Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YDR087C (RRP1)27826212791e-180
Scas_636.102882587981e-107
Kwal_56.234052802657951e-106
CAGL0M11110g2702547631e-102
AGR158C2672627176e-95
KLLA0C11979g2612536532e-85
Sklu_1568.32202145623e-72
Kwal_26.733258392730.31
KLLA0E13541g35869643.3
YPR023C (EAF3)40150617.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YDR087C
         (274 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YDR087C (RRP1) [939] chr4 complement(617464..618300) Protein inv...   497   e-180
Scas_636.10                                                           311   e-107
Kwal_56.23405                                                         310   e-106
CAGL0M11110g complement(1095317..1096129) similar to sp|P35178 S...   298   e-102
AGR158C [4469] [Homologous to ScYDR087C (RRP1) - SH] (1043874..1...   280   6e-95
KLLA0C11979g complement(1027919..1028704) similar to sp|P35178 S...   256   2e-85
Sklu_1568.3 YDR087C, Contig c1568 3651-4313 reverse complement        221   3e-72
Kwal_26.7332                                                           33   0.31 
KLLA0E13541g complement(1191602..1192678) similar to sp|Q12432 S...    29   3.3  
YPR023C (EAF3) [5457] chr16 complement(608821..610026) Component...    28   7.4  

>YDR087C (RRP1) [939] chr4 complement(617464..618300) Protein
           involved in maturation of 25S rRNA [837 bp, 278 aa]
          Length = 278

 Score =  497 bits (1279), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 247/262 (94%), Positives = 247/262 (94%)

Query: 1   METSNFVKQLSSNNRKTRVNALEALKKYLTAKQFKENKQIEFNKLWKGLYYAMWFSDRPR 60
           METSNFVKQLSSNNRKTRVNALEALKKYLTAKQFKENKQIEFNKLWKGLYYAMWFSDRPR
Sbjct: 1   METSNFVKQLSSNNRKTRVNALEALKKYLTAKQFKENKQIEFNKLWKGLYYAMWFSDRPR 60

Query: 61  PQQRLANELGELHGLYFDPKDNSTADELTTNDKAFIKFSRGFWKVMCFEWFNIDRYRLDK 120
           PQQRLANELGELHGLYFDPKDNSTADELTTNDKAFIKFSRGFWKVMCFEWFNIDRYRLDK
Sbjct: 61  PQQRLANELGELHGLYFDPKDNSTADELTTNDKAFIKFSRGFWKVMCFEWFNIDRYRLDK 120

Query: 121 YLLLIRRVLFSQLKYLQSRNWDKKLVDEYIKKVLRWLPLSGSPKVYTGIPIHIVDILLDE 180
           YLLLIRRVLFSQLKYLQSRNWDKKLVDEYIKKVLRWLPLSGSPKVYTGIPIHIVDILLDE
Sbjct: 121 YLLLIRRVLFSQLKYLQSRNWDKKLVDEYIKKVLRWLPLSGSPKVYTGIPIHIVDILLDE 180

Query: 181 WERLLKXXXXXXXXXXXXXXXMRKIAESAKKTPLADVIAIFQDIVADYNNSKVLREKIKE 240
           WERLLK               MRKIAESAKKTPLADVIAIFQDIVADYNNSKVLREKIKE
Sbjct: 181 WERLLKDGDEDDEDEENKEEEMRKIAESAKKTPLADVIAIFQDIVADYNNSKVLREKIKE 240

Query: 241 DLFSDTRLVSWDILEGETQHND 262
           DLFSDTRLVSWDILEGETQHND
Sbjct: 241 DLFSDTRLVSWDILEGETQHND 262

>Scas_636.10
          Length = 288

 Score =  311 bits (798), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 155/258 (60%), Positives = 193/258 (74%), Gaps = 4/258 (1%)

Query: 1   METSNFVKQLSSNNRKTRVNALEALKKYLTAKQFKENKQIEFNKLWKGLYYAMWFSDRPR 60
           M+TS FVKQLSSNNR  R  +LEAL+K+L +K+    KQ +FNKLWKGLY+AMWFSDRPR
Sbjct: 1   MDTSTFVKQLSSNNRVVREKSLEALEKFLVSKKCLSFKQSQFNKLWKGLYFAMWFSDRPR 60

Query: 61  PQQRLANELGELHGLYFDPKDNSTADE---LTTNDKAFIKFSRGFWKVMCFEWFNIDRYR 117
           PQQRLAN+LG+L+GLYF+ KDN   +    L+ NDKAFIKFS+ FWK++C EW++IDR+R
Sbjct: 61  PQQRLANKLGQLYGLYFNEKDNENQENETRLSDNDKAFIKFSKAFWKILCLEWYSIDRFR 120

Query: 118 LDKYLLLIRRVLFSQLKYLQSRNWDKKLVDEYIKKVLRWLPLSGSPKVYTGIPIHIVDIL 177
           +DKYLLL RRV F+QLKYLQSRNW+ KLV++Y + VL  LPLSG  KVY+GIP HI+DIL
Sbjct: 121 MDKYLLLTRRVFFNQLKYLQSRNWNAKLVEQYCQGVLVDLPLSGDAKVYSGIPFHIIDIL 180

Query: 178 LDEWERLLKXXXXXXXXXXXXXXXMRKIAESAKKTPLADVIAIFQDIVADYNNSKVLREK 237
           LDEWERLL                   I  + K+TPL + I IF  +V++ NNSK+LR K
Sbjct: 181 LDEWERLLT-DKDDEHDDEEKETDEVDIVIAVKETPLNNFIKIFYGLVSNVNNSKILRTK 239

Query: 238 IKEDLFSDTRLVSWDILE 255
           IKEDL +D RL+ W I+E
Sbjct: 240 IKEDLLADPRLIEWGIIE 257

>Kwal_56.23405
          Length = 280

 Score =  310 bits (795), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 152/265 (57%), Positives = 189/265 (71%), Gaps = 8/265 (3%)

Query: 1   METSNFVKQLSSNNRKTRVNALEALKKYLTAKQFKENKQIEFNKLWKGLYYAMWFSDRPR 60
           ME+S FVKQL+SN R  R  AL++LKKYLT KQFKENKQ  F+KLWKGLYYAMWFSDRPR
Sbjct: 1   MESSAFVKQLASNTRTVREEALDSLKKYLTTKQFKENKQASFDKLWKGLYYAMWFSDRPR 60

Query: 61  PQQRLANELGELHGLYFDPKDNSTAD-ELTTNDKAFIKFSRGFWKVMCFEWFNIDRYRLD 119
           PQQRLAN LGELH LYFD  DN  ++ ELT ND+AF+KFS+ FW+V+C EW+ ID +RLD
Sbjct: 61  PQQRLANSLGELHVLYFDKADNQKSNGELTLNDRAFLKFSKAFWRVICLEWYGIDHHRLD 120

Query: 120 KYLLLIRRVLFSQLKYLQSRNWDKKLVDEYIKKVLRWLPLSGSPKVYTGIPIHIVDILLD 179
           KYLLL+RRVL  QL+YLQ R WD+++V  YI+ VLR LPLSG  KVY GIP HI+DI +D
Sbjct: 121 KYLLLVRRVLAHQLRYLQLREWDEEVVSNYIRAVLRKLPLSGDKKVYNGIPFHIIDIFVD 180

Query: 180 EWERLL-------KXXXXXXXXXXXXXXXMRKIAESAKKTPLADVIAIFQDIVADYNNSK 232
           EWE+L+                       +++      +TPLA  + IF+D+ ++ NN K
Sbjct: 181 EWEKLILHNGEDEDEEDDEKTNQEDEEAKLQEECARIAETPLAQFVEIFEDLASNINNIK 240

Query: 233 VLREKIKEDLFSDTRLVSWDILEGE 257
            LR+KIKED+F D RL  W +LE +
Sbjct: 241 SLRDKIKEDIFKDERLKKWGVLETQ 265

>CAGL0M11110g complement(1095317..1096129) similar to sp|P35178
           Saccharomyces cerevisiae YDR087c RRP1 involved in
           processing rRNA precursor species to mature rRNAs, start
           by similarity
          Length = 270

 Score =  298 bits (763), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 141/254 (55%), Positives = 187/254 (73%), Gaps = 4/254 (1%)

Query: 1   METSNFVKQLSSNNRKTRVNALEALKKYLTAKQFKENKQIEFNKLWKGLYYAMWFSDRPR 60
           METS FVKQL+SNNR  R  ALE L++++ + QFK++KQ++F+KLWKGLYYAMWF DRPR
Sbjct: 1   METSKFVKQLASNNRVVREKALETLEQFIVSAQFKKSKQVQFDKLWKGLYYAMWFCDRPR 60

Query: 61  PQQRLANELGELHGLYFDPKDNSTADELTTNDKAFIKFSRGFWKVMCFEWFNIDRYRLDK 120
           PQQRLA+ LG LH  +FD +D S A+ELT NDKAF++FS+ FW++MC EW  IDR+RLDK
Sbjct: 61  PQQRLASTLGALHVRFFDERD-SGAEELTVNDKAFVRFSKAFWRIMCLEWLGIDRFRLDK 119

Query: 121 YLLLIRRVLFSQLKYLQSRNWDKKLVDEYIKKVLRWLPLSGSPKVYTGIPIHIVDILLDE 180
           YLLLIRR LF+Q KYLQ R W   LV +Y+++VL  +PLSG PKVY GIPIH++DI+LDE
Sbjct: 120 YLLLIRRALFNQFKYLQMRQWHAPLVAKYLERVLGAIPLSGDPKVYNGIPIHVMDIMLDE 179

Query: 181 WERLLKXXXXXXXXXXXXXXXMRKIAESAKKTPLADVIAIFQDIVADYNNSKVLREKIKE 240
           WERL                 M+   E    +PL  V+ I ++++ +Y+NSK+LR+KIK+
Sbjct: 180 WERLALEDEEEELEEDKKLEIMK---EFVSGSPLDQVLDILRNLLKNYDNSKILRDKIKK 236

Query: 241 DLFSDTRLVSWDIL 254
           ++ +D RL  W I+
Sbjct: 237 EVLTDKRLAQWGIV 250

>AGR158C [4469] [Homologous to ScYDR087C (RRP1) - SH]
           (1043874..1044677) [804 bp, 267 aa]
          Length = 267

 Score =  280 bits (717), Expect = 6e-95,   Method: Compositional matrix adjust.
 Identities = 133/262 (50%), Positives = 183/262 (69%), Gaps = 11/262 (4%)

Query: 1   METSNFVKQLSSNNRKTRVNALEALKKYLTAKQFKENKQIEFNKLWKGLYYAMWFSDRPR 60
           ++TS FV+QL+SN+R  R  ALE+L+ YL ++Q ++  Q++F++LWKGLY+AMWFSDRPR
Sbjct: 4   VQTSPFVRQLASNSRSVREQALESLRSYLASQQLRKAPQLQFDQLWKGLYFAMWFSDRPR 63

Query: 61  PQQRLANELGELHGLYFDPKDNSTADELTTNDKAFIKFSRGFWKVMCFEWFNIDRYRLDK 120
           PQQRLA +LGEL  L+ D        +    D+AF++FS+ FWKVMC EW+NID +RLDK
Sbjct: 64  PQQRLAAQLGELSLLFLD-------GDTALGDRAFVRFSKAFWKVMCLEWYNIDHHRLDK 116

Query: 121 YLLLIRRVLFSQLKYLQSRNWDKKLVDEYIKKVLRWLPLSGSPKVYTGIPIHIVDILLDE 180
           YLLL+RRVL++QL++L+ R WD  LV+ Y+ KVL+ LPLSGSPKVY GIP HI+DI +DE
Sbjct: 117 YLLLVRRVLYNQLRFLRERGWDAALVERYVAKVLQGLPLSGSPKVYNGIPFHIIDIFVDE 176

Query: 181 WERL-LKXXXXXXXXXXXXXXXMRKIAESAKKTPLADVIAIFQDIVADYNNSKVLREKIK 239
           WERL L+                R +  +   TPL   +A+FQ + A+  N K+LREKIK
Sbjct: 177 WERLVLRDGRDAEDADMPELPEQRDLIAA---TPLPRFVAVFQGLAANIANIKILREKIK 233

Query: 240 EDLFSDTRLVSWDILEGETQHN 261
           +DL +D RL  W +L  ++  +
Sbjct: 234 QDLLADQRLYDWGVLARDSPES 255

>KLLA0C11979g complement(1027919..1028704) similar to sp|P35178
           Saccharomyces cerevisiae YDR087c RRP1 involved in
           processing rRNA precursor species to mature rRNAs
           singleton, start by similarity
          Length = 261

 Score =  256 bits (653), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 130/253 (51%), Positives = 169/253 (66%), Gaps = 12/253 (4%)

Query: 4   SNFVKQLSSNNRKTRVNALEALKKYLTAKQFKENKQIEFNKLWKGLYYAMWFSDRPRPQQ 63
           +  VKQL+ + ++TR  A E+L+KYLT + F+  KQ +F+KLWKGLYY+MW  D+P PQQ
Sbjct: 3   NTLVKQLAGHRKETREQAFESLRKYLTTRNFQNAKQSQFDKLWKGLYYSMWHCDKPIPQQ 62

Query: 64  RLANELGELHGLYFDPKDNSTADELTTNDKAFIKFSRGFWKVMCFEWFNIDRYRLDKYLL 123
            LA  LGELH LY   K          N +AFI+FS+ FWKV+C EW+ ID +RLDK+LL
Sbjct: 63  SLAYSLGELHLLYLKGK----------NQQAFIRFSKAFWKVICIEWYRIDHHRLDKFLL 112

Query: 124 LIRRVLFSQLKYLQSRNWDKKLVDEYIKKVLRWLPLSGSPKVYTGIPIHIVDILLDEWER 183
           LIRR L  Q+KYL    W++ LVD+YI KVL+ +PLSG  KVY GIP HI+DILLDEW +
Sbjct: 113 LIRRCLHFQIKYLHECEWEQALVDDYINKVLKKIPLSGDRKVYNGIPFHIIDILLDEWVK 172

Query: 184 LLKXXXXXXXXXXXXXXXMRKIAESAKKTPLADVIAIFQDIVADYNNSKVLREKIKEDLF 243
           +                   K A S  KTPL+D I+IFQ++ +D NN K+LR+KIKEDL 
Sbjct: 173 VCYGEEEDEEDNEDDKEEEIKEAVS--KTPLSDFISIFQELSSDTNNIKILRDKIKEDLL 230

Query: 244 SDTRLVSWDILEG 256
            D RL +WD+L+ 
Sbjct: 231 KDQRLRAWDVLQS 243

>Sklu_1568.3 YDR087C, Contig c1568 3651-4313 reverse complement
          Length = 220

 Score =  221 bits (562), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 117/214 (54%), Positives = 147/214 (68%), Gaps = 14/214 (6%)

Query: 53  MWFSDRPRPQQRLANELGELHGLYFDPKDNSTADELTTNDKAFIKFSRGFWKVMCFEWFN 112
           MWFSDRPRPQ RL NELGELH L+F   +N    E+T  DKAFIKF+ GFWKV+C EW++
Sbjct: 1   MWFSDRPRPQHRLGNELGELHLLFFAAVENKQ--EITLVDKAFIKFTNGFWKVICLEWYS 58

Query: 113 IDRYRLDKYLLLIRRVLFSQLKYLQSRNWDKKLVDEYIKKVLRWLPLSGSPKVYTGIPIH 172
           ID +RLDKY+LL+RRVLF+QLKYL+ RNW+++LV +YI  VL+ LPLSG  KVY GIP H
Sbjct: 59  IDHHRLDKYILLVRRVLFNQLKYLKLRNWNEELVLKYIDSVLKKLPLSGDKKVYNGIPFH 118

Query: 173 IVDILLDEWERLLKXXXXXXXXXXXXXXXMRKIAESAKK----TPLADVIAIFQDIVADY 228
           I+DI +DEWE+L+                  K +E  K+    TPL+  + IFQD+ ++ 
Sbjct: 119 IIDIFVDEWEKLV-----IRDGEDEGEDGEEKDSEECKQLIAATPLSLFVEIFQDLSSNI 173

Query: 229 NNSKVLREKIKEDLFSDTRLVSWDILEGETQHND 262
            N KVLREKIKED+  D RL  W IL   TQ +D
Sbjct: 174 ENIKVLREKIKEDILGDQRLHLWGIL---TQGDD 204

>Kwal_26.7332
          Length = 583

 Score = 32.7 bits (73), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 43/92 (46%), Gaps = 18/92 (19%)

Query: 54  WFSDRPRPQQRL------------ANELGELH---GLYFDPKDNSTADELTTNDKAFIKF 98
           WFS  PR +Q+L            A E  +LH   G++ D  D    DE   N++  + F
Sbjct: 272 WFSTEPRKRQKLGSFQLFVQDYVGAGEFLDLHPFPGMFRDRNDTKKTDEFHWNEQTLLSF 331

Query: 99  SRGFWKVMCFEWF--NIDRYRLDKYLLLIRRV 128
            +   K++  ++   N DR  LD +++  R++
Sbjct: 332 RQQLEKLIILDYIMRNTDR-GLDNWMVRTRKL 362

>KLLA0E13541g complement(1191602..1192678) similar to sp|Q12432
           Saccharomyces cerevisiae YPR023c EAF3 singleton, start
           by similarity
          Length = 358

 Score = 29.3 bits (64), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 17/69 (24%), Positives = 33/69 (47%), Gaps = 18/69 (26%)

Query: 163 PKVYTGIPIHIVDILLDEWERLLKXXXXXXXXXXXXXXXMRKIAESAKKTPLADVIAIFQ 222
           PK++  +PI +  +L+D+WE + K                RK+ +   + P+  +++ F 
Sbjct: 186 PKIHIKVPISLRSVLVDDWENVTKD---------------RKLVQLPSERPIEHILSQF- 229

Query: 223 DIVADYNNS 231
              AD +NS
Sbjct: 230 --YADTSNS 236

>YPR023C (EAF3) [5457] chr16 complement(608821..610026) Component of
           the NuA4 histone acetyltransferase complex [1206 bp, 401
           aa]
          Length = 401

 Score = 28.1 bits (61), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 14/50 (28%), Positives = 26/50 (52%)

Query: 137 QSRNWDKKLVDEYIKKVLRWLPLSGSPKVYTGIPIHIVDILLDEWERLLK 186
           Q+ N D++        +L  +    +PK+   IPI +  +L+D+WE + K
Sbjct: 192 QNGNDDRRRSSSLSPNMLHHIAGYPTPKISLQIPIKLKSVLVDDWEYVTK 241

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.321    0.137    0.414 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,596,410
Number of extensions: 364593
Number of successful extensions: 1039
Number of sequences better than 10.0: 14
Number of HSP's gapped: 1026
Number of HSP's successfully gapped: 14
Length of query: 274
Length of database: 16,596,109
Length adjustment: 100
Effective length of query: 174
Effective length of database: 13,134,309
Effective search space: 2285369766
Effective search space used: 2285369766
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 61 (28.1 bits)