Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YDR084C19919710431e-147
CAGL0K09988g1961977025e-95
Scas_636.82011996931e-93
Kwal_56.233791951976922e-93
Sklu_501.11951985896e-78
AGR153C2012015784e-76
KLLA0C11869g1951985541e-72
YDR452W (PPN1)67422599.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YDR084C
         (197 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YDR084C (YDR084C) [936] chr4 complement(613399..613998) Protein ...   406   e-147
CAGL0K09988g 977017..977607 similar to sp|P38962 Saccharomyces c...   275   5e-95
Scas_636.8                                                            271   1e-93
Kwal_56.23379                                                         271   2e-93
Sklu_501.1 YDR084C, Contig c501 280-867                               231   6e-78
AGR153C [4464] [Homologous to ScYDR084C - SH] (1037657..1038262)...   227   4e-76
KLLA0C11869g complement(1020415..1021002) similar to sp|P38962 S...   218   1e-72
YDR452W (PPN1) [1271] chr4 (1362866..1364890) Vacuolar endopolyp...    27   9.8  

>YDR084C (YDR084C) [936] chr4 complement(613399..613998) Protein of
           unknown function, has moderate similarity to
           uncharacterized S. pombe Spbc2a9.05cp [600 bp, 199 aa]
          Length = 199

 Score =  406 bits (1043), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 197/197 (100%), Positives = 197/197 (100%)

Query: 1   MDQARNFYNTILKSSHPLLLSFHLAGKAVPIVFYIIGSMFLNFTPQFITVVLLLSFDFYL 60
           MDQARNFYNTILKSSHPLLLSFHLAGKAVPIVFYIIGSMFLNFTPQFITVVLLLSFDFYL
Sbjct: 1   MDQARNFYNTILKSSHPLLLSFHLAGKAVPIVFYIIGSMFLNFTPQFITVVLLLSFDFYL 60

Query: 61  TKNITGRKLVQLRWWYDSTDVNKDSNFTFESYKQYAPGPPINAIDSKLFWWSMYVTPVIW 120
           TKNITGRKLVQLRWWYDSTDVNKDSNFTFESYKQYAPGPPINAIDSKLFWWSMYVTPVIW
Sbjct: 61  TKNITGRKLVQLRWWYDSTDVNKDSNFTFESYKQYAPGPPINAIDSKLFWWSMYVTPVIW 120

Query: 121 GVFAVLCLLRLKIFYLILVIVAMCLTAWNTYGFRCCDRWEPNSGQSDGQDTNNWFALPSV 180
           GVFAVLCLLRLKIFYLILVIVAMCLTAWNTYGFRCCDRWEPNSGQSDGQDTNNWFALPSV
Sbjct: 121 GVFAVLCLLRLKIFYLILVIVAMCLTAWNTYGFRCCDRWEPNSGQSDGQDTNNWFALPSV 180

Query: 181 PGFENLSRLANIQSFFQ 197
           PGFENLSRLANIQSFFQ
Sbjct: 181 PGFENLSRLANIQSFFQ 197

>CAGL0K09988g 977017..977607 similar to sp|P38962 Saccharomyces
           cerevisiae YDR084c, start by similarity
          Length = 196

 Score =  275 bits (702), Expect = 5e-95,   Method: Compositional matrix adjust.
 Identities = 128/197 (64%), Positives = 156/197 (79%), Gaps = 5/197 (2%)

Query: 1   MDQARNFYNTILKSSHPLLLSFHLAGKAVPIVFYIIGSMFLNFTPQFITVVLLLSFDFYL 60
           MD  RNFY+TIL+SSHPLL++FHLAGKA P+ FYI G +F +FT  FIT+VLLL+ DFY 
Sbjct: 1   MDHVRNFYDTILRSSHPLLMAFHLAGKAAPLAFYIAGFLFPSFTALFITIVLLLAADFYF 60

Query: 61  TKNITGRKLVQLRWWYDSTDVNKDSNFTFESYKQYAPGPPINAIDSKLFWWSMYVTPVIW 120
           TKNI+GR+LVQLRWWYDS+  + ++ FTFES+KQY  GPPIN IDSKLFWWSMY+TP IW
Sbjct: 61  TKNISGRRLVQLRWWYDSSATSTET-FTFESHKQYTAGPPINPIDSKLFWWSMYLTPAIW 119

Query: 121 GVFAVLCLLRLKIFYLILVIVAMCLTAWNTYGFRCCDRWEPNSGQSDGQDTNNWFALPSV 180
            V  +L +LRLK+   IL+ VA C+T WNTYGFRCCDRW PN+ QS    T  +F LPS+
Sbjct: 120 FVLGILAILRLKLITFILIAVATCMTGWNTYGFRCCDRWNPNNSQS----TEPFFQLPSI 175

Query: 181 PGFENLSRLANIQSFFQ 197
           PG +N++RLA  QSFFQ
Sbjct: 176 PGLDNITRLARFQSFFQ 192

>Scas_636.8
          Length = 201

 Score =  271 bits (693), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 140/199 (70%), Positives = 164/199 (82%), Gaps = 4/199 (2%)

Query: 1   MDQARNFYNTILKSSHPLLLSFHLAGKAVPIVFYIIGSMFLNFTPQFITVVLLLSFDFYL 60
           M+   NFYNTILKSSHP+LL  HLAGKA PIVFYIIGS+FL FT QFI VVLLL+FDFYL
Sbjct: 1   MEHLSNFYNTILKSSHPILLGLHLAGKAAPIVFYIIGSLFLGFTAQFICVVLLLAFDFYL 60

Query: 61  TKNITGRKLVQLRWWYDSTDVNKDSNFTFESYKQYAP--GPPINAIDSKLFWWSMYVTPV 118
           TKNI+GRKLVQLRWWYDST  N ++ F FESYKQY P  GPPIN IDS+LFWWSMY TP+
Sbjct: 61  TKNISGRKLVQLRWWYDSTTENTET-FRFESYKQYPPSLGPPINPIDSRLFWWSMYATPI 119

Query: 119 IWGVFAVLCLLRLKIFYLILVIVAMCLTAWNTYGFRCCDRWEPNSGQSDGQDTNNWFALP 178
           +W VF +LC+LRLK+FYL+LV+VA+ LT WNTYGFRCCD+W+P +  +D   T +WF LP
Sbjct: 120 VWAVFGILCILRLKLFYLVLVVVAVFLTGWNTYGFRCCDKWDPIAKNAD-NSTESWFQLP 178

Query: 179 SVPGFENLSRLANIQSFFQ 197
           S+PG +NL R+A  QSFFQ
Sbjct: 179 SIPGLDNLQRMARFQSFFQ 197

>Kwal_56.23379
          Length = 195

 Score =  271 bits (692), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 126/197 (63%), Positives = 156/197 (79%), Gaps = 4/197 (2%)

Query: 1   MDQARNFYNTILKSSHPLLLSFHLAGKAVPIVFYIIGSMFLNFTPQFITVVLLLSFDFYL 60
           MD A+NFY TILKSSHPL+LS H+AGKA P+V Y+IGS FL+FT  FITV+LLL+ DFYL
Sbjct: 1   MDHAKNFYQTILKSSHPLVLSLHIAGKAGPLVIYLIGSWFLSFTAHFITVLLLLAVDFYL 60

Query: 61  TKNITGRKLVQLRWWYDSTDVNKDSNFTFESYKQYAPGPPINAIDSKLFWWSMYVTPVIW 120
           TKNI GRKLVQLRWWYDS+  +KDS  TFESYK+YAPGPPIN +DSKLFWWS+YV+P +W
Sbjct: 61  TKNINGRKLVQLRWWYDSSS-SKDSPLTFESYKEYAPGPPINPVDSKLFWWSLYVSPALW 119

Query: 121 GVFAVLCLLRLKIFYLILVIVAMCLTAWNTYGFRCCDRWEPNSGQSDGQDTNNWFALPSV 180
            +F +LCL + K  YLIL+ +A+CLT WN +GFR CD+W+P +  S    T  WF LP++
Sbjct: 120 VIFGLLCLFQAKFLYLILIGMAVCLTGWNLHGFRSCDKWDPAANSS---KTETWFQLPNI 176

Query: 181 PGFENLSRLANIQSFFQ 197
             FENL R A +Q+FF+
Sbjct: 177 ATFENLGRFATVQNFFR 193

>Sklu_501.1 YDR084C, Contig c501 280-867
          Length = 195

 Score =  231 bits (589), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 121/198 (61%), Positives = 150/198 (75%), Gaps = 6/198 (3%)

Query: 1   MDQARNFYNTILKSSHPLLLSFHLAGKAVPIVFYIIGSMFLN-FTPQFITVVLLLSFDFY 59
           MDQ +NFY TILKSSHPL+LS HL GKA PI+ Y++GS F++ F   FI V+LLL+ DFY
Sbjct: 1   MDQIKNFYETILKSSHPLILSLHLLGKAAPILSYLLGSWFIHSFAALFILVILLLAADFY 60

Query: 60  LTKNITGRKLVQLRWWYDSTDVNKDSNFTFESYKQYAPGPPINAIDSKLFWWSMYVTPVI 119
           LTKNI+GRKLVQLRWWYDS    K + FTFESYKQY  G PIN IDSKLFWWS+Y+TPV+
Sbjct: 61  LTKNISGRKLVQLRWWYDSMGQAK-TPFTFESYKQYPAGNPINPIDSKLFWWSIYLTPVV 119

Query: 120 WGVFAVLCLLRLKIFYLILVIVAMCLTAWNTYGFRCCDRWEPNSGQSDGQDTNNWFALPS 179
           W +F +LC+L+ +  YL+LV++A+ L  WN +GFR CD+WEP  GQ  G   N+W  LP+
Sbjct: 120 WAIFGILCILKFQFLYLLLVVLALGLNGWNAHGFRSCDKWEP--GQDSG--NNSWIXLPN 175

Query: 180 VPGFENLSRLANIQSFFQ 197
           +   ENLSR+A   SFFQ
Sbjct: 176 LSSLENLSRIARFXSFFQ 193

>AGR153C [4464] [Homologous to ScYDR084C - SH] (1037657..1038262)
           [606 bp, 201 aa]
          Length = 201

 Score =  227 bits (578), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 110/201 (54%), Positives = 144/201 (71%), Gaps = 6/201 (2%)

Query: 1   MDQARNFYNTILKSSHPLLLSFHLAGKAVPIVFYIIGSMFLNFTPQFITV-VLLLSFDFY 59
           MD  RNFY+TI+KSSHPL+LS HLAGKA+P+ FY++G  F+++T  F+ + +LLL+ DFY
Sbjct: 1   MDSVRNFYDTIIKSSHPLVLSLHLAGKAIPVAFYLLGGWFVSYTSHFLIITILLLAVDFY 60

Query: 60  LTKNITGRKLVQLRWWYDSTDVNKD-SNFTFESYKQYA--PGPPINAIDSKLFWWSMYVT 116
           LTKNI+GRKLV LRWW+++T  N+D S F FESYKQY    GP +N IDSKLFW S Y  
Sbjct: 61  LTKNISGRKLVHLRWWHNATGTNEDGSPFVFESYKQYPDYSGPAVNPIDSKLFWISTYAA 120

Query: 117 PVIWGVFAVLCLLRLKIFYLILVIVAMCLTAWNTYGFRCCDRWEPNSGQSDGQDTNNWFA 176
           P +W +F VLC+LRL+   L LV+ A  LT +N YGFR CDRWEPN   S  + ++ W  
Sbjct: 121 PALWALFGVLCVLRLQFISLFLVLFAAGLTGYNAYGFRSCDRWEPNKKSS--ETSSIWPQ 178

Query: 177 LPSVPGFENLSRLANIQSFFQ 197
           +P+    EN+ RL   Q+FF+
Sbjct: 179 MPTFTNVENIQRLFTFQTFFR 199

>KLLA0C11869g complement(1020415..1021002) similar to sp|P38962
           Saccharomyces cerevisiae YDR084c singleton, start by
           similarity
          Length = 195

 Score =  218 bits (554), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 111/198 (56%), Positives = 132/198 (66%), Gaps = 8/198 (4%)

Query: 1   MDQARNFYNTILKSSHPLLLSFHLAGKAVPIVFYIIGSMFLNFTPQFITVVLLLSFDFYL 60
           MD ARNFY TIL SSHPL+L+ HL GKAVPIVFY++GS FL+ T QFI V+L L+ DFY 
Sbjct: 1   MDSARNFYKTILASSHPLILTIHLLGKAVPIVFYLLGSWFLSSTVQFIIVILTLAADFYF 60

Query: 61  TKNITGRKLVQLRWWYDSTDVNKDSNFTFESYKQY--APGPPINAIDSKLFWWSMYVTPV 118
           TKNI GRKL+Q RWWYD +     + F FES+K+Y      PIN IDSKLFW S+YV P 
Sbjct: 61  TKNINGRKLIQQRWWYDVSG-EDTTTFRFESFKEYPDVAAAPINPIDSKLFWLSLYVAPT 119

Query: 119 IWGVFAVLCLLRLKIFYLILVIVAMCLTAWNTYGFRCCDRWEPNSGQSDGQDTNNWFALP 178
           IW VF  LCL++ +  YLILVI A  L  WN Y +R CD+WEP             F LP
Sbjct: 120 IWVVFGFLCLIKFQFVYLILVIFAGGLNLWNAYAYRLCDQWEPGHTAEAPL-----FQLP 174

Query: 179 SVPGFENLSRLANIQSFF 196
            +P F NL R+  +QSFF
Sbjct: 175 MLPSFANLDRVTRLQSFF 192

>YDR452W (PPN1) [1271] chr4 (1362866..1364890) Vacuolar
           endopolyphosphatase, has similarity to human
           sphingomyelin phosphodiesterase [2025 bp, 674 aa]
          Length = 674

 Score = 27.3 bits (59), Expect = 9.8,   Method: Composition-based stats.
 Identities = 10/22 (45%), Positives = 13/22 (59%)

Query: 74  WWYDSTDVNKDSNFTFESYKQY 95
           W Y+ TD+  DSNF    YK +
Sbjct: 502 WEYNITDIVNDSNFAVSEYKPW 523

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.328    0.141    0.471 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 6,890,001
Number of extensions: 293572
Number of successful extensions: 864
Number of sequences better than 10.0: 14
Number of HSP's gapped: 846
Number of HSP's successfully gapped: 14
Length of query: 197
Length of database: 16,596,109
Length adjustment: 96
Effective length of query: 101
Effective length of database: 13,272,781
Effective search space: 1340550881
Effective search space used: 1340550881
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 59 (27.3 bits)