYLQYQQQDIEDSQSIYEYRHDEVVTFLYLSALLTSCIMASVCLGIVLSLFRG 798
            S  D++  L+Y   ++++S+SIYE++HD+V+T  YL++LL SC+ + +CLGIVL+LFR 
Sbjct: 706 GSESDLEALLEYDPSNVQESESIYEFKHDQVLTVFYLASLLISCMTSGLCLGIVLALFRE 765

Query: 799 QSNNE-IDLEIQNXXXXXXXXXXXXXXXXXXXXXXXXFSRFTLAPIWHYVGCFTMF 853
             N++ I  +  N                        FSRFTLAP+WHY+ CF  F
Sbjct: 766 SENDDVIVFDGINFLLAVIIGSLLVSLILIIVSLLLLFSRFTLAPLWHYISCFVFF 821

>Kwal_56.23410
          Length = 825

 Score =  448 bits (1152), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 312/874 (35%), Positives = 458/874 (52%), Gaps = 84/874 (9%)

Query: 1   MKFEDRILNKSIPEWKFYNINYEKLKVAIKKVTAYDYDNPNDSGM--EKLLNQCSVAFDQ 58
           MKF  +I  KS+PEW+  NI+Y+ LK A+K VT +  +    S +  +  L     AF  
Sbjct: 1   MKFGSQIYEKSVPEWRLNNIDYKHLKEAVKTVTTFKPEKQPASSVNEDAELMWLYRAFQT 60

Query: 59  EFQNVNLFVSLKIKEISTRILSVESSIIDFSKGLNKTSRNRFNLRKLKIINAHVDDCNFE 118
           +F+NVN FV +KIKE STR++SVESSII   + + +  RN+   R+L +I++H+D CN E
Sbjct: 61  QFRNVNDFVGMKIKEASTRLVSVESSIIRLQRQMQEPHRNK--RRQLALISSHLDHCNME 118

Query: 119 LQLLSRFLIIQRIALRKLFKKLLNEFPQDSENPLTASEYVTSIRNSESLRNGHE-GISFM 177
           L  + RFLI+Q+IALRKL KK L  +P D      A ++V  I N   LR   E G+SF 
Sbjct: 119 LLRICRFLILQKIALRKLLKKFLKYYPYDKA---VAEKFVEQITNCPELRGDQENGLSFT 175

Query: 178 KLDLDPYLLEVSLIVDVLHDLENKLEDATEPAVEQRSLNRSDESAHTSSSPEANNSSLPA 237
           KLDLDPYLLEVSL+VDVL +LE            Q +  R     H     E   S +P 
Sbjct: 176 KLDLDPYLLEVSLVVDVLQELE------------QAASGRKGSLTH-----ETMKSEMPG 218

Query: 238 ---SPRSIPLLSNKKTSKMIDSSLEFDTALIDKAENLGRFLLSSEDIEGLKFMLLNIGFR 294
                 S P+ S+       DS L FD+  + KA  L  FL++ E I  +KF+LL +GF 
Sbjct: 219 EIEGAHSAPMASHA------DSDLAFDSIFLGKASRLQAFLVADESISQMKFLLLQLGFH 272

Query: 295 IIDDSIISTSKEIL----DTTDNINSAGNKSIRSAKSFNDLQHTLSLSKQKNI-LP--SA 347
           ++DD +I  S++ L     T+   N    K+ R+ KSF+DL+  L+  + +N+ LP  S 
Sbjct: 273 VVDDDMILVSQQSLKDSSSTSLTANGTSGKTPRTVKSFHDLR--LASDQNENVALPMISD 330

Query: 348 VQSNEKYVSISILDTVGNEGSPLLLTDDNINQHPNMIVSSTAEDTCIVMCHVGGLRNHVV 407
           ++S+++   I++LD+   +  P  L DD IN+HP ++V+ +    C+VMCHVGGLRNH+V
Sbjct: 331 IRSSQQ-TEIAMLDS---KPVPSFLEDDAINRHPTIVVNGSRTCKCLVMCHVGGLRNHIV 386

Query: 408 TNDLLLRDVKNILSAMRSGNDTKNISALINSLDPSPISKIALEWIQSHRLKTIEPKLDFK 467
           + ++     K  L+++ S      +     +   +PI K+ LEWI+SH L    PK+  +
Sbjct: 387 SENV----SKKKLASVLSNKSLDTLETESETEVTTPIGKLCLEWIKSHSLHQCGPKISTQ 442

Query: 468 RTRFISA---DNGDIYLIALDESITIGNVSTLPFPILEIKKLSRSSGLSQTAINEDNKFK 524
           RTRF  A    N   YL+ +DESI +     +P  ++EI+       L +    +D    
Sbjct: 443 RTRFTKAVGEPNLTEYLVCVDESIVLAGSKKVPHAVVEIRSQQSGGMLHRKEGYKDELIT 502

Query: 525 QLMKSVVTNEFQCSLIPPDLTTWKICLELVHSNELQNDLFQLLLRDQYKLNSDDSLSPDE 584
            L++ +  N   C  +  D T WK+  +  ++ +L++ LF          NS+       
Sbjct: 503 TLIEKMYENHISCYPLKEDQTLWKLLYQAANAEDLKSGLFSAACPSLTSFNSES------ 556

Query: 585 FFQLGKDRLEEEFDLTGPINNSQGSVDSGRRVRIHKKSKQ--SDNETKKKPIRYWNEFDE 642
            F++G+  L       G     + +  +G++ +  K  +Q  S     K PIRYWNEFD 
Sbjct: 557 IFEIGESELSRMIAAKG---EQRRASFAGKKPKSRKTKEQLISPQANSKPPIRYWNEFDN 613

Query: 643 QEEDNLDNAFYIDTNGSRSTTDNEESLLLRNSPPDYGFILFSRNFINRTYDFCEKLRNLI 702
            EE   + +FY DT             +      D GFI+F+RNFIN TY+F E LR  +
Sbjct: 614 GEEAG-NESFYRDTEA-----------MPFEGEMDNGFIVFNRNFINATYNFSESLRRFL 661

Query: 703 --RHDKKTSPDLFQNSKHPHCSSTNYGSVASFGSQSTSASYDDVQRYLQYQQQDIEDSQS 760
               D+     L  +S+H    S N  + +S  + ++SA   D  RY+ Y  +  EDSQS
Sbjct: 662 TLSSDEPEKRPLLTDSQHRQ--SINSFTTSSSLNTTSSAE-RDYNRYINYTIEQ-EDSQS 717

Query: 761 IYEYRHDEVVTFLYLSALLTSCIMASVCLGIVLSLFRGQSNNEIDLEIQNXXXXXXXXXX 820
           +YE++HD+VVTF YLS+LL SCI + + LGIV SLFR + N++I                
Sbjct: 718 VYEFKHDQVVTFFYLSSLLVSCITSGISLGIVASLFR-ELNDDIVFGAGPGLLTVIIATL 776

Query: 821 XXXXXXXXXXXXXXFSRFTLAPIWHYVGCFTMFF 854
                         FSRF  AP WHYVGCF +F 
Sbjct: 777 LTSLILSCASLLLLFSRFKFAPWWHYVGCFLIFL 810

>CAGL0C03696g complement(367135..369630) similar to sp|P38966
           Saccharomyces cerevisiae YDR089w, start by similarity
          Length = 831

 Score =  409 bits (1050), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 279/875 (31%), Positives = 469/875 (53%), Gaps = 82/875 (9%)

Query: 1   MKFEDRILNKSIPEWKFYNINYEKLKVAIKKVTAYDYDNPNDSGMEKLLNQCSVAFDQEF 60
           MKF  +IL+KS+P+WK  NI+YE+LK  IK+VT+     PN +  E L     V+F Q  
Sbjct: 1   MKFGSQILDKSVPDWKLNNIDYEELKKIIKQVTSKK-TAPNSNDFEGL----EVSFKQNI 55

Query: 61  QNVNLFVSLKIKEISTRILSVESSIIDFSKGLNKTSRNRFNLRKLKIINAHVDDCNFELQ 120
             +NLFVSLK+KEIS++++S+E SI       N+ + NR  LR++K I  +++ CN  LQ
Sbjct: 56  VQINLFVSLKLKEISSKLVSIEHSITKLLD--NEINDNRKVLRRIKTIKNYLETCNDLLQ 113

Query: 121 LLSRFLIIQRIALRKLFKKLLNEFPQDSENPLTASEYVTSIRNSESLRNGHEGISFMKLD 180
            LSRF+I+QRIALRKLFKK+   +         A ++++SI+N   LR+G+EG+SF  LD
Sbjct: 114 KLSRFVIVQRIALRKLFKKITKHYGDKK----IAQQFISSIQNCNELRDGYEGVSFKNLD 169

Query: 181 LDPYLLEVSLIVDVLHDLENKLEDATEPAVEQRSLNRSDESAHTSSSPEANNSSLPASPR 240
           L  YL+EVSLI+D+L D+ N ++                    T +  +  +     S  
Sbjct: 170 LQSYLVEVSLIMDILTDMTNAIKS-------------------TGNFKDLPSELFEKSKL 210

Query: 241 SIPLLSNKKTSKMIDSSLEFDTALIDKAENLGRFLLSSEDIEGLKFMLLNIGFRIIDDSI 300
                 NKK      ++ +FD  L DK E +   L+ S++ E LKF+L+ +GF++ D ++
Sbjct: 211 ITNATDNKKPLVSFTTNQQFDQVLWDKGELIQSLLVRSDNNEQLKFLLITLGFQVFDQNL 270

Query: 301 ISTSKEILDTTDNINSAGNKSIRSAKSF--NDLQHTLSLSKQKNILPSAVQSNEKYVSIS 358
              S++I+ +  N   +  +S+RS KSF  +D      L        +  +  E+    +
Sbjct: 271 QGISRDIIASEPN---SEVRSLRSKKSFYESDRPALKRLHTSSTEYLNNAEEMEQSKCKA 327

Query: 359 ILDTVGNEGSPLLLTDDNINQHPNMIV----SSTAEDTCIVMCHVGGLRNHVVTNDLLLR 414
           ++ T   +    +     I  +P++++    ++   + CIV+CHVGGLR  VVT+ L + 
Sbjct: 328 VMLTPSGKVDSSIYDSKKITSYPSVLLEYEKNNVIANECIVICHVGGLRGKVVTDKLHIN 387

Query: 415 DVKNILSAMRSGNDTKNISALINSLDPSPISKIALEWIQSHRLKTIEPKLDFKRTRFISA 474
           ++   L          N  A+       P++KIAL+WI  H +K    ++ FKRTR+   
Sbjct: 388 EISEYLK-------NSNKQAI-----SDPLAKIALDWICDHGMKECGIEIGFKRTRYFCN 435

Query: 475 DNGDIYLIALDESITIGNVST-----LPFPILEIKKLSRSSGLSQTAINEDNKFKQLMKS 529
            + ++Y+I +DE  T+ + +      +   I++++ ++ +      ++ +  K +++ + 
Sbjct: 436 KHSNLYMITIDEEFTLSDSNGQTEKLMDHSIIDLRVVTTNFSSDNKSLAK--KSQEIYEK 493

Query: 530 VVTNEFQCSLIPPDLTTWKICLELVHSNELQNDLFQLLLRDQYKLNSDDSLSPDEFFQLG 589
           +++++ QC    PD    K+ L +  +N  ++ + +L+L + Y+LN ++ ++ DEFF +G
Sbjct: 494 IISSKIQCFPFQPDFHPVKLLLSIHENNGSKDVIHRLMLENIYELNENNKITEDEFFGIG 553

Query: 590 KDRL----EEEFDLTGPINNSQGSVDSGRRVRIHKK-----SKQSDNETKKKPIRYWNEF 640
            D L      EF      +N    V+S  R     K     SK  + E  K  IRYWNEF
Sbjct: 554 FDLLLDICSSEFK-----DNYYQKVESPTRTPNDWKKNNLLSKNKNTENNKPAIRYWNEF 608

Query: 641 DEQEEDNLDNAFYIDTNGSRSTTDNEESLLLRNSPPDYGFILFSRNFINRTYDFCEKLRN 700
           D+ EE+N    FYI     +  TD+ ES  L+    DYGFI FS++FI  TY   +  R+
Sbjct: 609 DDLEEENGGGGFYI-----QDRTDDLESNELQ-QERDYGFIHFSKDFIESTYSSLQSFRD 662

Query: 701 LI--RHDKKTSPDLFQNSKHPHCSSTNYGSVASFGSQSTSASYDDVQRYLQYQQQDIEDS 758
            +  + + +T+ D           ++NYGS++S GS   S S +D+++ +++Q ++IE+S
Sbjct: 663 FLGFKDNNRTAIDPALLDLSERFGNSNYGSISSKGS-ILSNSVEDIRKLIEHQMKEIENS 721

Query: 759 QSIYEYRHDEVVTFLYLSALLTSCIMASVCLGIVLSLFRGQSNNEIDLEIQNXXXXXXXX 818
           +S+Y Y+HD+V++ +YL ALL +C  + +C+GIVLS+F G  N++I++++          
Sbjct: 722 ESVYVYKHDQVLSLMYLFALLMACATSGICMGIVLSVFNGD-NSDIEIDVGKTLIITVIL 780

Query: 819 XXXXXXXXXXXXXXXXFSRFTLAPIWHYVGCFTMF 853
                           FSR+T APIWHY   F +F
Sbjct: 781 SLGISLGLITLCLLLLFSRYTYAPIWHYALSFAIF 815

>KLLA0F14509g complement(1345334..1347889) weakly similar to
           sp|P38966 Saccharomyces cerevisiae YDR089w singleton,
           start by similarity
          Length = 851

 Score =  355 bits (912), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 284/901 (31%), Positives = 453/901 (50%), Gaps = 126/901 (13%)

Query: 1   MKFEDRILNKSIPEWKFYNINYEKLKVAIKKVTAYDYDN-----PNDSGMEKLLNQCSVA 55
           MKF  +IL+KS+PEWK +NI+Y++LKV I++ T           PN    +  L      
Sbjct: 1   MKFGTQILDKSVPEWKLHNIDYQQLKVGIRRCTTVREGQDPEFRPNSIEDDPELRSLKKL 60

Query: 56  FDQEFQNVNLFVSLKIKEISTRILSVESSI--IDFSKGLNKTSRNRFNLRKLKIINAHVD 113
           F  +F+ +N+F+S+K+KE STRI+S+E+ +  +   K  NK       LR++K+IN H+D
Sbjct: 61  FRSQFEMINVFISMKLKECSTRIVSIENYLTQLHLIKDENK------KLRRIKLINQHLD 114

Query: 114 DCNFELQLLSRFLIIQRIALRKLFKKLLNEFPQDSENPLTASEYVTSIRNSESLRNGHEG 173
            CN ELQ LSR+LI+Q+IA+RKLFKK L  +P  ++    A E++ S++N    + GHEG
Sbjct: 115 RCNLELQKLSRYLILQKIAVRKLFKKFLKHYPYGTQ---LAQEFINSLKNCPEFKEGHEG 171

Query: 174 ISFMKLDLDPYLLEVSLIVDVLHDLENKLEDATEPAVEQRSLNRSDESAHTSSSPEANNS 233
           +S + +DLDPYLLE+SLIVD+LH++E   +DA +  V+    + + ++ +TS+S    NS
Sbjct: 172 VSMLTVDLDPYLLEISLIVDLLHEME---QDADQQPVD----SGNTKTGNTSNS--RANS 222

Query: 234 SLPASPRSIPLLSNKKTSKMIDS---SLEFDTALIDKAENLGRFLLSSEDIEGLKFMLLN 290
           ++  +  + P                +L+FD   + K   LG FL+S E  + +KF+L+N
Sbjct: 223 NVGITSGTAPSSRKSSVVSSSHVIDSTLKFDHYFLSKFNPLGSFLISKESEDEIKFLLIN 282

Query: 291 IGFRIIDDSIISTSKEILDTTDNINSAGNKSIRSAKSFNDLQH--TLSLSKQKNILPSA- 347
           +GF + DDS+I+TSK+IL + D + S    SI+S + F D Q     S S++++   S  
Sbjct: 283 LGFCLFDDSVIATSKKIL-SGDALLSKRKGSIKSLRMFRDAQREEAASSSQRRDTESSPP 341

Query: 348 VQSNEKYVSIS---------------ILDTVGNEGSPL--LLTDDNINQHPNMIVSSTAE 390
           V S E     +               + + +   G+ +  L      N  PN++VS  + 
Sbjct: 342 VGSPESDPGSNRSQQLSNSSSSAHNILFEPLAKPGADVTNLYNSTEENLFPNLLVSYPSS 401

Query: 391 DTCIVMCHVGGLRNHVVTNDLLLRDVKNILSAMRSGNDTKNISALINSLDPS--PIS--- 445
           +  I++CHVGGLRNH+ T+ +   D+K                A++N  +PS  P+S   
Sbjct: 402 NDSILLCHVGGLRNHISTDTIEYTDIK----------------AVLNGCEPSLMPVSNRL 445

Query: 446 -KIALEWIQSHRLKTIEPKLDFKRTRFI----SADNGDIYLIALDESITIGNVSTLPFPI 500
            +   +W  SH LKT +  +  +R+RFI    S +  + YLI +D++I I N + LPF +
Sbjct: 446 DEFCRDWCYSHNLKTTDLVIKCRRSRFIISHSSIETNNDYLICIDDNIEI-NDNKLPFAV 504

Query: 501 LEIKKLSRSSGLS-----QTAINEDNKFKQLMKSVVTNEFQCSLIPPDLTTWKICLELVH 555
           LE+K L  +S  S      +  + D     L + +VT+         + T W++  ++  
Sbjct: 505 LEVKILEATSSSSVPNKTYSKKHIDPIMVDLTEKLVTDNLSVYPTGRNFTLWEMAGKIAG 564

Query: 556 SNELQNDLFQLLLRDQYKLNSDDSLSPDEFFQLGKDRLEEEFD-----LTGPINNSQGSV 610
            +   N L  L       LN +   S +E F  G   L++  D     L  P      S 
Sbjct: 565 GS---NPLACL----DGNLNFE---SVEEMFGAGNALLKKTHDRYQSLLNPPTIEFSQSS 614

Query: 611 DSGRRVRIHKKSKQSDNETKKKPIRYWNEFDEQEEDNLDNAFY--IDTNGSRSTTDNEES 668
                V I      +  E +K  IRYWNEFD+ EE  +D  FY  +D +    T D    
Sbjct: 615 SQNTAVNI----SPTVTEREKPRIRYWNEFDDGEE-AMDQDFYSCLDEDDDEYTHDT--- 666

Query: 669 LLLRNSPPDYGFILFSRNFINRTYDFCEKLRNL--IRHDKKTSPDLFQNSKHPHCSSTNY 726
                     G I F+ +FI   Y    K +    I  D +    L +++   + S    
Sbjct: 667 ----------GLIRFNPSFIIAIYHLLSKFQIAFGIIDDVQARKSLLRDAGKSYNSIDTD 716

Query: 727 GSVASFGSQSTSASYDDVQRYLQYQQQDIEDSQSIYEYRHDEVVTFLYLSALLTSCIMAS 786
            S+ +    S+S+  +DV ++ + ++Q+   S+SIYE+ HD+V++F Y+S+LL SC+   
Sbjct: 717 TSILT----SSSSERNDVNKFWELEEQN---SESIYEFEHDQVISFFYVSSLLISCLTTG 769

Query: 787 VCLGIVLSLFRGQSNNEIDLEIQNXXXXXXXXXXXXXXXXXXXXXXXXFSRFTLAPIWHY 846
           V +GI+ SLF+   N++  LE +                         FSRFT AP WHY
Sbjct: 770 VTIGIMTSLFKSL-NDDTQLENETSILTMIFISLSISLILGAWSLLLMFSRFTFAPTWHY 828

Query: 847 V 847
           +
Sbjct: 829 I 829

>AGR160W [4471] [Homologous to ScYDR089W - SH]
           complement(1045983..1048493) [2511 bp, 836 aa]
          Length = 836

 Score =  352 bits (903), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 258/893 (28%), Positives = 420/893 (47%), Gaps = 124/893 (13%)

Query: 1   MKFEDRILNKSIPEWKFYNINYEKLKVAIKKVTAYDYDNPNDSGMEKLLNQCSVAFDQEF 60
           MK   R       EW    ++YE L+  +++ T Y        G  ++L +   AF  E 
Sbjct: 12  MKLRGR--RGPAAEWTLNGMDYEYLREEVRRATTYAGGREETDG--RVLGRLLGAFRAEL 67

Query: 61  QNVNLFVSLKIKEISTRILSVESSIIDFSKGLNKTSRNRFNLRKLKIINAHVDDCNFELQ 120
            NVNLFVSLK++EI+ R+ +VE+ I+++ +   K         +L+  N  +  C+ +LQ
Sbjct: 68  SNVNLFVSLKMREITARLETVEAGIVEWRR--RKVGEPGARALRLRRANGQLAQCSADLQ 125

Query: 121 LLSRFLIIQRIALRKLFKKLLNEFPQDSENPLTASEYVTSIRNSESLRNGHEGISFMKLD 180
            L+R+L++Q+ ALRKL ++L+  +P D         +V ++   + L+ GHEG+ F  +D
Sbjct: 126 RLARYLLLQKAALRKLTRRLVRYYPYDEAE---VEGFVAALYACDELQQGHEGVVFTAVD 182

Query: 181 LDPYLLEVSLIVDVLHDLENKLEDATEPAVEQRSLNRSDESAHTSSSPEANNSSLPASPR 240
           L+PYLLEVSLI+ VL+DLE K           RS+ R+ E                    
Sbjct: 183 LEPYLLEVSLIMGVLYDLEMK----------DRSVERAREP------------------- 213

Query: 241 SIPLLSNKKTSKMIDSSLEFDTALIDKAENLGRFLLSSEDIEGLKFMLLNIGFRIIDDSI 300
                 N    + I S L FDT  + K   L R L+S +++  LKF+L+ + +++IDD +
Sbjct: 214 -----PNNVLGRPITSCLTFDTLFLGKYHLLQRLLISQDNVGELKFLLMKLDYQMIDDDV 268

Query: 301 ISTSKEI----LDTTDNINSAGNKSIRSAKSFNDLQHTLSLSKQKNILPSAVQSNEKYVS 356
           +STS+++    L   D I   G+   +S + F+      +  ++ + LP      +K  +
Sbjct: 269 LSTSRQLANGALPGGDPIK--GSCKAQSLRFFDFGAARPARMRRNSSLP------DKLRT 320

Query: 357 ISILDTVGNEGSPLLLTDDNINQHPNMIVSSTAEDTCIVMCHVGGLRNHVVTNDLLLRDV 416
           +S L T         +TD+  NQHPN+ V    +D C++MCHVGG+RNH++T +L L  V
Sbjct: 321 LSQLRTHMYPLDKQFMTDEAYNQHPNIFVRGQQDDACLLMCHVGGMRNHIITQNLPLPLV 380

Query: 417 KNILSAMRSGNDTKNISALINSLDPSPISKIALEWIQSHRLKTIEPKLDFKRTRFISAD- 475
              L+  +  +    +SAL          K+ L+W++++ L   +  +  KRTRF +   
Sbjct: 381 LECLTKRQWSHKNIPLSAL---------DKLCLDWVRTNNLGLSDFVISVKRTRFFTKRD 431

Query: 476 ---NG----DIYLIALDESITIGNVSTLPFPILEIKKLSRSSGLSQTAINE-DNKFKQLM 527
              NG     +YLI LDE + I N   LP   +E++KL+ +      + N+ D +   L+
Sbjct: 432 EVINGTAFTSVYLITLDEEVFINNTLKLPHAFVEVRKLTNTVVTPNKSTNKIDTELSHLI 491

Query: 528 KSVVTNEFQCSLIPPDLTTWKICLEL--VHSNELQNDLFQLLLRDQYKLNSDDSLSPDEF 585
             ++     C  + P  T WK+   L    + E++  ++  L    ++ +S+  +S D  
Sbjct: 492 DVILDMSLSCYPLAPSNTLWKMAYSLKDTPAEEIERSMYAALAAADFQDSSN--ISGDIL 549

Query: 586 FQLGKDRLEEEFDLTGPINNSQGSVDSGRRVRIHK----KSKQSDNETKKKPIRYWNEFD 641
           F +G+ RL++    T P      +  S      HK    +S  S  ET ++  RYWNE D
Sbjct: 550 FSIGRRRLDQMSTPTVPQRTPSLAKSS------HKSQDAQSPSSSGETPQRK-RYWNELD 602

Query: 642 EQEEDNLDNAFYIDTNGSRSTTDNEESLLLRNSPPDYGFILFSRNFINRTYDFCEKLRNL 701
           EQ + +  + FY D           E L   +   ++GFI F +NFI   Y +  KL ++
Sbjct: 603 EQNDADAQDCFYRD----------PEELHTGDYEAEHGFIKFDKNFILNFYQYLHKLNHI 652

Query: 702 IRHDKKT--------------------SPDLFQNSKHPHCSSTNYGS-VASFGSQSTSAS 740
             + KK                     +P + QNS+    S+    S +   GSQ    +
Sbjct: 653 FCYQKKPPKEYTVVPCSGDSEITRSELTPLIRQNSEARSYSALEVQSTLPGGGSQLQVPN 712

Query: 741 YDDVQRYLQYQQQDIEDSQSIYEYRHDEVVTFLYLSALLTSCIMASVCLGIVLSLFRGQS 800
           +DD    + Y + D+     +Y Y+HDEVV+  YL+ LL SCI     +GI+ SLF    
Sbjct: 713 WDDEAALVCYDELDV-----LYGYKHDEVVSLFYLTTLLVSCITTGTTVGIMFSLFSALG 767

Query: 801 NNEIDLEIQNXXXXXXXXXXXXXXXXXXXXXXXXFSRFTLAPIWHYVGCFTMF 853
           N++ + E  N                        FSR+ +AP WHY  C  +F
Sbjct: 768 NDQTEFEGSNYITALILVSLVVSLMLSSFSLLLLFSRYHMAPWWHYSSCIIVF 820

>AGR223W [4534] [Homologous to ScYPL110C - SH]
           complement(1167870..1171835) [3966 bp, 1321 aa]
          Length = 1321

 Score = 37.4 bits (85), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 28/109 (25%), Positives = 44/109 (40%), Gaps = 25/109 (22%)

Query: 1   MKFEDRILNKSIPEWKFYNINYEKLKVAIKKVT------------AYDYDNP-------- 40
           MKF     N  +PEW    +NY+ LK  IK++T            A   D P        
Sbjct: 1   MKFGKTFPNHQVPEWAHKYVNYKGLKKQIKEITLVQDALFRQEQGAASQDGPARRRGRES 60

Query: 41  -----NDSGMEKLLNQCSVAFDQEFQNVNLFVSLKIKEISTRILSVESS 84
                    ++KLL     A D++ + V+ F +++  E   R+  + SS
Sbjct: 61  KEQYLGHPEVKKLLAAFFFALDRDIEKVDGFYNMQFMEYDRRLRKLLSS 109

>Sklu_2202.8 YPL110C, Contig c2202 8829-12932
          Length = 1367

 Score = 37.0 bits (84), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 48/111 (43%), Gaps = 27/111 (24%)

Query: 1   MKFEDRILNKSIPEWKFYNINYEKLKVAIKKVT-------------AYDYDNP------- 40
           MKF     N  +PEW    +NY+ LK  IK++T             + + D P       
Sbjct: 1   MKFGKTFPNHQVPEWSHQYVNYKGLKKLIKQITQTQEKLHREQHDHSGETDPPARPRNTL 60

Query: 41  -------NDSGMEKLLNQCSVAFDQEFQNVNLFVSLKIKEISTRILSVESS 84
                  NDS ++ LL     A D++ + V+ F +++  E + R+  + SS
Sbjct: 61  NIDENYLNDSLVKSLLASFFFALDRDIEKVDNFYNMQFLEYNRRLRRLISS 111

>Kwal_23.3741
          Length = 312

 Score = 35.0 bits (79), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 40/90 (44%), Gaps = 10/90 (11%)

Query: 308 LDTTDNINSAGNKSIRSAKSFN----DLQHTLSLSKQKNILPSAVQSNEKYVSISILDTV 363
            D++D+     N ++  A+SFN    +L     L   KNI+PS   +N       I    
Sbjct: 209 FDSSDDFQWLLNAAVVRAESFNIDVRELTPQFVLGVIKNIIPSVASTNAI-----IAAQC 263

Query: 364 GNEGSPLLLTDDNINQHPNMIVSSTAEDTC 393
            NE S LL  D  I + PN + +   +D C
Sbjct: 264 CNEASKLLYDDYEIGEAPNFL-TYNGDDGC 292

>KLLA0F00660g 54232..58356 similar to sgd|S0006031 Saccharomyces
          cerevisiae YPL110c, start by similarity
          Length = 1374

 Score = 33.9 bits (76), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 19/34 (55%)

Query: 1  MKFEDRILNKSIPEWKFYNINYEKLKVAIKKVTA 34
          MKF     N  +PEW    +NY+ LK  IK++ A
Sbjct: 1  MKFGKTFPNHQVPEWSHEYVNYKSLKKLIKEIVA 34

>Kwal_27.12292
          Length = 217

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 19/33 (57%)

Query: 1  MKFEDRILNKSIPEWKFYNINYEKLKVAIKKVT 33
          MKF     N  +PEW    +NY+ LK  IK++T
Sbjct: 1  MKFGKTFPNHQVPEWSHEYVNYKNLKKLIKEIT 33

>CAGL0K07073g complement(693824..697186) similar to sp|P38329
           Saccharomyces cerevisiae YBR235w, start by similarity
          Length = 1120

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 33/98 (33%), Positives = 48/98 (48%), Gaps = 11/98 (11%)

Query: 223 HTSSSPEANNSSLPASPRSIPLLSNKKTSKMIDSSLEFDTAL-IDKAENLGRFLLSS--E 279
           + +  PE+ ++SL  S  S+  L   K+ KMID+ +   TAL  D  EN  +   +   +
Sbjct: 652 YKNKGPESGSASLSQSRISMNSLKAIKSQKMIDAKMNLPTALPTDAYENKVKVTPTQWVQ 711

Query: 280 DIEGLKFMLLNI----GFRIID----DSIISTSKEILD 309
            IE L  M  NI    GFR +D    D I   SK ++D
Sbjct: 712 MIEDLSLMQSNIAIAHGFRDLDIPQRDGIKQASKRVID 749

>YPL110C (YPL110C) [5334] chr16 complement(341067..344738) Member of
           the glycerophosphoryl diester phosphodiesterase family,
           contains six ankyrin (Ank) repeats and a SYG1, Pho81 and
           XPR1 (SPX) N-terminal domain, has weak similarity to S.
           cerevisiae Pho81p, which is a cyclin-dependent kinase
           (CDK) inhibitor [3672 bp, 1223 aa]
          Length = 1223

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 43/112 (38%), Gaps = 28/112 (25%)

Query: 1   MKFEDRILNKSIPEWKFYNINYEKLKVAIKKVT-------------AYDYDNP------- 40
           MKF     N  IPEW    + Y+ LK  IK++T             +YD   P       
Sbjct: 1   MKFGKTFANHRIPEWSSQYVGYKSLKKMIKEITRLQEDIYRAHNKNSYDEGRPPTKMRDS 60

Query: 41  --------NDSGMEKLLNQCSVAFDQEFQNVNLFVSLKIKEISTRILSVESS 84
                   +   ++KLL     A D++ + V+ F + +  E   R   + SS
Sbjct: 61  SNSAQNYLDSPKIQKLLASFFFAVDRDIEKVDTFYNSQYAEYKKRFERLLSS 112

>YPL019C (VTC3) [5418] chr16 complement(514507..517014) Subunit of
          the vacuolar transporter chaperone (Vtc) complex
          (Vtc1p, Vtc2p, Vtc3p, Vtc4p), required for the final
          step of vacuolar fusion, involved in vacuolar
          polyphosphate accumulation [2508 bp, 835 aa]
          Length = 835

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 33/66 (50%)

Query: 1  MKFEDRILNKSIPEWKFYNINYEKLKVAIKKVTAYDYDNPNDSGMEKLLNQCSVAFDQEF 60
          M F  ++ N   P WK   I+YE+LK  +K+   +D  +  DS  E+  +    A D+E 
Sbjct: 1  MLFGIKLANDVYPPWKDSYIDYERLKKLLKESVIHDGRSSVDSWSERNESDFVEALDKEL 60

Query: 61 QNVNLF 66
          + V  F
Sbjct: 61 EKVYTF 66

>CAGL0J07040g 675389..679126 similar to tr|Q02979 Saccharomyces
          cerevisiae YPL110c, start by similarity
          Length = 1245

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 20/33 (60%)

Query: 1  MKFEDRILNKSIPEWKFYNINYEKLKVAIKKVT 33
          MKF   +L   IPEW    +NY+ LK  +K++T
Sbjct: 1  MKFGKTLLKLRIPEWSHLYVNYKVLKKILKEIT 33

>Kwal_23.5060
          Length = 835

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 41/95 (43%), Gaps = 8/95 (8%)

Query: 1  MKFEDRILNKSIPEWKFYNINYEKLKVAIKK--VTAYDYD------NPNDSGMEKLLNQC 52
          M F  R+ N+  P W+   I YE+LK  +K+  +   +Y       N  D+  EK  +  
Sbjct: 1  MLFGVRLANQMYPPWRDSYIEYERLKKLLKESVIENRNYSGRRSQRNEQDAWTEKDESNF 60

Query: 53 SVAFDQEFQNVNLFVSLKIKEISTRILSVESSIID 87
              D E + V  F S K   I  ++L +E    D
Sbjct: 61 VAVLDAELEKVYSFQSHKYNSIMDKLLRLEEKTDD 95

>Kwal_27.12751
          Length = 1093

 Score = 31.2 bits (69), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 34/154 (22%), Positives = 70/154 (45%), Gaps = 18/154 (11%)

Query: 1   MKFEDRILNK--SIPEWKFYNINYEKLKVAIKKV---------TAYDYDNPNDSGMEKLL 49
           MKF   +  +  ++PE+  + I+Y+ LK  IK++         T+   D+ ++S + + L
Sbjct: 1   MKFGKHLETRQLALPEYNGHFIDYKSLKKLIKQLSVSGAAVVGTSAALDSADESLVHQTL 60

Query: 50  NQCSVAF----DQEFQNVNLFVSLKIKEISTRILSVESSIIDFSKGLNKTSRNRFNLRKL 105
            +   +F    ++E + VN +   K  ++  +   ++S   D  K    +S+N    R L
Sbjct: 61  QEHKASFFFRLERELEKVNAYYLEKEADLRIKFDILQSRFQDSVKRGKLSSKNTVAYRPL 120

Query: 106 KIINAHVDDCNFELQLLSRFLIIQRIALRKLFKK 139
           +     +     +L  L +F+ + R    K+ KK
Sbjct: 121 R---DGIKKFERDLAHLEQFVELNRTGFSKVLKK 151

>AFR326W [3518] [Homologous to ScYDR011W (SNQ2 ) - NSH; ScYNR070W -
           NSH] complement(1025594..1029523) [3930 bp, 1309 aa]
          Length = 1309

 Score = 30.4 bits (67), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 38/154 (24%), Positives = 64/154 (41%), Gaps = 19/154 (12%)

Query: 13  PEWKFYNINYEKLKVAIKKVTAYDYDNPNDSGMEKLLNQCSVAF-----------DQEFQ 61
           PE K    NYE LK A +      Y N  D+ M++L  Q ++ F           D+   
Sbjct: 68  PENKLVFKNYEYLKFAERCTGEIIYSNAEDNHMKQLTVQETIDFAVNCNVDVAKEDKILL 127

Query: 62  NVNLFVSLKIKEISTRILSVESSIIDFSKGLNKTSRNRFNLRKLKIINAHV---DDCNFE 118
              L  + K+ E+   +++ E+     S  L+   R R ++ +  + NA +   D+C   
Sbjct: 128 RDTLLSAFKLSEVRHTLVADEN-----SSKLSVGERRRLSIIEAFLGNASLYLWDNCTNG 182

Query: 119 LQLLSRFLIIQRIALRKLFKKLLNEFPQDSENPL 152
           L  ++   IIQ + L     K +N F     N +
Sbjct: 183 LDSMTAMDIIQGLKLMARVTKTVNLFGCTQANGI 216

>KLLA0E20317g complement(1796579..1798423) weakly similar to
           sp|P34225 Saccharomyces cerevisiae YBL060w singleton,
           hypothetical start
          Length = 614

 Score = 30.4 bits (67), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 27/109 (24%), Positives = 50/109 (45%), Gaps = 13/109 (11%)

Query: 174 ISFMKLDLDPYLLEVSLIVDVLHDLENKLEDATEPAVEQRSL----NRSDESAHTSSSPE 229
           I  ++ +L    L+  LI D L    N++ D   P  + R+     N++D S+ ++ SP 
Sbjct: 173 IYAIRYELKDMQLDEKLIKDDLRGYYNQILDIPFPLCQPRTFKEVSNKNDYSSTSNDSPS 232

Query: 230 ANNSSLPASP---------RSIPLLSNKKTSKMIDSSLEFDTALIDKAE 269
            N+SS+  SP         R   L S +  S +++ +    + L  ++E
Sbjct: 233 MNHSSMNPSPNERVSFSVSRKTSLFSLRPASSLLEKTTTSQSVLSSQSE 281

>Scas_625.24
          Length = 588

 Score = 30.4 bits (67), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 31/115 (26%), Positives = 53/115 (46%), Gaps = 8/115 (6%)

Query: 625 SDNETKKKPIRYWNEFDEQEEDNLDNAFYIDTNGSRSTTDNEESLLLRNSPPDYGFILFS 684
           ++N++KK PIR   E   + ED+   A  I   G+     NE S  +++   +     F 
Sbjct: 55  AENDSKKGPIRIVTELKLKGEDDSPTALDITNKGTILLGCNENSEKIQSGKGNNNIRKFQ 114

Query: 685 RNFINRTYDFCEKLRNLIRHDKKTSPDLFQNSKHPHCSSTNYGSVASFGSQSTSA 739
            +  + +  F E     +  DK TSPD +  +K  + S+   GS+A+  S +  A
Sbjct: 115 LDVESPSLKFVES----VDLDKFTSPDDY--TKFVYTSTD--GSIAAIASSTEPA 161

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.133    0.373 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 28,537,913
Number of extensions: 1330913
Number of successful extensions: 6372
Number of sequences better than 10.0: 122
Number of HSP's gapped: 6570
Number of HSP's successfully gapped: 124
Length of query: 854
Length of database: 16,596,109
Length adjustment: 110
Effective length of query: 744
Effective length of database: 12,788,129
Effective search space: 9514367976
Effective search space used: 9514367976
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 66 (30.0 bits)