Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YDR086C (SSS1)80802942e-36
Scas_636.9*72681986e-22
Sklu_1568.270681692e-17
Kwal_56.23403111681695e-17
KLLA0C11957g70681656e-17
AGR157C70681501e-14
ADL235W58246640.25
KLLA0D02332g16124581.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YDR086C
         (80 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YDR086C (SSS1) [938] chr4 complement(616922..617164) Component o...   117   2e-36
Scas_636.9*                                                            81   6e-22
Sklu_1568.2 YDR086C, Contig c1568 3228-3440 reverse complement         70   2e-17
Kwal_56.23403                                                          70   5e-17
KLLA0C11957g complement(1027449..1027661) similar to sp|P35179 S...    68   6e-17
AGR157C [4468] [Homologous to ScYDR086C (SSS1) - SH] (1043498..1...    62   1e-14
ADL235W [1506] [Homologous to ScYNL048W (ALG11) - SH] complement...    29   0.25 
KLLA0D02332g 198735..199220 no similarity, hypothetical start          27   1.4  

>YDR086C (SSS1) [938] chr4 complement(616922..617164) Component of
          the Sec61p-Sss1p-Sbh1p complex and the
          Ssh1p-Sss1p-Sbh2p complex, involved in protein
          translocation into the endoplasmic reticulum [243 bp,
          80 aa]
          Length = 80

 Score =  117 bits (294), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 61/80 (76%)

Query: 1  MARASEKGEEKKQSNNQVEKLVEAPVEFVREGTQFLAKCKKPDLKEYTKXXXXXXXXXXX 60
          MARASEKGEEKKQSNNQVEKLVEAPVEFVREGTQFLAKCKKPDLKEYTK           
Sbjct: 1  MARASEKGEEKKQSNNQVEKLVEAPVEFVREGTQFLAKCKKPDLKEYTKIVKAVGIGFIA 60

Query: 61 XXXXXXXXKLIHIPIRYVIV 80
                  KLIHIPIRYVIV
Sbjct: 61 VGIIGYAIKLIHIPIRYVIV 80

>Scas_636.9*
          Length = 72

 Score = 80.9 bits (198), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 38/68 (55%), Positives = 47/68 (69%)

Query: 13 QSNNQVEKLVEAPVEFVREGTQFLAKCKKPDLKEYTKXXXXXXXXXXXXXXXXXXXKLIH 72
          +S+NQ+EKL++AP+EFV++G QFL KCKKPDLKEYT+                   KLIH
Sbjct: 5  KSDNQIEKLMDAPLEFVKDGNQFLNKCKKPDLKEYTRIVRAVGIGFVAVGIIGYAIKLIH 64

Query: 73 IPIRYVIV 80
          IPIRYVIV
Sbjct: 65 IPIRYVIV 72

>Sklu_1568.2 YDR086C, Contig c1568 3228-3440 reverse complement
          Length = 70

 Score = 69.7 bits (169), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 43/68 (63%)

Query: 13 QSNNQVEKLVEAPVEFVREGTQFLAKCKKPDLKEYTKXXXXXXXXXXXXXXXXXXXKLIH 72
          + NNQ+E+L EAP+EFV++G+ F+ KCKKP+ KEY K                   KL+H
Sbjct: 3  KGNNQIEQLAEAPLEFVKDGSAFIQKCKKPNNKEYLKIVRAVGIGFVAVGVIGYAIKLVH 62

Query: 73 IPIRYVIV 80
          IPIRY+IV
Sbjct: 63 IPIRYLIV 70

>Kwal_56.23403
          Length = 111

 Score = 69.7 bits (169), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 33/68 (48%), Positives = 43/68 (63%)

Query: 13  QSNNQVEKLVEAPVEFVREGTQFLAKCKKPDLKEYTKXXXXXXXXXXXXXXXXXXXKLIH 72
           +SNNQ+EKL EAPVEFV+EG+ F+ KCKKP  K++ +                   KL+H
Sbjct: 44  KSNNQIEKLAEAPVEFVKEGSAFIQKCKKPTNKDFLQIVRAVGIGFVAVGIIGYAIKLVH 103

Query: 73  IPIRYVIV 80
           IPIRY+IV
Sbjct: 104 IPIRYLIV 111

>KLLA0C11957g complement(1027449..1027661) similar to sp|P35179
          Saccharomyces cerevisiae YDR086c SSS1 ER
          protein-translocase complex subunit singleton, start by
          similarity
          Length = 70

 Score = 68.2 bits (165), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 40/68 (58%)

Query: 13 QSNNQVEKLVEAPVEFVREGTQFLAKCKKPDLKEYTKXXXXXXXXXXXXXXXXXXXKLIH 72
          + N Q +KLVE P+EFV+EG QFL KCKKP  KEY K                   KLIH
Sbjct: 3  KQNAQFDKLVETPLEFVKEGNQFLQKCKKPSKKEYLKIIQAVGIGFVAVGVIGYIIKLIH 62

Query: 73 IPIRYVIV 80
          IPIRY+IV
Sbjct: 63 IPIRYLIV 70

>AGR157C [4468] [Homologous to ScYDR086C (SSS1) - SH]
          (1043498..1043710) [213 bp, 70 aa]
          Length = 70

 Score = 62.4 bits (150), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 42/68 (61%)

Query: 13 QSNNQVEKLVEAPVEFVREGTQFLAKCKKPDLKEYTKXXXXXXXXXXXXXXXXXXXKLIH 72
          ++NN +EKL +AP+EF ++GT FL+KC KP+ +E+ +                   KLIH
Sbjct: 3  KNNNNLEKLSDAPLEFFKDGTAFLSKCNKPNQREFLQIIRAVGIGFLAVGVIGYAIKLIH 62

Query: 73 IPIRYVIV 80
          IPIR++IV
Sbjct: 63 IPIRHLIV 70

>ADL235W [1506] [Homologous to ScYNL048W (ALG11) - SH]
           complement(291105..292853) [1749 bp, 582 aa]
          Length = 582

 Score = 29.3 bits (64), Expect = 0.25,   Method: Composition-based stats.
 Identities = 11/46 (23%), Positives = 25/46 (54%)

Query: 4   ASEKGEEKKQSNNQVEKLVEAPVEFVREGTQFLAKCKKPDLKEYTK 49
            S +G+E +    ++E+L  + +   +E  +F+  CK   +K+Y +
Sbjct: 395 GSTRGQEDRDYVKKLEQLAYSELAIPKESLEFITDCKYEKMKKYLQ 440

>KLLA0D02332g 198735..199220 no similarity, hypothetical start
          Length = 161

 Score = 26.9 bits (58), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 15/24 (62%)

Query: 24 APVEFVREGTQFLAKCKKPDLKEY 47
           PV+F   GTQFL + KKP   E+
Sbjct: 21 TPVKFRPTGTQFLNQYKKPSAAEH 44

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.314    0.132    0.358 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 1,915,169
Number of extensions: 50132
Number of successful extensions: 151
Number of sequences better than 10.0: 9
Number of HSP's gapped: 145
Number of HSP's successfully gapped: 9
Length of query: 80
Length of database: 16,596,109
Length adjustment: 52
Effective length of query: 28
Effective length of database: 14,795,973
Effective search space: 414287244
Effective search space used: 414287244
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 54 (25.4 bits)