Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YDR085C (AFR1)62060930780.0
Kwal_56.233806552262193e-18
AGR154C6282771337e-08
Scas_459.1*6481811311e-07
KLLA0C11891g6172511184e-06
CAGL0I08591g517781175e-06
YER158C573301167e-06
Scas_636.8d433263940.002
Kwal_33.15425322109674.5
YNL277W (MET2)48646658.3
Scas_686.372848659.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YDR085C
         (609 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YDR085C (AFR1) [937] chr4 complement(614282..616144) Protein inv...  1190   0.0  
Kwal_56.23380                                                          89   3e-18
AGR154C [4465] [Homologous to ScYER158C - SH; ScYDR085C (AFR1) -...    56   7e-08
Scas_459.1*                                                            55   1e-07
KLLA0C11891g complement(1021360..1023213) some similarities with...    50   4e-06
CAGL0I08591g complement(837496..839049) some similarities with s...    50   5e-06
YER158C (YER158C) [1587] chr5 complement(488852..490573) Protein...    49   7e-06
Scas_636.8d                                                            41   0.002
Kwal_33.15425                                                          30   4.5  
YNL277W (MET2) [4333] chr14 (117347..118807) Homoserine O-acetyl...    30   8.3  
Scas_686.3                                                             30   9.4  

>YDR085C (AFR1) [937] chr4 complement(614282..616144) Protein
           involved in morphogenesis of the mating projection
           (shmoo) [1863 bp, 620 aa]
          Length = 620

 Score = 1190 bits (3078), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 577/609 (94%), Positives = 577/609 (94%)

Query: 1   MEGSYLSAQENQPIPERLIPRSNSTSNLFALSSTFSKLNVRNDADYNYSNPNKKRHIYSG 60
           MEGSYLSAQENQPIPERLIPRSNSTSNLFALSSTFSKLNVRNDADYNYSNPNKKRHIYSG
Sbjct: 1   MEGSYLSAQENQPIPERLIPRSNSTSNLFALSSTFSKLNVRNDADYNYSNPNKKRHIYSG 60

Query: 61  EIDCRSVTAARKFPVRSCSMTAAQQRKRTALFTVRERNSYHEGFNNDQDYVSQYQKPQYT 120
           EIDCRSVTAARKFPVRSCSMTAAQQRKRTALFTVRERNSYHEGFNNDQDYVSQYQKPQYT
Sbjct: 61  EIDCRSVTAARKFPVRSCSMTAAQQRKRTALFTVRERNSYHEGFNNDQDYVSQYQKPQYT 120

Query: 121 FGVYKELTPYQLQRSKMKRSFQFPNGEIYKPKLDGKCTHSLKKPELNSRDSSLFKFSEKK 180
           FGVYKELTPYQLQRSKMKRSFQFPNGEIYKPKLDGKCTHSLKKPELNSRDSSLFKFSEKK
Sbjct: 121 FGVYKELTPYQLQRSKMKRSFQFPNGEIYKPKLDGKCTHSLKKPELNSRDSSLFKFSEKK 180

Query: 181 GRNLSKDFVGPHNGTSVIHIPPNDTGYGVNSLELNTXXXXXXXXXXXXXXXXXAVNTLTS 240
           GRNLSKDFVGPHNGTSVIHIPPNDTGYGVNSLELNT                 AVNTLTS
Sbjct: 181 GRNLSKDFVGPHNGTSVIHIPPNDTGYGVNSLELNTSVPSTIKSSVSSTSPISAVNTLTS 240

Query: 241 LPESQTDDDDGYENKTVTISYCFENTVNEKHGSHIEKLDLSTKEKTKPTTNSGLFDRKKK 300
           LPESQTDDDDGYENKTVTISYCFENTVNEKHGSHIEKLDLSTKEKTKPTTNSGLFDRKKK
Sbjct: 241 LPESQTDDDDGYENKTVTISYCFENTVNEKHGSHIEKLDLSTKEKTKPTTNSGLFDRKKK 300

Query: 301 TILGTEKYRCIXXXXXXXXXXXXXXXWRTSGNSNTKHGKKDTKRRRIPIDDMVTHSDGNS 360
           TILGTEKYRCI               WRTSGNSNTKHGKKDTKRRRIPIDDMVTHSDGNS
Sbjct: 301 TILGTEKYRCIKSQSKLKLGSVLKKLWRTSGNSNTKHGKKDTKRRRIPIDDMVTHSDGNS 360

Query: 361 EAENDIELMDANLDGIEFDDDETLMDTDSIFDDLLSKENDKYDLRRRQLEIRQKLHETSH 420
           EAENDIELMDANLDGIEFDDDETLMDTDSIFDDLLSKENDKYDLRRRQLEIRQKLHETSH
Sbjct: 361 EAENDIELMDANLDGIEFDDDETLMDTDSIFDDLLSKENDKYDLRRRQLEIRQKLHETSH 420

Query: 421 NDDGKVSFRDTEKHNVNEGLIDKTIIEEFSKLGEYIIDTRNQPPPRSSKRPSLDDNESAR 480
           NDDGKVSFRDTEKHNVNEGLIDKTIIEEFSKLGEYIIDTRNQPPPRSSKRPSLDDNESAR
Sbjct: 421 NDDGKVSFRDTEKHNVNEGLIDKTIIEEFSKLGEYIIDTRNQPPPRSSKRPSLDDNESAR 480

Query: 481 YFYNISTDLRQSLSGPISLPMHVGNDMVNRLRNDWEYIRFEDRRNSLPDSSFDKVETPPK 540
           YFYNISTDLRQSLSGPISLPMHVGNDMVNRLRNDWEYIRFEDRRNSLPDSSFDKVETPPK
Sbjct: 481 YFYNISTDLRQSLSGPISLPMHVGNDMVNRLRNDWEYIRFEDRRNSLPDSSFDKVETPPK 540

Query: 541 PIKKDVRFAKEVCLASTWSSNAYERANPEFIMNRHRLLWMMKVHPSMNSAMNEIKLELNS 600
           PIKKDVRFAKEVCLASTWSSNAYERANPEFIMNRHRLLWMMKVHPSMNSAMNEIKLELNS
Sbjct: 541 PIKKDVRFAKEVCLASTWSSNAYERANPEFIMNRHRLLWMMKVHPSMNSAMNEIKLELNS 600

Query: 601 YKKNEMVVH 609
           YKKNEMVVH
Sbjct: 601 YKKNEMVVH 609

>Kwal_56.23380
          Length = 655

 Score = 89.0 bits (219), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 65/226 (28%), Positives = 109/226 (48%), Gaps = 30/226 (13%)

Query: 390 IFDDLLSKENDKYDLRRRQLEIRQKLHETSHNDDGKVSFRDTEKHNVNEGLIDKTIIEEF 449
           +FD LL K ND   L+  +L + +K   T+ ++  +    D      +EG+ID+ +I EF
Sbjct: 443 VFDSLLLK-NDHATLKPLRLPLSEK-DSTAKDERPESQALDQHSGTTDEGVIDQDLIREF 500

Query: 450 SKLGEYIID------TRNQPPPRSSKRPSLDDNESARYFYNISTDLRQSLSGPISLPMHV 503
           S+LG +I D      T + PPPRS KRP L + ES   FY               L +  
Sbjct: 501 SRLGSFITDGITHQQTASVPPPRSQKRPRLSNKESVVGFYRHQASQNH-------LALDP 553

Query: 504 GNDMVNRLRNDWEYIRFEDRRNSLPDSSFDKVETPPKPIKKDVRFAKEVCLASTWSSNAY 563
              + + L+ DWE + ++    ++  +S D          K +RF+  V +  T+++  Y
Sbjct: 554 DERLAHSLQRDWESVYYD----AVVATSTDVTA------GKKLRFSTAVYVKDTYAAAEY 603

Query: 564 ERANPEFIMNRHRLLWMMKVHPSMNSAMNEIKLELNSYKKNEMVVH 609
           ER++ +FI  R R++    +     + +  +  +LN +KK EM VH
Sbjct: 604 ERSDKKFIRTRRRMMQTKNM-----AYIEAVTSQLNQFKKGEMKVH 644

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 32/65 (49%), Gaps = 7/65 (10%)

Query: 105 NNDQDYVSQYQKPQYTFGVYKELTPYQLQRSKMKRSFQFPNGEIYKPKLDGKC-----TH 159
           NN    + + Q  Q    +   LTPYQ QR +MK SFQFPNGE + P+          TH
Sbjct: 69  NNSLSLIPEQQ--QVPTHLLHSLTPYQKQRRRMKNSFQFPNGESFTPRQKSVAAFAGPTH 126

Query: 160 SLKKP 164
            L  P
Sbjct: 127 RLSGP 131

>AGR154C [4465] [Homologous to ScYER158C - SH; ScYDR085C (AFR1) -
           SH] (1038731..1040617) [1887 bp, 628 aa]
          Length = 628

 Score = 55.8 bits (133), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 70/277 (25%), Positives = 116/277 (41%), Gaps = 60/277 (21%)

Query: 383 TLMDTDSIFDDLLSKENDKYDLRRRQLEIRQKLHETSHNDDGKVSFRDTEKHNVNEGL-- 440
           +L D D +FD LL K +D++D  ++  +   K  E++      V   DT        L  
Sbjct: 351 SLFDIDLVFDTLLLK-SDRHDEPKKDCKGLAK-EESTKTKQCVVIKHDTPPAANRTSLTH 408

Query: 441 -IDKTIIEEFSKLGEYI-IDTRNQ----------------PPPRSSKRPSLDDNESARYF 482
            +D  +I EFSKLGEYI   T  Q                PPPRS++RP     + ++ F
Sbjct: 409 ELDYELIHEFSKLGEYIRTGTEGQELGATLLSLSSFSNLTPPPRSNRRPVFRQPDVSQSF 468

Query: 483 YN----ISTDLRQSLSGPISLPMHVGND-MVNRLRNDWEYIR------------------ 519
           Y+    +S D  + +     L      D +++ L+  W+ +                   
Sbjct: 469 YHSNMTLSPDFAKGIRANDKLSAFQYKDRILSNLQQHWKVVHVNETMPRQSSPSKSIISS 528

Query: 520 -----FEDRRNSLPDSSFDKVETPPKPIK--KDVRFAKEVCLASTWSSNAYERANPEFIM 572
                F +  +S   S  D      K +K  K + F+  + +  T+S   Y R++  F+ 
Sbjct: 529 QPSLEFANSSSSRSSSPLDSA----KSVKSTKRIEFSDVIYVNDTYSHWDYRRSDKRFLR 584

Query: 573 NRHRLLWMMKVHPSMNSAMNEIKLELNSYKKNEMVVH 609
            R +L+      P + +    +K ELN YK++EM+VH
Sbjct: 585 ERKQLMTSAHGLPFVQA----VKWELNEYKRHEMMVH 617

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 40/84 (47%), Gaps = 9/84 (10%)

Query: 128 TPYQLQRSKMKRSFQFPNGEIYKPKLD----GKCTHSL--KKPELNSRDSSLFKFSEKKG 181
           T YQ  R++MK+SFQFPNGE + P+      G+  HSL   +PE  +         +  G
Sbjct: 63  TAYQRLRTQMKQSFQFPNGESFTPRAQLRPGGERAHSLCGARPEAAAWPRRSASLQKPAG 122

Query: 182 RNLSKDFVGPHNGTSVIHIPPNDT 205
           R  +       +  S++  PP D 
Sbjct: 123 RGYAAKAA---SAESLVRRPPGDA 143

>Scas_459.1*
          Length = 648

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 51/181 (28%), Positives = 78/181 (43%), Gaps = 41/181 (22%)

Query: 463 PPPRSSKRPSLDDNESARYFYNISTDLRQSLSGP--------------ISLPMHVGNDMV 508
           PP RS  RP+L++NE+A+ FY+    L  SLS                +S  + +    +
Sbjct: 464 PPVRSPNRPALENNETAKLFYH---SLDGSLSSTTMTDTESSKPNNLEVSDTLMIPEKTL 520

Query: 509 NRLRNDWEYIRFEDRRNSLPDSSFDKVETPPKPIKKD-----------------VRFAKE 551
            RL  DWE +     +  +  S+     T    +                    +RFAKE
Sbjct: 521 KRLYQDWEKVTINKPKIKILTSTSVNSSTSSTSLPSSLNTGYSSATSSSTASKSLRFAKE 580

Query: 552 VCLASTWSSNAYERANPEFIMNRHRL---LWMMKVHPSMNSAMNEIKLELNSYKKNEMVV 608
           + ++ T+S   Y RA+P+    +      L  +K H      +NEIK E+N YK+NEM V
Sbjct: 581 ITISETYSPFEYLRADPDTSTTKSLYGDNLVYLKGH----GFINEIKFEINQYKRNEMSV 636

Query: 609 H 609
           H
Sbjct: 637 H 637

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 24/28 (85%)

Query: 125 KELTPYQLQRSKMKRSFQFPNGEIYKPK 152
           KELTPYQLQ+ +MK SFQFPNGE + P+
Sbjct: 257 KELTPYQLQKKQMKASFQFPNGESFTPR 284

>KLLA0C11891g complement(1021360..1023213) some similarities with
           sp|P40095 Saccharomyces cerevisiae YER158c singleton,
           hypothetical start
          Length = 617

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 62/251 (24%), Positives = 101/251 (40%), Gaps = 61/251 (24%)

Query: 360 SEAENDIELMDANL-DGIEFDDDETLMDTDSIFDDLLSKENDKYDLRRRQLEIRQKLHET 418
           SE+     L+D    D IE D  + LMD D +FD LL K                     
Sbjct: 416 SESAEPPSLLDLETEDDIEDDGFKDLMDIDLVFDSLLLK--------------------- 454

Query: 419 SHNDDGKVSFRDTEKHNVNEGLIDKTIIEEFSKLGEYIIDTRNQPPPRSSKRPSLDDNES 478
                       +E+H  N    D  +I +F++    I     +PP RSSKRP L  +  
Sbjct: 455 ------------SEQHQQNS---DIALINQFNE-STRISPPTVEPPLRSSKRPLLVKDYQ 498

Query: 479 ARYFYNISTDLRQSLSGPISLPMHVGNDMVNRLRNDWEYIRFEDRRNSLPDSSFDKVETP 538
            R  ++ +                  + ++  L  +W+ + F    N++  S     ++ 
Sbjct: 499 GRLIHHHNNGQTTH-----------SDRIIEHLHQNWKAVHF----NAVVPSVVRSNDSS 543

Query: 539 PKPIKKDVRFAKEVCLASTWSSNAYERANPEFIMNRHRLLWMMKVHPSMNSAMNEIKLEL 598
                K  RF +E+ +  T+S   Y R++  F  +R +L        S +  ++ IK+EL
Sbjct: 544 SPVSAKKCRFNEEIYVNDTFSPTEYLRSDKAFPESRKQL--------SKSRYIDGIKMEL 595

Query: 599 NSYKKNEMVVH 609
           N +KK EM+VH
Sbjct: 596 NEFKKREMLVH 606

 Score = 48.9 bits (115), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 24/30 (80%)

Query: 123 VYKELTPYQLQRSKMKRSFQFPNGEIYKPK 152
            +  LTPYQ+QRS MK+SFQFPNGE + P+
Sbjct: 74  AHHRLTPYQIQRSHMKQSFQFPNGESFTPR 103

>CAGL0I08591g complement(837496..839049) some similarities with
           sp|P40095 Saccharomyces cerevisiae YER158c, hypothetical
           start
          Length = 517

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 42/78 (53%), Gaps = 16/78 (20%)

Query: 542 IKKDVRFAKEVCLASTWSSNAYERANPEFIMNRHRLLWMMKVHPSMNSAMN--------- 592
           + K +RF+ EV L  TW+   YER+N  F+ N       ++V  S +S  +         
Sbjct: 435 MNKKLRFSNEVLLTDTWAPEVYERSNDSFLDN------FIEVGGSTSSGNDSSANTTTQK 488

Query: 593 -EIKLELNSYKKNEMVVH 609
            EIK E+N +KKNEMVVH
Sbjct: 489 PEIKQEINEFKKNEMVVH 506

 Score = 38.1 bits (87), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 21/26 (80%)

Query: 127 LTPYQLQRSKMKRSFQFPNGEIYKPK 152
           ++ YQLQ+ KMK SF+F NGE++ P+
Sbjct: 214 VSAYQLQKQKMKHSFKFENGEVFTPR 239

>YER158C (YER158C) [1587] chr5 complement(488852..490573) Protein of
           unknown function [1722 bp, 573 aa]
          Length = 573

 Score = 49.3 bits (116), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 20/30 (66%), Positives = 25/30 (83%)

Query: 123 VYKELTPYQLQRSKMKRSFQFPNGEIYKPK 152
           V KELTP+QLQR +MK +FQFPNGE + P+
Sbjct: 173 VRKELTPFQLQRKQMKSAFQFPNGENFTPR 202

 Score = 39.7 bits (91), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 40/76 (52%), Gaps = 10/76 (13%)

Query: 544 KDVRFAKEVCLASTWSSNAYERANPEFIMNRHRLLWMMKVHPS------MNSAMN----E 593
           K +RFA E+ +  TWS+  Y R +  F+ N  +       +PS      ++S  N    E
Sbjct: 487 KSLRFADEIYVNDTWSAADYCRCDNTFLNNFFKGKSQDITNPSTFVGNNLSSTKNISNIE 546

Query: 594 IKLELNSYKKNEMVVH 609
           IK+E+N +K+ EM VH
Sbjct: 547 IKMEVNEFKRKEMRVH 562

 Score = 33.1 bits (74), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 41/99 (41%), Gaps = 15/99 (15%)

Query: 425 KVSFRDTEKHNVNEGLI-DKTIIEEFSKLGEYIIDTRNQ----PPPRSSKRPSLDDNESA 479
           K SF     H      I D  I++E + LG+      N+    PPPRS  RP+L D  + 
Sbjct: 326 KQSFSTVNNHETAVPSIKDSGIVQELTALGD-----NNRIPVLPPPRSPNRPTLSDKRTT 380

Query: 480 RYFYNISTDLRQSLSGPISLPMHVGNDMVNRLRNDWEYI 518
           + +Y       Q  S     P       + RL+++W  +
Sbjct: 381 KLYY-----CSQDSSNEDIAPEEKSTVFLKRLQDEWSTV 414

>Scas_636.8d
          Length = 433

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 61/263 (23%), Positives = 107/263 (40%), Gaps = 43/263 (16%)

Query: 357 DGNSEAENDIELMDANLDG---IEFDDDETLMDTDSIFDDLLSKENDKYDLRRRQLEIRQ 413
           D N+E    I  +     G   +  D+D+  M+ D IFD++LS+ +          + R 
Sbjct: 193 DNNNEPLRKIRPLSIQFHGNIDVAIDEDDFSMNIDYIFDNILSRLDSNGSTEFETAKNR- 251

Query: 414 KLHETSHNDDGKVSFRDTEKHNVNEGL----IDKTIIEEFSKLGEYIIDT---RNQPPPR 466
              ET+ +++  ++     + +V E +    +D  +IEEF  L  Y+I +      PP  
Sbjct: 252 ---ETNESNEDYLNISQPSEESVPEEMNPDYVDTDLIEEFDDLA-YLITSPSILTPPPRS 307

Query: 467 SSKRPSLDDNESARYFYNISTDLRQSLSGPISLPMHVGNDMVNRLRNDWEYIRFEDRRNS 526
             +   +D   S RY                    H    ++ RL+ +WE +   +    
Sbjct: 308 ERRPRGMDKTISRRYH-------------------HHNRPLLVRLKEEWETVHIGES--- 345

Query: 527 LPDSSFDKVETPPKPIKKDVRFAKEVCLASTWSSNAYERANPEFIMNRHRLLWMMKVHPS 586
            PD+   K         K VRF  ++ +  TWS   YER       N   ++ +++    
Sbjct: 346 -PDTR--KTNKSDAATPKTVRFDTDIYVDDTWSPLEYERHGTTIARNMKEMVRLIQRD-- 400

Query: 587 MNSAMNEIKLELNSYKKNEMVVH 609
            +  ++ IK E+N +K  EM VH
Sbjct: 401 -HVFIDNIKREINYFKMYEMQVH 422

>Kwal_33.15425
          Length = 322

 Score = 30.4 bits (67), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 28/109 (25%), Positives = 47/109 (43%), Gaps = 13/109 (11%)

Query: 485 ISTDLRQSLSGPISLPMHVGNDMVNRLR----NDWEYIRFEDRRNSLPDSSFDKVETPPK 540
           +S     +  GP     +   D+VN  R        ++ F++R      S FD+VETP  
Sbjct: 41  VSPHAGYAYCGPTMGKAYAALDLVNVKRIFVLGPSHHVYFKNRAYV---SRFDEVETPLG 97

Query: 541 PIKKDVRFAKEVCLASTWSSNAYERANPEFIMNRHRL-LWMMKVHPSMN 588
           PI  D + A E+         A+E  +P+   + H L +    +H ++N
Sbjct: 98  PIPVDSKTAAELV-----KDEAFEYMDPDIDADEHSLEMQFPMLHATLN 141

>YNL277W (MET2) [4333] chr14 (117347..118807) Homoserine
           O-acetyltransferase, catalyzes the conversion of
           homoserine + acetyl-CoA to O-acetylhomoserine + CoA
           [1461 bp, 486 aa]
          Length = 486

 Score = 29.6 bits (65), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 22/46 (47%)

Query: 73  FPVRSCSMTAAQQRKRTALFTVRERNSYHEGFNNDQDYVSQYQKPQ 118
           +PV    +      + +AL T R RNS+   F+     ++Q QK Q
Sbjct: 218 YPVEEQPVAGLSAARMSALLTYRTRNSFENKFSRRSPSIAQQQKAQ 263

>Scas_686.3
          Length = 728

 Score = 29.6 bits (65), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 26/48 (54%), Gaps = 7/48 (14%)

Query: 512 RNDWEYIRFEDRRNSLPDSSFDK--VETP----PKPIKKDVRFAKEVC 553
           R+ WEYI  E + N  P S+F K  ++ P    P P  ++ R A+E C
Sbjct: 29  RHTWEYINSEQKTND-PQSTFTKWLLQLPDFPAPTPTTEEPRTAREAC 75

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.313    0.130    0.376 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 21,936,994
Number of extensions: 1047714
Number of successful extensions: 3292
Number of sequences better than 10.0: 82
Number of HSP's gapped: 3376
Number of HSP's successfully gapped: 89
Length of query: 609
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 502
Effective length of database: 12,891,983
Effective search space: 6471775466
Effective search space used: 6471775466
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 65 (29.6 bits)