Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YDR088C (SLU7)38235919100.0
Scas_636.113533648601e-114
Kwal_56.234073413557442e-96
CAGL0H04917g3183266518e-83
KLLA0F14531g3413303499e-38
AGR159C2662491871e-15
Scas_546.3d931269860.016
Scas_713.4152355830.034
CAGL0G10109g666132800.083
Sklu_2438.9365150720.67
YER164W (CHD1)146851710.89
Scas_685.13*35431700.99
YLR116W (MSL5)47648701.0
YIL079C (AIR1)36018691.4
KLLA0F05896g34919645.6
YDR285W (ZIP1)875144645.9
Scas_721.13641147637.1
Scas_681.162048101647.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YDR088C
         (376 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YDR088C (SLU7) [940] chr4 complement(618491..619639) Pre-mRNA sp...   740   0.0  
Scas_636.11                                                           335   e-114
Kwal_56.23407                                                         291   2e-96
CAGL0H04917g 469160..470116 similar to sp|Q02775 Saccharomyces c...   255   8e-83
KLLA0F14531g 1349155..1350180 weakly similar to sp|Q02775 Saccha...   139   9e-38
AGR159C [4470] [Homologous to ScYDR088C (SLU7) - SH] (1044766..1...    77   1e-15
Scas_546.3d                                                            38   0.016
Scas_713.41                                                            37   0.034
CAGL0G10109g complement(967161..969161) similar to sp|P32349 Sac...    35   0.083
Sklu_2438.9 YDL175C, Contig c2438 19268-20365                          32   0.67 
YER164W (CHD1) [1592] chr5 (505387..509793) Protein involved in ...    32   0.89 
Scas_685.13*                                                           32   0.99 
YLR116W (MSL5) [3529] chr12 (380823..382253) Component of the sp...    32   1.0  
YIL079C (AIR1) [2592] chr9 complement(210920..212002) RING finge...    31   1.4  
KLLA0F05896g complement(566005..567054) similar to sp|P40507 Sac...    29   5.6  
YDR285W (ZIP1) [1114] chr4 (1032428..1035055) Structural protein...    29   5.9  
Scas_721.136                                                           29   7.1  
Scas_681.16                                                            29   7.3  

>YDR088C (SLU7) [940] chr4 complement(618491..619639) Pre-mRNA
           splicing factor affecting 3' splice site choice,
           required for the second catalytic step of splicing [1149
           bp, 382 aa]
          Length = 382

 Score =  740 bits (1910), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/359 (100%), Positives = 359/359 (100%)

Query: 18  KRQLQQAKEKNENIHIPRYIRNQPWYYKDTPKEQEGKKPGNDDTSTAEGGEKSDYLVHHR 77
           KRQLQQAKEKNENIHIPRYIRNQPWYYKDTPKEQEGKKPGNDDTSTAEGGEKSDYLVHHR
Sbjct: 18  KRQLQQAKEKNENIHIPRYIRNQPWYYKDTPKEQEGKKPGNDDTSTAEGGEKSDYLVHHR 77

Query: 78  QKAKGGALDIDNNSEPKIGMGIKDEFKLIRPQKMSVRDSHSLSFCRNCGEAGHKEKDCME 137
           QKAKGGALDIDNNSEPKIGMGIKDEFKLIRPQKMSVRDSHSLSFCRNCGEAGHKEKDCME
Sbjct: 78  QKAKGGALDIDNNSEPKIGMGIKDEFKLIRPQKMSVRDSHSLSFCRNCGEAGHKEKDCME 137

Query: 138 KPRKMQKLVPDLNSQKNNGTVLVRATDDDWDSRKDRWYGYSGKEYNELISKWERDKRNKI 197
           KPRKMQKLVPDLNSQKNNGTVLVRATDDDWDSRKDRWYGYSGKEYNELISKWERDKRNKI
Sbjct: 138 KPRKMQKLVPDLNSQKNNGTVLVRATDDDWDSRKDRWYGYSGKEYNELISKWERDKRNKI 197

Query: 198 KGKDKSQTDETLWDTDEEIELMKLELYKDSVGSLKKDDADNSQLYRTSTRLREDKAAYLN 257
           KGKDKSQTDETLWDTDEEIELMKLELYKDSVGSLKKDDADNSQLYRTSTRLREDKAAYLN
Sbjct: 198 KGKDKSQTDETLWDTDEEIELMKLELYKDSVGSLKKDDADNSQLYRTSTRLREDKAAYLN 257

Query: 258 DINSTESNYDPKSRLYKTETLGAVDEKSKMFRRHLTGEGLKLNELNQFARSHAKEMGIRD 317
           DINSTESNYDPKSRLYKTETLGAVDEKSKMFRRHLTGEGLKLNELNQFARSHAKEMGIRD
Sbjct: 258 DINSTESNYDPKSRLYKTETLGAVDEKSKMFRRHLTGEGLKLNELNQFARSHAKEMGIRD 317

Query: 318 EIEDKEKVQHVLVANPTKYEYLKKKREQEETKQPKIVSIGDLEARKVDGTKQSEEQRNH 376
           EIEDKEKVQHVLVANPTKYEYLKKKREQEETKQPKIVSIGDLEARKVDGTKQSEEQRNH
Sbjct: 318 EIEDKEKVQHVLVANPTKYEYLKKKREQEETKQPKIVSIGDLEARKVDGTKQSEEQRNH 376

>Scas_636.11
          Length = 353

 Score =  335 bits (860), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 182/364 (50%), Positives = 239/364 (65%), Gaps = 27/364 (7%)

Query: 18  KRQLQQAKEKNENIHIPRYIRNQPWYYKDTPKEQEGKKPGNDDTSTAEGGEKSDYLVHHR 77
           KR   + ++  EN HIPRYI+ QPWYYKD          GN   +  EG +  DYL HHR
Sbjct: 4   KRSTDKKQQTKENQHIPRYIKTQPWYYKD----------GN---AKPEGKDDEDYLKHHR 50

Query: 78  QKAKGGALDIDNNSEPKIGMGIKDEF--KLIRPQKMSVRDSHSLSFCRNCGEAGHKEKDC 135
            K       +D+N EP IG GI D+F     +  K ++ D+  +  C NCG  GH  KDC
Sbjct: 51  NKDHT----LDHNDEPSIGAGISDKFITTETKTLKTTMSDNGDVRKCTNCGTMGHLAKDC 106

Query: 136 MEKPRKMQKLVPDLNSQKNNGTVLVRATDDDWDSRKDRWYGYSGKEYNELISKWERDKRN 195
            E+P+K +KL    +S   +   +    + DWD++KDRW+GY GKEYNEL+  WE  K+N
Sbjct: 107 FERPKKFKKL----DSYSGDQIKIRNDEELDWDAKKDRWFGYEGKEYNELLQNWENKKKN 162

Query: 196 KIKGKDKSQTDETLWDTDEEIELMKLELYKDSVGSLKKDDADNSQL-YRTSTRLREDKAA 254
           ++K     + +  +WD+DEEIELMKL LYKDSVG LKKDD +N+ L  RTS RLRED+AA
Sbjct: 163 ELKMPSNGENEVNIWDSDEEIELMKLGLYKDSVGLLKKDDYNNTHLKNRTSVRLREDRAA 222

Query: 255 YLNDINSTESNYDPKSRLYKTETLGAVDEKSKMFRRHLTGEGLKLNELNQFARSHAKEMG 314
           YLND+NS   NYDPKSR+YK+E LG++DEKSKMFRRHLTGEG++LNELN F R+HA++ G
Sbjct: 223 YLNDVNSGTINYDPKSRIYKSEELGSIDEKSKMFRRHLTGEGIELNELNSFTRAHARQTG 282

Query: 315 IRDEIEDKEKVQHVLVANPTKYEYLKKKREQE---ETKQPKIVSIGDLEARKVDGTKQSE 371
           IRDE+ED  KV+HVLVANPTKYE L ++++Q    E +     +      +K  GT Q+E
Sbjct: 283 IRDEVEDSHKVEHVLVANPTKYEQLMREKKQNLPTERQNEDSTTPQSPMTQKPVGTAQTE 342

Query: 372 EQRN 375
           E ++
Sbjct: 343 ETKD 346

>Kwal_56.23407
          Length = 341

 Score =  291 bits (744), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 171/355 (48%), Positives = 220/355 (61%), Gaps = 35/355 (9%)

Query: 27  KNENIHIPRYIRNQPWYYKDTPKEQEGKKPGNDDTSTAEGGEKSDYLVHHRQKAKGGA-L 85
           K EN+HIP+YI++QPW+YKD        K G+D        + +DYL HHR+  +  + L
Sbjct: 11  KQENVHIPKYIKDQPWFYKDL-------KSGDD--------QSNDYLSHHRRLNRPDSDL 55

Query: 86  DIDNNSEPKIGMGIKDEFKLIRPQKMSVRDSHSLSFCRNCGEAGHKEKDCMEKPRKMQKL 145
           DIDNN+EPKIG GIKDE++        V  S     C NCG   H  +DC+E PRK    
Sbjct: 56  DIDNNAEPKIGRGIKDEYE----GYSEVVTSRVRPKCNNCGGMDHIRRDCLEAPRKR--- 108

Query: 146 VPDLNSQKNNGTVLVRA-TDDDWDSRKDRWYGYSGKEYNELISKWERDKRNKIKGKDKSQ 204
            P         ++L R     +WD+++DRW+GY GKEY + +  WE  K  + +G D+  
Sbjct: 109 -PATTKSVLKSSILRRKDMSGNWDAQRDRWFGYEGKEYEDTLRTWETAKDKESQGNDEI- 166

Query: 205 TDETLWDTDEEIELMKLELYKDSV-GSLKKDDADNSQLYRTSTRLREDKAAYLNDINSTE 263
             E L DTDEEIEL  L LYKD V G++  DD + S+L R S RLRED+AAYLNDINS  
Sbjct: 167 --EDLIDTDEEIELAALGLYKDEVTGAVAPDDENGSRL-RASVRLREDRAAYLNDINSET 223

Query: 264 SNYDPKSRLYKTETLGAVDEKSKMFRRHLTGEGLKLNELNQFARSHAKEMGIRDEIEDKE 323
            NYDPKSRLYK+E LG +D +SKMF RHLTGE L+L +L++FAR      GIRDE+ED  
Sbjct: 224 LNYDPKSRLYKSEDLGEIDTESKMFHRHLTGESLELAKLSRFAREKTLAAGIRDEVEDDA 283

Query: 324 KVQHVLVANPTKYEYLKKKREQEETKQPKIVS--IGDLEARKVDGTKQSEEQRNH 376
           K  HVLVANPTKYE L K   Q++   P  +     +  A+K+ GTKQS+EQR+ 
Sbjct: 284 KTNHVLVANPTKYELLMK---QDKNTAPLTLEERYRNQTAKKITGTKQSDEQRSQ 335

>CAGL0H04917g 469160..470116 similar to sp|Q02775 Saccharomyces
           cerevisiae YDR088c SLU7, hypothetical start
          Length = 318

 Score =  255 bits (651), Expect = 8e-83,   Method: Compositional matrix adjust.
 Identities = 147/326 (45%), Positives = 191/326 (58%), Gaps = 66/326 (20%)

Query: 24  AKEKNENIHIPRYIRNQPWYYKDTPKEQEGKKPGNDDTSTAEGGEKSDYLVHHRQKAKGG 83
            K K+ N HIP YI+N PWYY+D             D ++    ++ DYL HHRQ+    
Sbjct: 14  TKTKDVNEHIPNYIKNLPWYYQDI------------DKNSKNNSKEQDYLRHHRQRRDDK 61

Query: 84  ALDIDNNSEPKIGMGIKDEFKLIRPQKMSVRDSHSLSFCRNCGEAGHKEKDCMEKPRKMQ 143
            +DIDNN + KIG GIKDEF++I   K +  D                            
Sbjct: 62  TIDIDNNDQAKIGTGIKDEFEVIVENKKTTID---------------------------- 93

Query: 144 KLVPDLNSQKNNGTVLVRATDDDWDSRKDRWYGYSGKEYNELISKWERDKRNKIKGKDKS 203
                       G +  R  + DWD+RKDRWYGYSGKEY E++ KWE+ + +       +
Sbjct: 94  ------------GIIKRRKDEKDWDARKDRWYGYSGKEYEEVLKKWEKSREDL-----NN 136

Query: 204 QTDETLWDTDEEIELMKLELYKDSVGSLKKDDADNSQLYRTSTRLREDKAAYLNDINSTE 263
            T+E+ +DTDEEIE+MKL       G   KD   N  +  +S RLREDKAAYL DI S+ 
Sbjct: 137 TTEESAYDTDEEIEMMKL-------GLTPKDLEQN--IKGSSVRLREDKAAYLKDIYSST 187

Query: 264 SNYDPKSRLYKTETLGAVDEKSKMFRRHLTGEGLKLNELNQFARSHAKEMGIRDEIEDKE 323
           +NYDPKSRLYK++ LG++DE S MF RHLTGEG +LN+LN+FAR +AKE GIRDE+ D +
Sbjct: 188 TNYDPKSRLYKSDDLGSIDEHSNMFLRHLTGEGKELNDLNKFARENAKESGIRDELVDAD 247

Query: 324 KVQHVLVANPTKYEYLKKKREQEETK 349
           KV HVLVANPTK E L+K++E +  K
Sbjct: 248 KVNHVLVANPTKLEVLRKQKELDSLK 273

>KLLA0F14531g 1349155..1350180 weakly similar to sp|Q02775
           Saccharomyces cerevisiae YDR088c SLU7 pre-mRNA splicing
           factor affecting 3 splice site choice singleton,
           hypothetical start
          Length = 341

 Score =  139 bits (349), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 111/330 (33%), Positives = 161/330 (48%), Gaps = 59/330 (17%)

Query: 29  ENIHIPRYIRNQPWYYKDTPKEQEGKKPGNDDTSTAEGG-------EKSDYLVHHRQKAK 81
           +N HIP +I+N+PWY  +  +        N +++ +  G       E+ DYL HHR K  
Sbjct: 21  QNEHIPNFIKNKPWYLAEESEVSASTSAINSNSTISGTGTGTGTELEEKDYLSHHRLK-- 78

Query: 82  GGALDIDNNSEPKIGMG-IKDEFKLIRPQKMSVRDSHSLSFCRNCGEAGHKEKDCMEKPR 140
                   +S P  G   I D F  +RP              RN      K+KD  +   
Sbjct: 79  -------KSSVPDSGTAEIDDAFTYVRPS------------GRN-----RKKKDSYD--- 111

Query: 141 KMQKLVPDLNSQKNNGTVLVRATDDDWDSRKDRWYGYSGKEYNELISKWERDKRNKIKGK 200
               L  D   ++ +  V+    + ++D+++DRWYGY+       I + ER+     KG 
Sbjct: 112 ----LDLDAPVRRRDEKVI----ESNYDAKRDRWYGYTPD-----IKEIERNH----KGP 154

Query: 201 DKSQTDETLWDTDEEIELMKLELYKDSVGSLKKDDADNSQLYRTSTRLREDKAAYLNDIN 260
           D S  +    D  +  E+ +L L  + VG          +      RLREDKAAYL D++
Sbjct: 155 DTSHRE---MDEVQIQEMERLGLKPEDVGFDATQPLSGPKEKYNPVRLREDKAAYLQDMS 211

Query: 261 STESNYDPKSRLYKTETLGAVDEKSKMFRRHLTGEGLKLNELNQFARSHAKEMGIRDEIE 320
           S E  YDPKSR+YK++  G +D KSKMF RHLTG+ L++  +N+  R  A   GI+D   
Sbjct: 212 SEEMLYDPKSRIYKSKEEGTIDPKSKMFHRHLTGDALQVGVINERVRQEAVRSGIKDFEV 271

Query: 321 DKEKVQHVLVANPTKYEYLKKKREQEETKQ 350
           +KEK+ HV  ANPTKYE +   R + E KQ
Sbjct: 272 NKEKLNHVFAANPTKYELM--MRTEPERKQ 299

>AGR159C [4470] [Homologous to ScYDR088C (SLU7) - SH]
           (1044766..1045566) [801 bp, 266 aa]
          Length = 266

 Score = 76.6 bits (187), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 69/249 (27%), Positives = 107/249 (42%), Gaps = 60/249 (24%)

Query: 29  ENIHIPRYIRNQPWYYKDTPKEQEGKKPGNDDTSTAEGGEKSDYLVHHRQKAKGGALDID 88
           EN HIP+YIR++PWY +           G+DD         +DYL HHR++   GA D  
Sbjct: 3   ENKHIPKYIRDKPWYVES----------GDDD---------ADYLGHHRREPGEGAQDF- 42

Query: 89  NNSEPKIGMGIKDEFKLIRPQKMSVRDSHSLSFCRNCGEAGHKEKDCMEKPRKMQKLVPD 148
             S  + G  I D F        + R       C NCG A H  +DC+ +PRK       
Sbjct: 43  --SVAQQGSVISDRFVA----GSAPRAGRGRGRCTNCG-ANHDRRDCLLRPRKQ------ 89

Query: 149 LNSQKNNGTVLVRATDDD---WDSRKDRWYGYSGKEYNELISKWERDKRNKIKGKDKSQT 205
             ++ + G    +  D++   +++++DRWYG+ G     + +               ++ 
Sbjct: 90  --ARGDGGERAFQVRDENALSFEAKRDRWYGFEGPVAPAVAAA-------------AAEP 134

Query: 206 DETLWDTDEEIELMKLELYKDSVGSLKKDDADNSQLYRTSTRLREDKAAYLNDINSTESN 265
                D    +E  KL L   +  +     A          R R D+A YL+D+   E+ 
Sbjct: 135 PAAAEDAAAAVERYKLGLDARAARAGVGAPA---------IRPRHDRARYLDDVRGEETR 185

Query: 266 YDPKSRLYK 274
           YDPKSR+Y+
Sbjct: 186 YDPKSRVYR 194

>Scas_546.3d
          Length = 931

 Score = 37.7 bits (86), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 61/269 (22%), Positives = 111/269 (41%), Gaps = 38/269 (14%)

Query: 28  NENIHIPRYIRNQPWYYKDTPKEQEGKKPGNDDTSTAEGGEKSDYLVHHRQKAKGGALDI 87
           N  + IP + RNQP Y  D PK    +   N     +E  +    L   + + K   +++
Sbjct: 142 NSLLVIPGHFRNQPVYIPD-PKMVYDEVSLN----YSEVNKDKSLLSSEQLELKKNIIEM 196

Query: 88  -------------DNNSEPKIGMGIKDEFKLIRPQKMSVRDSHSLSFCRNCGEAGHKEKD 134
                         N+ +P I   +   F + R       D H   F RN    G   + 
Sbjct: 197 ATTFWKVNQDLLPTNSKKPTIS-AVAKYFHIPR----QTFDDHIKGFHRNSAIFGASSRP 251

Query: 135 CMEKPRKMQKLVPDLNSQKNNGTVLVRATDDDWDSRKDRWY-----GYSGKE-YNELISK 188
            ++   ++Q +  +L    NNG   + AT+DD   R +R       G    E  NELI K
Sbjct: 252 LLDN-NELQLIKANLKMASNNGCP-IPATEDDMKYRIERILEKKRRGLKEIEMVNELIDK 309

Query: 189 WERDKRNKIKGKDKSQTDETLWDTDEEIELMKLELYKDSVGSLKKDDADNSQLYRTSTRL 248
           W+   ++ I+G++       ++D+ E+++  ++ +   S+ SL  +  +  +L RT   L
Sbjct: 310 WKEADKDSIQGENYK-----VYDSLEQLK--RILISGISIQSLNFNPIEYLKLKRTFEHL 362

Query: 249 REDKAAYLNDINSTESNYDPKSRLYKTET 277
              ++ Y N+++    N   K  + +  T
Sbjct: 363 NSIRSTYQNNLSGKPLNTVSKRTITRIRT 391

>Scas_713.41
          Length = 523

 Score = 36.6 bits (83), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 25/55 (45%)

Query: 119 LSFCRNCGEAGHKEKDCMEKPRKMQKLVPDLNSQKNNGTVLVRATDDDWDSRKDR 173
           +  CR CG+ GH  +DC    +  Q   P  N+  N+ +     TD   D ++ R
Sbjct: 301 MIVCRKCGQTGHTTRDCTFTTQPPQHFPPSTNASYNSNSRYSNYTDSQNDLKRRR 355

>CAGL0G10109g complement(967161..969161) similar to sp|P32349
           Saccharomyces cerevisiae YPR190c RPC82 DNA-directed RNA
           polymerase III, hypothetical start
          Length = 666

 Score = 35.4 bits (80), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 37/132 (28%), Positives = 60/132 (45%), Gaps = 29/132 (21%)

Query: 159 LVRATDDDWDSRKDRWYGYSGKEYNELI-SKWERDKRNKIKGKDKSQTD-----ETLWDT 212
           LVR T  D+   KD W     KEYN+L  +  + D + + + K+K++T+     E   D 
Sbjct: 217 LVRLTKFDYTPIKDLWNLLYEKEYNQLPRNSTQSDLKKRTEAKNKAKTEFHNLMEASTDL 276

Query: 213 DEEIEL----------------MKLELYKDSVGSLKKDDADNS-------QLYRTSTRLR 249
            + I+L                + ++ +  S  SL+  +   S       QLY+ + +L 
Sbjct: 277 SKLIKLDPSTSLRTVIPTATLTINIKRFLKSRRSLQLTNYARSRVGPVSAQLYKLALKLT 336

Query: 250 EDKAAYLNDINS 261
           E+KA Y NDI S
Sbjct: 337 ENKAPYFNDILS 348

>Sklu_2438.9 YDL175C, Contig c2438 19268-20365
          Length = 365

 Score = 32.3 bits (72), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 37/150 (24%), Positives = 63/150 (42%), Gaps = 21/150 (14%)

Query: 65  EGGEKSDYLVHHRQKAKGGALDIDNNSEPKIGMGIKDEFKLIRPQKMSVRDSHSLSFCRN 124
           EGG       H  ++    + +  N+S  +   GI   + L+   K  V  +H + FC N
Sbjct: 114 EGGHYRSQCPHKWKRIYCTSCNSKNHSRDRC-PGIWRSYYLLDNNKKRVLPTHRV-FCYN 171

Query: 125 CGEAGHKEKDCMEKPRKMQKLVPDLNSQKNNGTVLVRATDDDWDSRKDRWYGYSGKEYNE 184
           CG  GH   DC   P +    VP+      +G+              D   G   +EY  
Sbjct: 172 CGGKGHFGDDC---PERRSSRVPN-----EDGSAFA----------GDNLPGKLKQEYFA 213

Query: 185 LISKWERDKRNKIKGKDKSQTDETLWDTDE 214
            + K+ R++R +  G ++ QTD + +D ++
Sbjct: 214 SLRKYNRERRWQDYG-NEDQTDASQFDYND 242

>YER164W (CHD1) [1592] chr5 (505387..509793) Protein involved in
           ATP-dependent nucleosome remodeling activity, member of
           the Chromodomain-Helicase-DNA-binding (CHD) family [4407
           bp, 1468 aa]
          Length = 1468

 Score = 32.0 bits (71), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 28/51 (54%), Gaps = 5/51 (9%)

Query: 115 DSHSLSFCRNCGEAGHKEKDCMEKPRKMQKLVPDLNSQKNNGTVLVRATDD 165
           D H +    N     H+ K  +E+ + ++K VPDLN+ K N   L++ TD+
Sbjct: 175 DFHGIDIVIN-----HRLKTSLEEGKVLEKTVPDLNNCKENYEFLIKWTDE 220

>Scas_685.13*
          Length = 354

 Score = 31.6 bits (70), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 18/31 (58%)

Query: 122 CRNCGEAGHKEKDCMEKPRKMQKLVPDLNSQ 152
           C  CGE GHK+ +C  K +  +K+  D N Q
Sbjct: 324 CFGCGETGHKKNECPNKNQDRKKVKADTNKQ 354

>YLR116W (MSL5) [3529] chr12 (380823..382253) Component of the
           splicing commitment complex involved in recognition of
           branchpoint sequence and in bridging the ends of the
           intron [1431 bp, 476 aa]
          Length = 476

 Score = 31.6 bits (70), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 27/48 (56%), Gaps = 3/48 (6%)

Query: 122 CRNCGEAGHKEKDCMEKPRKMQKLVPDLNSQKNNGTVLVRATDDDWDS 169
           C+ CG+ GH  +DC    ++M +   D N+  NN +  +++ D  ++S
Sbjct: 299 CKICGQTGHFSRDCNSSSQRMSRF--DRNATVNN-SAPIQSNDVHYNS 343

>YIL079C (AIR1) [2592] chr9 complement(210920..212002) RING finger
           protein that inhibits arginine methylation of Npl3p
           [1083 bp, 360 aa]
          Length = 360

 Score = 31.2 bits (69), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 11/18 (61%), Positives = 12/18 (66%)

Query: 121 FCRNCGEAGHKEKDCMEK 138
           FC NCG AGH   DC E+
Sbjct: 174 FCYNCGNAGHFGDDCAER 191

>KLLA0F05896g complement(566005..567054) similar to sp|P40507
           Saccharomyces cerevisiae YIL079c, start by similarity
          Length = 349

 Score = 29.3 bits (64), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 11/19 (57%), Positives = 11/19 (57%)

Query: 119 LSFCRNCGEAGHKEKDCME 137
           L FC NCG  GH   DCM 
Sbjct: 165 LIFCYNCGGKGHFGDDCMS 183

>YDR285W (ZIP1) [1114] chr4 (1032428..1035055) Structural protein of
           the synaptonemal complex central element [2628 bp, 875
           aa]
          Length = 875

 Score = 29.3 bits (64), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 39/144 (27%), Positives = 61/144 (42%), Gaps = 15/144 (10%)

Query: 110 KMSVRDSHSLSFCRNCGEAGHKEKDCMEKPRKMQKLVPDLNSQKNNGTVLVRATDDDWDS 169
           K+ VR     S      E   K K C+E    +Q+ +  L S KNN    ++    +   
Sbjct: 207 KLKVRLQSYASNSDKINEKVGKYKSCLET---LQERIATLTSHKNNQETKLKDLRQNHQL 263

Query: 170 RKDRWYGY--SGKEYNELISKWERDKRNKIKGKDKSQTDETLWDTDEEIELMKLELYKDS 227
            + R  G+  S +  N+ I+           GK+K + D  L    +EIE +K EL  D 
Sbjct: 264 YQRRISGFKTSIENLNKTINDL---------GKNKKEADAELMKKGKEIEYLKREL-DDC 313

Query: 228 VGSLKKDDADNSQLYRTSTRLRED 251
            G L ++   NS L +   + RE+
Sbjct: 314 SGQLSEEKIKNSSLIQEMGKNREE 337

>Scas_721.136
          Length = 411

 Score = 28.9 bits (63), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 28/47 (59%), Gaps = 1/47 (2%)

Query: 224 YKDSVGSLKKDDADNSQLYRTSTRLREDKAAYLNDINSTESNYDPKS 270
           YKD+  S++ +D ++   Y  + +LR   +  LNDI ST +N +P S
Sbjct: 361 YKDTNDSVRNEDDEHILPYSATLQLRVLTSG-LNDIQSTNTNAEPNS 406

>Scas_681.16
          Length = 2048

 Score = 29.3 bits (64), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 24/101 (23%), Positives = 45/101 (44%), Gaps = 19/101 (18%)

Query: 253 AAYLNDINSTESNYDPKSR---------LYKTETLGAVDEKSKMFRRHLTGEGLKLNELN 303
            A L  + S  S Y+P ++         ++       V E+ +  +R L+  G+K+ EL 
Sbjct: 427 VAILTILRSLSSFYNPNTKKLAIDKFKAVFIAPLKALVQEQVRELQRRLSYLGIKVAELT 486

Query: 304 QFARSHAKEMGIRDEIEDKEKVQHVLVANPTKYEYLKKKRE 344
             +R        R +I +     H+LV+ P K++ + +K E
Sbjct: 487 GDSRLT------RQQINET----HILVSTPEKWDVVTRKSE 517

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.309    0.129    0.366 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 13,666,651
Number of extensions: 683742
Number of successful extensions: 2665
Number of sequences better than 10.0: 166
Number of HSP's gapped: 2629
Number of HSP's successfully gapped: 172
Length of query: 376
Length of database: 16,596,109
Length adjustment: 103
Effective length of query: 273
Effective length of database: 13,030,455
Effective search space: 3557314215
Effective search space used: 3557314215
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 62 (28.5 bits)