Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YDR046C (BAP3)60459429290.0
Scas_569.559355322010.0
YBR068C (BAP2)60957521830.0
Scas_718.4259558620980.0
CAGL0L07546g63461620100.0
CAGL0H08393g61255019770.0
AGR038C58056817680.0
Kwal_27.1053860256617150.0
CAGL0K05753g66061315810.0
CAGL0B01012g62360715760.0
YDR508C (GNP1)66359415500.0
AGR039C58654414790.0
Kwal_33.1320460755614440.0
Kwal_33.1321559857914290.0
AGR040C57357214220.0
YCL025C (AGP1)59553814040.0
KLLA0C01606g62055313970.0
Scas_517.267958313690.0
AFR698C60954313301e-178
YBR069C (TAT1)61954113221e-176
Scas_718.4161457412211e-161
Sklu_2029.259851911331e-148
ADL272W56452611061e-144
Sklu_2390.160552111001e-143
YKR039W (GAP1)60253810951e-142
KLLA0A06886g58753810731e-139
Kwal_27.1268159353910701e-139
CAGL0L03267g59754110681e-138
YGR191W (HIP1)60352010551e-136
CAGL0B03773g60551410501e-136
Kwal_33.1540758756210411e-134
KLLA0F01012g55650710181e-131
AGR319W62655810221e-131
Scas_479.159555210181e-131
KLLA0A11770g58153210081e-130
Scas_607.459951710101e-130
Kwal_33.1427659654310021e-128
Scas_507.15924999991e-128
AFR230C6045519891e-126
KLLA0A06930g5875489791e-125
AEL030W7395909641e-121
YOL020W (TAT2)5925549521e-121
CAGL0D02178g5775799501e-121
KLLA0A10813g5845648791e-110
Kwal_34.162544814668291e-104
Kwal_56.229515965878043e-99
KLLA0B06776g5885787931e-97
Scas_536.13723617497e-94
YLL061W (MMP1)5835577623e-93
YPL274W (SAM3)5875617293e-88
KLLA0C02365g5795287013e-84
CAGL0J08162g5975096971e-83
YNL268W (LYP1)6115416939e-83
Scas_706.36d6075386814e-81
CAGL0J08184g5725336794e-81
YEL063C (CAN1)5905846701e-79
Kwal_33.134115605686662e-79
Scas_706.375445396617e-79
Kwal_33.134015595476602e-78
AER405C4975026525e-78
Scas_520.2*3723586382e-77
KLLA0C02343g5815616446e-76
AFR667C5635446411e-75
KLLA0E16335g6055176264e-73
YPL265W (DIP5)6085246222e-72
YNL270C (ALP1)5735686141e-71
CAGL0A01199g6135466134e-71
AFR668W5564916016e-70
Scas_377.24904945783e-67
Scas_84.12132115361e-64
KLLA0F27093g5635565632e-64
Kwal_33.155455765655606e-64
Kwal_26.69405705515599e-64
Kwal_26.96125435555533e-63
Scas_486.25975605531e-62
KLLA0B14685g5715935432e-61
YOR348C (PUT4)6275865462e-61
Kwal_23.28175805915414e-61
Sklu_2438.145585055361e-60
CAGL0E05632g5985395354e-60
CAGL0M00154g5505365245e-59
YFL055W (AGP3)5585105212e-58
ACL135W5885805213e-58
KLLA0F23419g5735415186e-58
Scas_552.35585345168e-58
AFR156W5585335099e-57
Kwal_8.5906295144892e-53
Kwal_26.80975445464465e-48
Scas_377.11481374016e-46
Kwal_23.40265344704104e-43
Sklu_2365.98055874122e-42
YBR132C (AGP2)5966024037e-42
Scas_460.35845584011e-41
KLLA0C15873g5684893569e-36
CAGL0C00539g5725653569e-36
AAR038W5664963542e-35
KLLA0B09922g7975783556e-35
KLLA0D16830g8326073521e-34
Kwal_23.38475794533331e-32
Scas_682.308456373324e-32
Kwal_27.119007265133289e-32
CAGL0E01089g8536273219e-31
Kwal_53.194615655743091e-29
YDR160W (SSY1)8526513103e-29
Scas_619.2*4714553034e-29
AGL171W8516593004e-28
Scas_485.4*2371912665e-26
Scas_476.42371912657e-26
Scas_642.222371912577e-25
YGL077C (HNM1)563117900.008
Sklu_2147.4568119900.009
Sklu_2305.6541115890.010
Scas_233.114184830.016
Scas_689.1961286880.016
KLLA0A06666g56086810.088
Scas_720.18569109760.36
YKL174C618117730.83
CAGL0D00924g198067731.1
CAGL0H03399g55684721.3
CAGL0M08272g621121721.4
AFL081W542109711.6
YJL122W17559672.3
Kwal_26.686140136665.1
Kwal_26.70701315100667.4
Scas_492.329351649.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YDR046C
         (594 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YDR046C (BAP3) [899] chr4 complement(548758..550572) Branched ch...  1132   0.0  
Scas_569.5                                                            852   0.0  
YBR068C (BAP2) [258] chr2 complement(373821..375650) Branched-ch...   845   0.0  
Scas_718.42                                                           812   0.0  
CAGL0L07546g complement(831824..833728) highly similar to sp|P38...   778   0.0  
CAGL0H08393g 821998..823836 highly similar to sp|P41815 Saccharo...   766   0.0  
AGR038C [4348] [Homologous to ScYDR046C (BAP3) - SH; ScYBR068C (...   685   0.0  
Kwal_27.10538                                                         665   0.0  
CAGL0K05753g 564282..566264 highly similar to sp|P48813 Saccharo...   613   0.0  
CAGL0B01012g 91330..93201 similar to sp|P25376 Saccharomyces cer...   611   0.0  
YDR508C (GNP1) [1322] chr4 complement(1466441..1468432) High aff...   601   0.0  
AGR039C [4349] [Homologous to ScYDR046C (BAP3) - SH; ScYBR068C (...   574   0.0  
Kwal_33.13204                                                         560   0.0  
Kwal_33.13215                                                         555   0.0  
AGR040C [4350] [Homologous to ScYBR069C (TAT1) - SH] (782289..78...   552   0.0  
YCL025C (AGP1) [519] chr3 complement(76131..77918) Broad substra...   545   0.0  
KLLA0C01606g complement(123485..125347) similar to sp|P48813 Sac...   542   0.0  
Scas_517.2                                                            531   0.0  
AFR698C [3891] [Homologous to ScYDR508C (GNP1) - SH; ScYCL025C (...   516   e-178
YBR069C (TAT1) [259] chr2 complement(376534..378393) Amino acid ...   513   e-176
Scas_718.41                                                           474   e-161
Sklu_2029.2 , Contig c2029 2095-3891                                  441   e-148
ADL272W [1469] [Homologous to ScYDR508C (GNP1) - NSH] complement...   430   e-144
Sklu_2390.1 YGR191W, Contig c2390 5453-7270 reverse complement        428   e-143
YKR039W (GAP1) [3292] chr11 (514705..516513) General amino acid ...   426   e-142
KLLA0A06886g complement(621646..623409) similar to sp|P19145 Sac...   417   e-139
Kwal_27.12681                                                         416   e-139
CAGL0L03267g 372787..374580 highly similar to sp|P19145 Saccharo...   416   e-138
YGR191W (HIP1) [2141] chr7 (880423..882234) Histidine permease, ...   410   e-136
CAGL0B03773g 373956..375773 highly similar to sp|P06775 Saccharo...   409   e-136
Kwal_33.15407                                                         405   e-134
KLLA0F01012g complement(90772..92442) similar to sp|P48813 Sacch...   396   e-131
AGR319W [4630] [Homologous to ScYGR191W (HIP1) - SH] complement(...   398   e-131
Scas_479.1                                                            396   e-131
KLLA0A11770g 1014918..1016663 similar to sp|P06775 Saccharomyces...   392   e-130
Scas_607.4                                                            393   e-130
Kwal_33.14276                                                         390   e-128
Scas_507.1                                                            389   e-128
AFR230C [3422] [Homologous to ScYKR039W (GAP1) - NSH] (855416..8...   385   e-126
KLLA0A06930g complement(625498..627261) similar to sp|P19145 Sac...   381   e-125
AEL030W [2476] [Homologous to ScYOL020W (TAT2) - SH] complement(...   375   e-121
YOL020W (TAT2) [4796] chr15 (286172..287950) High affinity trypt...   371   e-121
CAGL0D02178g 222597..224330 highly similar to sp|P38967 Saccharo...   370   e-121
KLLA0A10813g complement(936126..937880) similar to sp|P38967 Sac...   343   e-110
Kwal_34.16254                                                         323   e-104
Kwal_56.22951                                                         314   3e-99
KLLA0B06776g 594172..595938 similar to sgd|S0006195 Saccharomyce...   310   1e-97
Scas_536.1                                                            293   7e-94
YLL061W (MMP1) [3363] chr12 (17956..19707) High affinity S-methy...   298   3e-93
YPL274W (SAM3) [5177] chr16 (22938..24701) High affinity S-adeno...   285   3e-88
KLLA0C02365g 208462..210201 similar to sp|P32487 Saccharomyces c...   274   3e-84
CAGL0J08162g complement(801555..803348) Highly similar to sp|P32...   273   1e-83
YNL268W (LYP1) [4340] chr14 (138549..140384) High affinity lysin...   271   9e-83
Scas_706.36d                                                          266   4e-81
CAGL0J08184g 804507..806225 similar to sp|P04817 Saccharomyces c...   266   4e-81
YEL063C (CAN1) [1365] chr5 complement(31694..33466) Permease for...   262   1e-79
Kwal_33.13411                                                         261   2e-79
Scas_706.37                                                           259   7e-79
Kwal_33.13401                                                         258   2e-78
AER405C [2905] [Homologous to ScYPL274W (SAM3) - NSH] (1413790.....   255   5e-78
Scas_520.2*                                                           250   2e-77
KLLA0C02343g complement(203552..205297) similar to sp|P04817 Sac...   252   6e-76
AFR667C [3860] [Homologous to ScYNL268W (LYP1) - SH] (1657064..1...   251   1e-75
KLLA0E16335g 1455271..1457088 gi|28565044|gb|AAO32605.1 Kluyvero...   245   4e-73
YPL265W (DIP5) [5186] chr16 (41043..42869) Dicarboxylic amino ac...   244   2e-72
YNL270C (ALP1) [4339] chr14 complement(135939..137660) Arginine ...   241   1e-71
CAGL0A01199g 121067..122908 similar to sp|P53388 Saccharomyces c...   240   4e-71
AFR668W [3861] [Homologous to ScYEL063C (CAN1) - SH; ScYNL270C (...   236   6e-70
Scas_377.2                                                            227   3e-67
Scas_84.1                                                             211   1e-64
KLLA0F27093g 2501049..2502740 similar to sp|P43548 Saccharomyces...   221   2e-64
Kwal_33.15545                                                         220   6e-64
Kwal_26.6940                                                          219   9e-64
Kwal_26.9612                                                          217   3e-63
Scas_486.2                                                            217   1e-62
KLLA0B14685g complement(1289025..1290740) similar to sp|P15380 S...   213   2e-61
YOR348C (PUT4) [5125] chr15 complement(986894..988777) High affi...   214   2e-61
Kwal_23.2817                                                          213   4e-61
Sklu_2438.14 YOR348C, Contig c2438 29357-31033                        211   1e-60
CAGL0E05632g complement(556619..558415) similar to sp|P15380 Sac...   210   4e-60
CAGL0M00154g 22039..23691 similar to sp|P32487 Saccharomyces cer...   206   5e-59
YFL055W (AGP3) [1629] chr6 (17004..18680) Amino acid permease fo...   205   2e-58
ACL135W [914] [Homologous to ScYPL265W (DIP5) - NSH] complement(...   205   3e-58
KLLA0F23419g complement(2187386..2189107) similar to sp|P15380 S...   204   6e-58
Scas_552.3                                                            203   8e-58
AFR156W [3348] [Homologous to ScYOR348C (PUT4) - NSH] complement...   200   9e-57
Kwal_8.590                                                            192   2e-53
Kwal_26.8097                                                          176   5e-48
Scas_377.1                                                            159   6e-46
Kwal_23.4026                                                          162   4e-43
Sklu_2365.9 YDR160W, Contig c2365 13522-15939                         163   2e-42
YBR132C (AGP2) [319] chr2 complement(499608..501398) Plasma memb...   159   7e-42
Scas_460.3                                                            159   1e-41
KLLA0C15873g 1381699..1383405 similar to sp|P38090 Saccharomyces...   141   9e-36
CAGL0C00539g 57784..59502 highly similar to sp|P38090 Saccharomy...   141   9e-36
AAR038W [224] [Homologous to ScYBR132C (AGP2) - SH] complement(4...   140   2e-35
KLLA0B09922g complement(867748..870141) weakly similar to sp|Q03...   141   6e-35
KLLA0D16830g 1426856..1429354 similar to sp|Q03770 Saccharomyces...   140   1e-34
Kwal_23.3847                                                          132   1e-32
Scas_682.30                                                           132   4e-32
Kwal_27.11900                                                         130   9e-32
CAGL0E01089g complement(96582..99143) similar to sp|Q03770 Sacch...   128   9e-31
Kwal_53.19461                                                         123   1e-29
YDR160W (SSY1) [1002] chr4 (776157..778715) Component of an extr...   124   3e-29
Scas_619.2*                                                           121   4e-29
AGL171W [4141] [Homologous to ScYDR160W (SSY1) - SH] complement(...   120   4e-28
Scas_485.4*                                                           107   5e-26
Scas_476.4                                                            106   7e-26
Scas_642.22                                                           103   7e-25
YGL077C (HNM1) [1905] chr7 complement(362226..363917) Choline pe...    39   0.008
Sklu_2147.4 YKL174C, Contig c2147 6541-8247 reverse complement         39   0.009
Sklu_2305.6 YGL077C, Contig c2305 10656-12281                          39   0.010
Scas_233.1                                                             37   0.016
Scas_689.19                                                            39   0.016
KLLA0A06666g complement(603169..604851) similar to sp|P36029 Sac...    36   0.088
Scas_720.18                                                            34   0.36 
YKL174C (YKL174C) [3097] chr11 complement(120385..122241) Member...    33   0.83 
CAGL0D00924g 108341..114283 similar to sp|P25386 Saccharomyces c...    33   1.1  
CAGL0H03399g complement(316110..317780) highly similar to sp|P19...    32   1.3  
CAGL0M08272g complement(823019..824884) highly similar to sp|P36...    32   1.4  
AFL081W [3112] [Homologous to ScYGL077C (HNM1) - SH] complement(...    32   1.6  
YJL122W (YJL122W) [2797] chr10 (189636..190163) Protein of unkno...    30   2.3  
Kwal_26.6861                                                           30   5.1  
Kwal_26.7070                                                           30   7.4  
Scas_492.3                                                             29   9.4  

>YDR046C (BAP3) [899] chr4 complement(548758..550572) Branched chain
           amino acid permease, also transports threonine, alanine
           and aromatic and sulfur containing amino acids [1815 bp,
           604 aa]
          Length = 604

 Score = 1132 bits (2929), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 553/594 (93%), Positives = 553/594 (93%)

Query: 1   MSDPIVTSSKMEKSAEFEVTDSALYNNFNTSTTASLTPEIKEHSEESRNGLVHRFVDSFR 60
           MSDPIVTSSKMEKSAEFEVTDSALYNNFNTSTTASLTPEIKEHSEESRNGLVHRFVDSFR
Sbjct: 1   MSDPIVTSSKMEKSAEFEVTDSALYNNFNTSTTASLTPEIKEHSEESRNGLVHRFVDSFR 60

Query: 61  RAESQRLEEDNDLEDGTKSMKSNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLSLAG 120
           RAESQRLEEDNDLEDGTKSMKSNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLSLAG
Sbjct: 61  RAESQRLEEDNDLEDGTKSMKSNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLSLAG 120

Query: 121 PGSLVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFISKSFGFATTWLFCIQW 180
           PGSLVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFISKSFGFATTWLFCIQW
Sbjct: 121 PGSLVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFISKSFGFATTWLFCIQW 180

Query: 181 LTVLPLELITSSMTVKYWNDTINADXXXXXXXXXXXXXXXXGVKAYGETEFIFNSCKILM 240
           LTVLPLELITSSMTVKYWNDTINAD                GVKAYGETEFIFNSCKILM
Sbjct: 181 LTVLPLELITSSMTVKYWNDTINADVFIVIFYVFLLFIHFFGVKAYGETEFIFNSCKILM 240

Query: 241 VAGFIILSVVINCGGAGVDGYIGGKYWRDPGSFAEGSGATRFKGICYILVSAYFSFGGIE 300
           VAGFIILSVVINCGGAGVDGYIGGKYWRDPGSFAEGSGATRFKGICYILVSAYFSFGGIE
Sbjct: 241 VAGFIILSVVINCGGAGVDGYIGGKYWRDPGSFAEGSGATRFKGICYILVSAYFSFGGIE 300

Query: 301 LFVLSINEQSNPRKSTPVAAKRSVYRXXXXXXXXXXXXGFNVPHNNDQLMGSGGSATHAS 360
           LFVLSINEQSNPRKSTPVAAKRSVYR            GFNVPHNNDQLMGSGGSATHAS
Sbjct: 301 LFVLSINEQSNPRKSTPVAAKRSVYRILIIYLLTMILIGFNVPHNNDQLMGSGGSATHAS 360

Query: 361 PYVLAASIHKVRVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPKFLNYIDRE 420
           PYVLAASIHKVRVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPKFLNYIDRE
Sbjct: 361 PYVLAASIHKVRVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPKFLNYIDRE 420

Query: 421 GRPLRAXXXXXXXXXXXXXACSPQEEQAFTWLAAIAGLSELFTWSGIMLSHIRFRKAMKV 480
           GRPLRA             ACSPQEEQAFTWLAAIAGLSELFTWSGIMLSHIRFRKAMKV
Sbjct: 421 GRPLRALVVCSLVGVVGFVACSPQEEQAFTWLAAIAGLSELFTWSGIMLSHIRFRKAMKV 480

Query: 481 QGRSLDEVGYKANTGIWGSYYGVFFNMLVFMAQFWVALSPIGNGGKCDAQAFFESYLAAP 540
           QGRSLDEVGYKANTGIWGSYYGVFFNMLVFMAQFWVALSPIGNGGKCDAQAFFESYLAAP
Sbjct: 481 QGRSLDEVGYKANTGIWGSYYGVFFNMLVFMAQFWVALSPIGNGGKCDAQAFFESYLAAP 540

Query: 541 LWIFMYVGYMVYKRDFTFLNPLDKIDLDFHRRVYDPEIMRQEDEENKERLKNSS 594
           LWIFMYVGYMVYKRDFTFLNPLDKIDLDFHRRVYDPEIMRQEDEENKERLKNSS
Sbjct: 541 LWIFMYVGYMVYKRDFTFLNPLDKIDLDFHRRVYDPEIMRQEDEENKERLKNSS 594

>Scas_569.5
          Length = 593

 Score =  852 bits (2201), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/553 (72%), Positives = 459/553 (83%), Gaps = 3/553 (0%)

Query: 42  EHSEESRNGLVHRFVDSFRRAESQRLEEDNDLEDGTKSMKSNNHLKKSMKSRHVVMMSLG 101
           + +EESR+GLVHRFVDSF+RA+      +NDLEDGTK +   +HLKK+MKSRHV+MM +G
Sbjct: 34  DATEESRSGLVHRFVDSFKRAQDS---TENDLEDGTKPLGDASHLKKAMKSRHVIMMCVG 90

Query: 102 TGIGTGLLVANAKGLSLAGPGSLVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNS 161
           TGIGTGLLVANA GLS  GPGSLVIGYV+VSFVTYFM+QAAGEM V YPTLPGNFN+Y S
Sbjct: 91  TGIGTGLLVANASGLSYGGPGSLVIGYVLVSFVTYFMIQAAGEMAVAYPTLPGNFNSYTS 150

Query: 162 IFISKSFGFATTWLFCIQWLTVLPLELITSSMTVKYWNDTINADXXXXXXXXXXXXXXXX 221
           +FISK FGFAT WLF IQWLTV PLELIT+S+T+KYWND INAD                
Sbjct: 151 MFISKPFGFATVWLFFIQWLTVFPLELITASLTIKYWNDKINADVFIVIFYVFLLFIHFF 210

Query: 222 GVKAYGETEFIFNSCKILMVAGFIILSVVINCGGAGVDGYIGGKYWRDPGSFAEGSGATR 281
           GVKAYGE EFIFNSCK+LM+AGFIILS+VINCGGAG DGYIG KYWRDPGSFAEG    +
Sbjct: 211 GVKAYGEAEFIFNSCKVLMIAGFIILSIVINCGGAGKDGYIGAKYWRDPGSFAEGDSVEK 270

Query: 282 FKGICYILVSAYFSFGGIELFVLSINEQSNPRKSTPVAAKRSVYRXXXXXXXXXXXXGFN 341
           FKGICYILV+AYFS+GG ELF LS+NEQ NPRKSTP AAK+S+YR            GFN
Sbjct: 271 FKGICYILVTAYFSYGGAELFSLSVNEQENPRKSTPQAAKQSIYRILIIYLLTMILIGFN 330

Query: 342 VPHNNDQLMGSGGSATHASPYVLAASIHKVRVIPHIINAVILISVISVANSALYAAPRLM 401
           VPHNNDQLMGSGGSATHASPYVLAASIH V+V+PH INAVILISVISVANSALYA+PRLM
Sbjct: 331 VPHNNDQLMGSGGSATHASPYVLAASIHGVKVVPHFINAVILISVISVANSALYASPRLM 390

Query: 402 CSLAQQGYAPKFLNYIDREGRPLRAXXXXXXXXXXXXXACSPQEEQAFTWLAAIAGLSEL 461
           CSLA+QGYAPKFL+Y+DREGRPLRA             + S +EE+ FTWLAAIAGLSEL
Sbjct: 391 CSLAEQGYAPKFLDYVDREGRPLRALILCAVFGVIGFVSASSKEEEVFTWLAAIAGLSEL 450

Query: 462 FTWSGIMLSHIRFRKAMKVQGRSLDEVGYKANTGIWGSYYGVFFNMLVFMAQFWVALSPI 521
           FTWSGIMLSH+RFR+ MK+ GRS +E+G++A TGIWGS YG+ FNMLVF+AQFWVAL+P 
Sbjct: 451 FTWSGIMLSHVRFRQCMKLHGRSEEEIGFRAVTGIWGSMYGISFNMLVFIAQFWVALAPP 510

Query: 522 GNGGKCDAQAFFESYLAAPLWIFMYVGYMVYKRDFTFLNPLDKIDLDFHRRVYDPEIMRQ 581
              GK DA++FF+SYLAAP+W+F Y GYM+YKRDFTFL PLDKIDL+FHRR+YDPE++RQ
Sbjct: 511 SLHGKVDAESFFQSYLAAPIWLFFYFGYMLYKRDFTFLVPLDKIDLNFHRRIYDPELIRQ 570

Query: 582 EDEENKERLKNSS 594
           EDEENKE++KNSS
Sbjct: 571 EDEENKEKIKNSS 583

>YBR068C (BAP2) [258] chr2 complement(373821..375650) Branched-chain
           amino acid permease, also transports alanine and
           aromatic and sulfur containing amino acids [1830 bp, 609
           aa]
          Length = 609

 Score =  845 bits (2183), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/575 (69%), Positives = 465/575 (80%), Gaps = 10/575 (1%)

Query: 26  NNFNTSTTASLTPEIKEHSEESRNGLVHRFVDSFRRAE------SQRLEEDNDLEDGTKS 79
           NNF +S++     + K  S++    L+HRF DSF+RAE       Q  E  +DLEDG +S
Sbjct: 29  NNFQSSSSEKTYSKQKSGSDK----LIHRFADSFKRAEGSTTRTKQINENTSDLEDGVES 84

Query: 80  MKSNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLSLAGPGSLVIGYVMVSFVTYFMV 139
           + S++ LKKSMKSRHVVMMSLGTGIGTGLLVANAKGL   GP +L+IGY++VSF TYFM+
Sbjct: 85  ITSDSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALIIGYILVSFETYFMI 144

Query: 140 QAAGEMGVTYPTLPGNFNAYNSIFISKSFGFATTWLFCIQWLTVLPLELITSSMTVKYWN 199
           QAAGEM VTYPTLP NFNAY+SIFISKSFGFAT WL+C QWLTVLPLELIT+SMT+++ N
Sbjct: 145 QAAGEMAVTYPTLPANFNAYSSIFISKSFGFATVWLYCFQWLTVLPLELITASMTIQFGN 204

Query: 200 DTINADXXXXXXXXXXXXXXXXGVKAYGETEFIFNSCKILMVAGFIILSVVINCGGAGVD 259
           D IN D                GVKAYGETEFIFN CKILM+AGFIILS+VINCGGAG D
Sbjct: 205 DKINPDIYILIFYVFLVFIHFFGVKAYGETEFIFNCCKILMIAGFIILSIVINCGGAGND 264

Query: 260 GYIGGKYWRDPGSFAEGSGATRFKGICYILVSAYFSFGGIELFVLSINEQSNPRKSTPVA 319
           GYIG  YW +PG+FA  +   RFK +CYILV+AYFSFGG+ELF LS+ EQSNPRKSTPVA
Sbjct: 265 GYIGATYWHNPGAFAGDTSIGRFKNVCYILVTAYFSFGGMELFALSVQEQSNPRKSTPVA 324

Query: 320 AKRSVYRXXXXXXXXXXXXGFNVPHNNDQLMGSGGSATHASPYVLAASIHKVRVIPHIIN 379
           AKRS+YR            GFNVP+N+DQLMG+GGSATHASPYVLAASIH V+++PHIIN
Sbjct: 325 AKRSIYRIVVIYLLTMILIGFNVPYNDDQLMGAGGSATHASPYVLAASIHGVKIVPHIIN 384

Query: 380 AVILISVISVANSALYAAPRLMCSLAQQGYAPKFLNYIDREGRPLRAXXXXXXXXXXXXX 439
           AVILISV+SVANS+LYA PRL+CSLAQQGYAPKFL+Y+DREGRPLRA             
Sbjct: 385 AVILISVVSVANSSLYAGPRLICSLAQQGYAPKFLDYVDREGRPLRALIVCCVFGVIAFV 444

Query: 440 ACSPQEEQAFTWLAAIAGLSELFTWSGIMLSHIRFRKAMKVQGRSLDEVGYKANTGIWGS 499
           A S +EE  FTWLAAIAGLSELFTW+ IMLSH+RFR+AMKVQGRSLDE+GYKA TGIWGS
Sbjct: 445 AASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGYKATTGIWGS 504

Query: 500 YYGVFFNMLVFMAQFWVALSPIGNGGKCDAQAFFESYLAAPLWIFMYVGYMVYKRDFTFL 559
            YGVFFN+LVF+AQFWVAL+P+GNGGKCDA++FF++YLA P+W+  Y GYMVY RDFT L
Sbjct: 505 IYGVFFNILVFVAQFWVALAPLGNGGKCDAESFFQNYLAFPIWLAFYFGYMVYNRDFTLL 564

Query: 560 NPLDKIDLDFHRRVYDPEIMRQEDEENKERLKNSS 594
           NPLDKIDLDFHRR+YDPE+MRQEDEENKE+L+N S
Sbjct: 565 NPLDKIDLDFHRRIYDPELMRQEDEENKEKLRNMS 599

>Scas_718.42
          Length = 595

 Score =  812 bits (2098), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/586 (66%), Positives = 456/586 (77%), Gaps = 5/586 (0%)

Query: 7   TSSKMEKSAEFEVTDSALYNNFNTSTTASLTPEIKEHSEESRNGLVHRFVDSFRRAESQR 66
           +S K E S E     S+     N +      P+       +     +RFVDSF+RAE   
Sbjct: 3   SSKKNETSPEVNSITSSTLKTPNVTEKFEPYPDTTAVKHRTH---FNRFVDSFKRAEVN- 58

Query: 67  LEEDNDLEDGTKSMKSNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLSLAGPGSLVI 126
                DLEDGT S++S+++LKK+MKSRHV+MMSLGTGIGTGLLVANAKGL LAGP SLVI
Sbjct: 59  -HNGIDLEDGTNSIQSDDNLKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAGPASLVI 117

Query: 127 GYVMVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFISKSFGFATTWLFCIQWLTVLPL 186
           GY MVSF+TYF++QAAGEM VTYPTLPG FN Y SIF+SK FGFAT WLFCIQWLTVLPL
Sbjct: 118 GYFMVSFITYFVIQAAGEMAVTYPTLPGGFNNYASIFVSKPFGFATVWLFCIQWLTVLPL 177

Query: 187 ELITSSMTVKYWNDTINADXXXXXXXXXXXXXXXXGVKAYGETEFIFNSCKILMVAGFII 246
           ELIT+SMT+KYWND INAD                GV+AYGE EFIFNSCKILM+ GF+I
Sbjct: 178 ELITASMTIKYWNDKINADVFVVILYVFLLFIHFFGVRAYGEAEFIFNSCKILMIGGFVI 237

Query: 247 LSVVINCGGAGVDGYIGGKYWRDPGSFAEGSGATRFKGICYILVSAYFSFGGIELFVLSI 306
           LS+V+NCGGAGVDGYIGGKYWRDPG+FA  + A+RFKG+ ++LV+AYFS+GG+ELF LS+
Sbjct: 238 LSIVVNCGGAGVDGYIGGKYWRDPGAFASDNAASRFKGVAFVLVTAYFSYGGVELFALSV 297

Query: 307 NEQSNPRKSTPVAAKRSVYRXXXXXXXXXXXXGFNVPHNNDQLMGSGGSATHASPYVLAA 366
           NEQ NPR+STP AAK+S+YR            GFNVPHN+DQLMG+GGSATHASPYVLA 
Sbjct: 298 NEQENPRRSTPAAAKQSIYRILIIYLLTMILIGFNVPHNSDQLMGAGGSATHASPYVLAV 357

Query: 367 SIHKVRVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPKFLNYIDREGRPLRA 426
           SIH V+V+PHIINAVILISV SVANSALYA+PRL+ SLA+QGYAPK+ NY+DREGRPLRA
Sbjct: 358 SIHGVKVVPHIINAVILISVTSVANSALYASPRLLRSLAEQGYAPKYFNYVDREGRPLRA 417

Query: 427 XXXXXXXXXXXXXACSPQEEQAFTWLAAIAGLSELFTWSGIMLSHIRFRKAMKVQGRSLD 486
                        ACS QEE  FTWLAAIAGLSELFTWS I+LSH+RFR AMK QG+SL+
Sbjct: 418 LILCSIFGVIAFCACSDQEEVIFTWLAAIAGLSELFTWSSILLSHVRFRLAMKAQGKSLN 477

Query: 487 EVGYKANTGIWGSYYGVFFNMLVFMAQFWVALSPIGNGGKCDAQAFFESYLAAPLWIFMY 546
           E+GY + TGIWGS YG FFN+LVF+AQFWVALSP G+ G   A+AFFESYLA P+W+F Y
Sbjct: 478 ELGYISITGIWGSLYGCFFNVLVFIAQFWVALSPPGSKGVYSAEAFFESYLAFPVWLFFY 537

Query: 547 VGYMVYKRDFTFLNPLDKIDLDFHRRVYDPEIMRQEDEENKERLKN 592
           +GYM+Y RDFTFL  L KIDLD HRR+YDPE++RQEDEE KER++N
Sbjct: 538 LGYMLYSRDFTFLTDLKKIDLDNHRRLYDPELLRQEDEETKERIRN 583

>CAGL0L07546g complement(831824..833728) highly similar to sp|P38084
           Saccharomyces cerevisiae YBR068c BAP2 or sp|P41815
           Saccharomyces cerevisiae YDR046c PAP1, start by
           similarity
          Length = 634

 Score =  778 bits (2010), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/616 (62%), Positives = 456/616 (74%), Gaps = 29/616 (4%)

Query: 7   TSSKMEKSAE------FEVTDSALYNNFNTSTTASLTPEIKEHSEESRNGLVHRFVDSFR 60
           +SSK E +AE      +   D   Y   N++  +    +      E R  LVHRFVDSF+
Sbjct: 10  SSSKKESTAEEFTIPEYSRDDGEKYAG-NSNDYSQRDSDNTSIESEPRTKLVHRFVDSFK 68

Query: 61  RAESQR-------------------LEEDN-DLEDGTK-SMKSNNHLKKSMKSRHVVMMS 99
           RA+                       EED+ DLE     S+ +N HLKK+MKSRHV+MMS
Sbjct: 69  RAQDVPTGRKSKEIGNNGGSKTKGGFEEDSLDLEGSDHDSIITNTHLKKAMKSRHVMMMS 128

Query: 100 LGTGIGTGLLVANAKGLSLAGPGSLVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGNFNAY 159
           LGTGIGTGLLVANAKGL   GP +LVIGYV+VSFVTYFM+QAAGEM VTYPTLPGNFNAY
Sbjct: 129 LGTGIGTGLLVANAKGLHFGGPAALVIGYVLVSFVTYFMIQAAGEMAVTYPTLPGNFNAY 188

Query: 160 NSIFISKSFGFATTWLFCIQWLTVLPLELITSSMTVKYWNDTINADXXXXXXXXXXXXXX 219
           +SIF+S +FGFAT W+FCIQWLTVLPLELIT+S+T+KYWND INAD              
Sbjct: 189 SSIFVSNAFGFATVWIFCIQWLTVLPLELITASLTIKYWNDKINADVFIVIFYVFLLCIH 248

Query: 220 XXG-VKAYGETEFIFNSCKILMVAGFIILSVVINCGGAGVDGYIGGKYWRDPGSFAEGSG 278
             G V AYGETEF+FN CKILMV GFII+S+VIN GGAG   YIGGK+W DPG+FA  + 
Sbjct: 249 LFGGVIAYGETEFLFNLCKILMVIGFIIMSIVINAGGAGNREYIGGKFWHDPGAFAGKTA 308

Query: 279 ATRFKGICYILVSAYFSFGGIELFVLSINEQSNPRKSTPVAAKRSVYRXXXXXXXXXXXX 338
            +RFKGICY+LVS YFS+GG ELF LS+NEQSNPR+STP A+K S+YR            
Sbjct: 309 GSRFKGICYVLVSGYFSYGGTELFALSVNEQSNPRRSTPQASKSSLYRILIIYLLTMILI 368

Query: 339 GFNVPHNNDQLMGSGGSATHASPYVLAASIHKVRVIPHIINAVILISVISVANSALYAAP 398
           GFNVP+++D+LMGSGGSATHASPYVLAAS++ V++ PH INAVILISVISVANS+LYAAP
Sbjct: 369 GFNVPYDSDELMGSGGSATHASPYVLAASLNGVKIAPHFINAVILISVISVANSSLYAAP 428

Query: 399 RLMCSLAQQGYAPKFLNYIDREGRPLRAXXXXXXXXXXXXXACSPQEEQAFTWLAAIAGL 458
           RLMCSLAQQGYAPKFL+Y+DR+GRPL A             A SP+EE+ FTWLAAIAGL
Sbjct: 429 RLMCSLAQQGYAPKFLDYVDRQGRPLLALIACLLVGVIGFVAASPKEEEVFTWLAAIAGL 488

Query: 459 SELFTWSGIMLSHIRFRKAMKVQGRSLDEVGYKANTGIWGSYYGVFFNMLVFMAQFWVAL 518
           SELFTWS IMLSH+RFR AMK+Q RSL+E+GYKA TGI+GS YGV FN+LVF AQFW AL
Sbjct: 489 SELFTWSSIMLSHVRFRMAMKLQNRSLEELGYKATTGIYGSIYGVCFNLLVFAAQFWTAL 548

Query: 519 SPIGNGGKCDAQAFFESYLAAPLWIFMYVGYMVYKRDFTFLNPLDKIDLDFHRRVYDPEI 578
            P G  GK +A +FF +YLA P+W+  Y GYM++ RDF  L PLDKIDLDFHRR+YDPE+
Sbjct: 549 FPFGGDGKANANSFFANYLAMPIWLVFYFGYMLWTRDFQLLKPLDKIDLDFHRRIYDPEL 608

Query: 579 MRQEDEENKERLKNSS 594
           MRQEDEE+KERL+N S
Sbjct: 609 MRQEDEESKERLRNGS 624

>CAGL0H08393g 821998..823836 highly similar to sp|P41815
           Saccharomyces cerevisiae YDR046c PAP1, hypothetical
           start
          Length = 612

 Score =  766 bits (1977), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/550 (66%), Positives = 435/550 (79%), Gaps = 6/550 (1%)

Query: 46  ESRNGLVHRFVDSFRRAESQRLEEDNDLEDGTKSMKSNNHLKKSMKSRHVVMMSLGTGIG 105
           + +N  +  F+DSF+RA+     + NDLE   K+  ++   KK+MKSRHV+MMSLGTGIG
Sbjct: 58  QVKNRHLQGFIDSFKRADDS--PDHNDLE---KTTTAHQEQKKTMKSRHVIMMSLGTGIG 112

Query: 106 TGLLVANAKGLSLAGPGSLVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFIS 165
           TGLLV+N KGLSLAGP SLVI Y +VSFVTYFM+QAAGEM VTYPTLPG+FNAY S FIS
Sbjct: 113 TGLLVSNGKGLSLAGPASLVIAYGLVSFVTYFMIQAAGEMAVTYPTLPGSFNAYTSFFIS 172

Query: 166 KSFGFATTWLFCIQWLTVLPLELITSSMTVKYWNDTINADXXXXXXXXXXXXXXXXGVKA 225
           K FGFATTWLFCIQWLTVLPLELIT++MT+KYWN +I+ D                GV+A
Sbjct: 173 KPFGFATTWLFCIQWLTVLPLELITAAMTIKYWNTSIDPDVFVIIFYVFLMFIHFFGVQA 232

Query: 226 YGETEFIFNSCKILMVAGFIILSVVINCGGAGVDGYIGGKYWRDPGSFAEGSGATRFKGI 285
           YGETEFIFN+CKILM+ GFII ++V+NCGGAG DGYIGGKYW DPG+FA  +GA+RFKGI
Sbjct: 233 YGETEFIFNACKILMIGGFIIFAIVVNCGGAGKDGYIGGKYWHDPGAFASSNGASRFKGI 292

Query: 286 CYILVSAYFSFGGIELFVLSINEQSNPRKSTPVAAKRSVYRXXXXXXXXXXXXGFNVPHN 345
           CY LV+AYFS+GG ELFVLS+N+Q NPRKSTP AAK +VYR            GF VPHN
Sbjct: 293 CYNLVNAYFSYGGNELFVLSVNDQKNPRKSTPAAAKSNVYRIVVIYLLTMILIGFVVPHN 352

Query: 346 NDQLMG-SGGSATHASPYVLAASIHKVRVIPHIINAVILISVISVANSALYAAPRLMCSL 404
           + +L+G SGG+  HASPYVLAASIH ++V+PHIINAVILI++ISVANS+LYA PRL+ SL
Sbjct: 353 SSELLGASGGNGLHASPYVLAASIHGIKVVPHIINAVILIALISVANSSLYAGPRLLSSL 412

Query: 405 AQQGYAPKFLNYIDREGRPLRAXXXXXXXXXXXXXACSPQEEQAFTWLAAIAGLSELFTW 464
           AQQGYAP+FL+Y+DR GRPL A             A SP+EE+ FTWLAAI+GLSELFTW
Sbjct: 413 AQQGYAPRFLSYVDRRGRPLTALLLSALVGVIGFAATSPREEEVFTWLAAISGLSELFTW 472

Query: 465 SGIMLSHIRFRKAMKVQGRSLDEVGYKANTGIWGSYYGVFFNMLVFMAQFWVALSPIGNG 524
           + IM SHIRFR+AMK+Q +SLD +GYKANTG+WGSY+GV FN+LVF AQFWVALSP  +G
Sbjct: 473 TSIMFSHIRFRRAMKLQNKSLDTLGYKANTGLWGSYFGVGFNILVFAAQFWVALSPPNSG 532

Query: 525 GKCDAQAFFESYLAAPLWIFMYVGYMVYKRDFTFLNPLDKIDLDFHRRVYDPEIMRQEDE 584
           GKCDA +FF SYLA P+W+  Y GYM + +DFT L  L+++DLD HR+VYDPE +RQED 
Sbjct: 533 GKCDANSFFASYLAMPIWLVFYFGYMCWYKDFTVLTDLNQVDLDNHRKVYDPEFLRQEDL 592

Query: 585 ENKERLKNSS 594
           ENKERL+NSS
Sbjct: 593 ENKERLRNSS 602

>AGR038C [4348] [Homologous to ScYDR046C (BAP3) - SH; ScYBR068C
           (BAP2) - SH] (777535..779277) [1743 bp, 580 aa]
          Length = 580

 Score =  685 bits (1768), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/568 (57%), Positives = 406/568 (71%), Gaps = 5/568 (0%)

Query: 26  NNFNTSTTASLTPEIKEHSEESRNGLVHRFVDSFRRAESQRLEEDNDLEDGTKSMKSNNH 85
           N FN  T           S ES  G   RFVDSFRR ++ R     DLEDG  +      
Sbjct: 7   NKFNEKTVVQTAYSPSYASPES-TGPFRRFVDSFRREDTSR---SGDLEDGEINSTDTTK 62

Query: 86  LKKSMKSRHVVMMSLGTGIGTGLLVANAKGLSLAGPGSLVIGYVMVSFVTYFMVQAAGEM 145
           L++ M++RHVVMMSLGTGIGTGLLVANA  L   GP  L+IGY++VS V+Y M+ AAGEM
Sbjct: 63  LQQRMRTRHVVMMSLGTGIGTGLLVANAASLHYGGPAGLLIGYLLVSIVSYIMMHAAGEM 122

Query: 146 GVTYPTLPGNFNAYNSIFISKSFGFATTWLFCIQWLTVLPLELITSSMTVKYWNDTINAD 205
            V YPTLPGNFNAY+SIFISK FGFAT WLFC+QWLTV PLELIT+++ +KYW  ++NA+
Sbjct: 123 AVAYPTLPGNFNAYSSIFISKPFGFATVWLFCLQWLTVFPLELITATIVIKYWKVSVNAN 182

Query: 206 XXXXXXXXXXXXXXXXGVKAYGETEFIFNSCKILMVAGFIILSVVINCGGAGVDGYIGGK 265
                           G + YGETEFIFN CK+LM+ GF+I+ ++IN G  G  GYIG +
Sbjct: 183 VFVVIFYLFIICIHFFGARGYGETEFIFNMCKVLMIVGFVIVGILINVGAIGDTGYIGDR 242

Query: 266 YWRDPGSFAEGSGATRFKGICYILVSAYFSFGGIELFVLSINEQSNPRKSTPVAAKRSVY 325
           YWR+PGSF  G+   + KG  Y+LV+AYFSFGG+EL+ LS+NE  NP+ + P A K+ VY
Sbjct: 243 YWRNPGSFVSGTPLDKLKGTAYVLVTAYFSFGGMELYALSVNELPNPKTAIPSACKKGVY 302

Query: 326 RXXXXXXXXXXXXGFNVPHNNDQLMGSGGSATHASPYVLAASIHKVRVIPHIINAVILIS 385
           R            GF VPH++D+LMGSG +  H SPYVLA  +H V+V+PHI+NAVILIS
Sbjct: 303 RILLVYLLTMIMIGFLVPHDSDRLMGSGSNDVHPSPYVLAIEMHGVKVLPHIVNAVILIS 362

Query: 386 VISVANSALYAAPRLMCSLAQQGYAPKFLNYIDREGRPLRAXXXXXXXXXXXXXACSPQE 445
           VISV NSA+Y+APRL+C+LAQQGYAPK L+YIDREGRPL +             A S  +
Sbjct: 363 VISVGNSAMYSAPRLLCALAQQGYAPKQLDYIDREGRPLISLILCAIFGLIAFSAASDNQ 422

Query: 446 EQAFTWLAAIAGLSELFTWSGIMLSHIRFRKAMKVQGRSLDEVGYKANTGIWGSYYGVFF 505
           E+ F WLAAIAGLSELFTW+ I LSH RFR+AMK+QGRSL+ +GY+A TG WGS Y VFF
Sbjct: 423 EKIFIWLAAIAGLSELFTWTSICLSHFRFRQAMKLQGRSLETLGYRAITGQWGSLYAVFF 482

Query: 506 NMLVFMAQFWVALSPIGNGGKCDAQAFFESYLAAPLWIFMYVGYMVYKRDFTFLNPLDKI 565
           N+LVF+AQFWVAL PI    K D  +FF++Y+A PLW+ M++GYMVY R++T LNPLDK+
Sbjct: 483 NLLVFIAQFWVALVPIAK-KKVDVLSFFQNYMAFPLWLIMFLGYMVYSRNWTLLNPLDKM 541

Query: 566 DLDFHRRVYDPEIMRQEDEENKERLKNS 593
           DLD HRRVYD E+++QE+ E KER++NS
Sbjct: 542 DLDTHRRVYDVEVLKQEEYEFKERMRNS 569

>Kwal_27.10538
          Length = 602

 Score =  665 bits (1715), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/566 (56%), Positives = 404/566 (71%), Gaps = 3/566 (0%)

Query: 31  STTASLTPEIKEHSEESRNGLVHRFVDSFRRAESQRLEEDNDLEDGT-KSMKSNNHLKKS 89
           S + S+  E      E+RN    RFV+SF+RAE      + DLE  T  S+ S++ LK+S
Sbjct: 28  SESGSIGQEWNAWDNENRNAW-GRFVNSFKRAEKHSTPSNGDLEHATTHSVASSSPLKRS 86

Query: 90  MKSRHVVMMSLGTGIGTGLLVANAKGLSLAGPGSLVIGYVMVSFVTYFMVQAAGEMGVTY 149
           +K RHV MMS+ TGIGTGLLVAN K L   GP  L+IGY  VS V Y M+QAAGEM V Y
Sbjct: 87  IKPRHVAMMSICTGIGTGLLVANGKSLRFGGPAGLIIGYAAVSVVAYIMMQAAGEMAVAY 146

Query: 150 PTLPGNFNAYNSIFISKSFGFATTWLFCIQWLTVLPLELITSSMTVKYWNDTINADXXXX 209
           P+LPGNFNAY+S  IS+ FGFAT WL+CIQWLTVLPLELIT+S+T+KYWND+INAD    
Sbjct: 147 PSLPGNFNAYSSQLISRPFGFATVWLYCIQWLTVLPLELITASLTIKYWNDSINADVFIA 206

Query: 210 XXXXXXXXXXXXGVKAYGETEFIFNSCKILMVAGFIILSVVINCGGAGVDGYIGGKYWRD 269
                       G + YGE+EFIF  CK+LM+ GF+ILS+VINCGGAG   YIG KYW D
Sbjct: 207 IFYVFILFIHFFGSRGYGESEFIFGICKVLMIIGFVILSIVINCGGAGDRKYIGAKYWYD 266

Query: 270 PGSFAEGSGATRFKGICYILVSAYFSFGGIELFVLSINEQSNPRKSTPVAAKRSVYRXXX 329
           PG+FA GSGAT+FKG+ Y+LV+ YFS+GG EL+ +++NEQSNPR++     K+ +YR   
Sbjct: 267 PGAFAVGSGATKFKGVAYVLVTGYFSYGGTELYAMTVNEQSNPRRAIQSITKQCIYRILL 326

Query: 330 XXXXXXXXXGFNVPHNNDQLMGSGG-SATHASPYVLAASIHKVRVIPHIINAVILISVIS 388
                    GF VPH + +LMGS G SATHASPYVLA S+H V+++PHIINAVILI+VIS
Sbjct: 327 IYMLTMILIGFLVPHTSSELMGSSGKSATHASPYVLAVSLHGVKIVPHIINAVILIAVIS 386

Query: 389 VANSALYAAPRLMCSLAQQGYAPKFLNYIDREGRPLRAXXXXXXXXXXXXXACSPQEEQA 448
           V NSA+Y+ PR++ +LA+QGYAP+FL Y+DR GRPL A             A S  EE  
Sbjct: 387 VGNSAMYSGPRILNTLAEQGYAPRFLAYVDRAGRPLVALIACSVFGLLAFVAASDCEEDV 446

Query: 449 FTWLAAIAGLSELFTWSGIMLSHIRFRKAMKVQGRSLDEVGYKANTGIWGSYYGVFFNML 508
           FTWLAAIAGLSELFTWS IMLSH+RFR+AM+   R L E+GYKANTG+ GS  G+ FN+L
Sbjct: 447 FTWLAAIAGLSELFTWSAIMLSHVRFRQAMRYNNRPLSELGYKANTGVLGSVLGLSFNIL 506

Query: 509 VFMAQFWVALSPIGNGGKCDAQAFFESYLAAPLWIFMYVGYMVYKRDFTFLNPLDKIDLD 568
           VF+AQFWV+++P G  GK D  +FF+SYLA PLW+ ++ GYM+  R++  + PL  IDLD
Sbjct: 507 VFIAQFWVSIAPFGKDGKLDVLSFFQSYLAFPLWVVLFFGYMIVFRNWEIIKPLKDIDLD 566

Query: 569 FHRRVYDPEIMRQEDEENKERLKNSS 594
            +R +YD + + QED E+K  ++NSS
Sbjct: 567 HYRSIYDQDRLYQEDLEHKILIQNSS 592

>CAGL0K05753g 564282..566264 highly similar to sp|P48813
           Saccharomyces cerevisiae YDR508c GNP1, start by
           similarity
          Length = 660

 Score =  613 bits (1581), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/613 (50%), Positives = 386/613 (62%), Gaps = 25/613 (4%)

Query: 3   DPIVTSSKMEKSAEFEVTDSALYNNFNTSTTASLTPEIKEHSEESRNGLVHRFVDSFRRA 62
           D + + S+   ++  E  D    +  N       T E     +E   G + RF+DSF+RA
Sbjct: 38  DNLGSGSRGATTSAVEYFDKENVDGVNIDEKLQSTTEFG--GDEMPRGNIRRFIDSFKRA 95

Query: 63  ESQRLEEDNDLED----------------------GTKSMK-SNNHLKKSMKSRHVVMMS 99
           E Q  ++ N  ED                      G   MK     LKKS+K RHVVM+S
Sbjct: 96  EQQPNQQHNLAEDLENDLTTAISMNSLDRVQNKPTGNGQMKFEEEALKKSIKPRHVVMIS 155

Query: 100 LGTGIGTGLLVANAKGLSLAGPGSLVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGNFNAY 159
           LGTGIGTGLLV NAK L  AGP  LVIGY ++    Y ++QAAGEM V Y  L G FN Y
Sbjct: 156 LGTGIGTGLLVGNAKALHNAGPAGLVIGYAIMGSCIYCIIQAAGEMAVVYSNLLGGFNTY 215

Query: 160 NSIFISKSFGFATTWLFCIQWLTVLPLELITSSMTVKYWNDTINADXXXXXXXXXXXXXX 219
            S+ +   FGFA  W++C+QWL V PLEL+T+S+T+KYW  T+N D              
Sbjct: 216 PSMLVDPGFGFAVAWVYCLQWLCVCPLELVTTSLTIKYWTTTVNPDAFVVIFYVVIIFIQ 275

Query: 220 XXGVKAYGETEFIFNSCKILMVAGFIILSVVINCGGAGVDGYIGGKYWRDPGSFAEGSGA 279
             G + Y E EF FN CKILM+ GF IL ++IN GGAG DGY+G KYW DPG+F   +G 
Sbjct: 276 IFGARGYAEAEFFFNCCKILMIIGFYILGIIINAGGAGNDGYLGAKYWHDPGAFRGTNGI 335

Query: 280 TRFKGICYILVSAYFSFGGIELFVLSINEQSNPRKSTPVAAKRSVYRXXXXXXXXXXXXG 339
            RFKGI    VSA F+FG  E   L+  EQSNPRK+ P AAK+ +YR            G
Sbjct: 336 QRFKGIMATFVSAAFAFGATEFIALTAAEQSNPRKAIPSAAKKVLYRVICIFVGTIALLG 395

Query: 340 FNVPHNNDQLMGSGGSATHASPYVLAASIHKVRVIPHIINAVILISVISVANSALYAAPR 399
           F VP ++DQLMG+GGSAT ASPYVLA SIH VRV+PH INAVILISV SVANSA Y++ R
Sbjct: 396 FLVPWDSDQLMGAGGSATKASPYVLAISIHGVRVVPHFINAVILISVFSVANSAFYSSSR 455

Query: 400 LMCSLAQQGYAPKFLNYIDREGRPLRAXXXXXXXXXXXXXACSPQEEQAFTWLAAIAGLS 459
           L+  LAQQGYAPKF +Y+DR+GRP RA             A SP+E+Q FTWL AI+GLS
Sbjct: 456 LLLGLAQQGYAPKFFDYVDRQGRPFRAMCCAALFGVIAFCAASPKEDQVFTWLLAISGLS 515

Query: 460 ELFTWSGIMLSHIRFRKAMKVQGRSLDEVGYKANTGIWGSYYGVFFNMLVFMAQFWVALS 519
           +LFTW  I +SHIRFR+AM VQGRSL E+G+KA  G++GSYY     +L  +AQFWVA++
Sbjct: 516 QLFTWIAICVSHIRFRRAMTVQGRSLGEIGFKAQLGVYGSYYATIMMVLALIAQFWVAIA 575

Query: 520 PIGNGGKCDAQAFFESYLAAPLWIFMYVGYMVYKRDFTFLNPLDKIDLDFHRRVYDPEIM 579
           PIGN G  DA+ FFE+YLA P+ I  Y GY ++KRD+        IDLD +R+V+D E++
Sbjct: 576 PIGNNGDLDAEGFFENYLAMPILIAFYFGYKLWKRDWRLFIRAKDIDLDSYRQVFDEELL 635

Query: 580 RQEDEENKERLKN 592
           +QEDEE KE+LKN
Sbjct: 636 KQEDEEYKEKLKN 648

>CAGL0B01012g 91330..93201 similar to sp|P25376 Saccharomyces
           cerevisiae YCL025c AGP1 Asparagine/glutamine permease or
           sp|P48813 Saccharomyces cerevisiae YDR508c GNP1,
           hypothetical start
          Length = 623

 Score =  611 bits (1576), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/607 (50%), Positives = 390/607 (64%), Gaps = 27/607 (4%)

Query: 12  EKSAEFEVTDSALYNNFNTSTTASLTPEIKEHSEESRNGLVHRFVDSFRRAESQRLEE-- 69
           + SA+F    S     + +    S+TPE              RFVDSF+RAE Q   E  
Sbjct: 6   DNSADFNDKVSDKEVEYMSPREVSVTPETSATPNTPAPSQFRRFVDSFKRAEQQNNSEIT 65

Query: 70  ---------DNDLEDGT---------------KSMKSNNHLKKSMKSRHVVMMSLGTGIG 105
                    +N  +DG                KS + N  LK+++K RHV+++SLGTGIG
Sbjct: 66  SAASCDGSSENLDKDGKEVADLEVQENQVLTEKSNQKNKELKQTIKPRHVILISLGTGIG 125

Query: 106 TGLLVANAKGLSLAGPGSLVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFIS 165
           TGLLV NAK L  AGP  L+IGY ++    Y ++QAAGE+ V+Y +L G FN Y S  + 
Sbjct: 126 TGLLVGNAKALHNAGPAGLLIGYSIMGTCLYCIIQAAGELAVSYSSLSGGFNVYPSFLVD 185

Query: 166 KSFGFATTWLFCIQWLTVLPLELITSSMTVKYWNDTINADXXXXXXXXXXXXXXXXGVKA 225
            +FGF+  W++CIQWL V PLEL+T+SMT+KYW  T+NAD                G + 
Sbjct: 186 PAFGFSVAWVYCIQWLCVCPLELVTASMTIKYWTTTVNADIFVGIFYVLIIVINTFGARG 245

Query: 226 YGETEFIFNSCKILMVAGFIILSVVINCGGAGVDGYIGGKYWRDPGSFAEGSGATRFKGI 285
           Y E EF FN CKILM+ GF IL +VIN GGAG DGYIG +YW  PG+FA       FKGI
Sbjct: 246 YAEAEFFFNCCKILMMIGFFILGIVINTGGAGNDGYIGDRYWHTPGAFAGDRPIDHFKGI 305

Query: 286 CYILVSAYFSFGGIELFVLSINEQSNPRKSTPVAAKRSVYRXXXXXXXXXXXXGFNVPHN 345
              +V+A F+FG  E   L+  EQSNPRK+ P AAK+ +YR            GF VP++
Sbjct: 306 MATMVTAAFAFGATEFIALTAAEQSNPRKAIPSAAKKVLYRILFIFLGSITLVGFLVPYD 365

Query: 346 NDQLMGSGGSATHASPYVLAASIHKVRVIPHIINAVILISVISVANSALYAAPRLMCSLA 405
           +DQLMGSGGSAT ASPYVLA S H V+V+PH INAVIL+SV+SV NSA Y++ RL+ SLA
Sbjct: 366 SDQLMGSGGSATKASPYVLAVSTHGVKVVPHFINAVILLSVLSVGNSAFYSSSRLLYSLA 425

Query: 406 QQGYAPKFLNYIDREGRPLRAXXXXXXXXXXXXXACSPQEEQAFTWLAAIAGLSELFTWS 465
           QQG APKF +Y+DREGRP RA             A SP+EEQ FTWL AI+GLS++FTW 
Sbjct: 426 QQGNAPKFFDYVDREGRPFRAMVCAGVFAIISFCAASPKEEQVFTWLLAISGLSQVFTWF 485

Query: 466 GIMLSHIRFRKAMKVQGRSLDEVGYKANTGIWGSYYGVFFNMLVFMAQFWVALSPIGNGG 525
            I LSHIRFRKAM VQ RSL E+G+KA TG+WGSYY  F  +++ +AQFWVA++PIG  G
Sbjct: 486 AICLSHIRFRKAMFVQKRSLGEIGFKAQTGVWGSYYVCFMLVMILIAQFWVAIAPIGE-G 544

Query: 526 KCDAQAFFESYLAAPLWIFMYVGYMVYKRDFTFLNPLDKIDLDFHRRVYDPEIMRQEDEE 585
           K DAQ FFE+YLA P+ I  YVGY ++K+D++     + IDLD HR+++D E+++QEDEE
Sbjct: 545 KLDAQGFFENYLAMPILILFYVGYKIWKKDWSLFIRANNIDLDKHRQIFDEELLKQEDEE 604

Query: 586 NKERLKN 592
            +E+LKN
Sbjct: 605 YREKLKN 611

>YDR508C (GNP1) [1322] chr4 complement(1466441..1468432) High
           affinity glutamine permease, may also transports
           leucine, cysteine, methionine, serine, threonine and
           asparagine, member of the amino acid-polyamine-choline
           (APC) family of membrane transporters [1992 bp, 663 aa]
          Length = 663

 Score =  601 bits (1550), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/594 (49%), Positives = 377/594 (63%), Gaps = 34/594 (5%)

Query: 33  TASLTPEIKEHSEESRNGLVHRFVDSFRRAESQRL---------------------EEDN 71
           T   T E  E+  E     + RF+DSFRRAE                         + DN
Sbjct: 58  TVEKTIENMEYEGEHHASYLRRFIDSFRRAEGSHANSPDSSNSNGTTPISTKDSSSQLDN 117

Query: 72  DLE--------DGTKSM-----KSNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLSL 118
           +L         DG K       +   +LKKS+K RH VMMSLGTGIGTGLLV N+K L+ 
Sbjct: 118 ELNRKSSYITVDGIKQSPQEQEQKQENLKKSIKPRHTVMMSLGTGIGTGLLVGNSKVLNN 177

Query: 119 AGPGSLVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFISKSFGFATTWLFCI 178
           AGPG L+IGY ++    Y ++QA GE+ V Y  L G FN Y    +  + GF+  WLFC+
Sbjct: 178 AGPGGLIIGYAIMGSCVYCIIQACGELAVIYSDLIGGFNTYPLFLVDPALGFSVAWLFCL 237

Query: 179 QWLTVLPLELITSSMTVKYWNDTINADXXXXXXXXXXXXXXXXGVKAYGETEFIFNSCKI 238
           QWL V PLEL+T+SMT+KYW  ++N D                G K Y E +F FN CKI
Sbjct: 238 QWLCVCPLELVTASMTIKYWTTSVNPDVFVVIFYVLIVVINVFGAKGYAEADFFFNCCKI 297

Query: 239 LMVAGFIILSVVINCGGAGVDGYIGGKYWRDPGSFAEGSGATRFKGICYILVSAYFSFGG 298
           LM+ GF IL+++I+CGGAG DGYIG KYWRDPG+F   +   RFKG+    V+A F+FG 
Sbjct: 298 LMIVGFFILAIIIDCGGAGTDGYIGSKYWRDPGAFRGDTPIQRFKGVVATFVTAAFAFGM 357

Query: 299 IELFVLSINEQSNPRKSTPVAAKRSVYRXXXXXXXXXXXXGFNVPHNNDQLMGSGGSATH 358
            E   ++ +EQSNPRK+ P AAK+ +YR            GF VP+ +DQL+G+ GSAT 
Sbjct: 358 SEQLAMTASEQSNPRKAIPSAAKKMIYRILFVFLASLTLVGFLVPYTSDQLLGAAGSATK 417

Query: 359 ASPYVLAASIHKVRVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPKFLNYID 418
           ASPYV+A S H VRV+PH INAVIL+SV+SVAN A Y + R++ SLA+QG APK  +YID
Sbjct: 418 ASPYVIAVSSHGVRVVPHFINAVILLSVLSVANGAFYTSSRILMSLAKQGNAPKCFDYID 477

Query: 419 REGRPLRAXXXXXXXXXXXXXACSPQEEQAFTWLAAIAGLSELFTWSGIMLSHIRFRKAM 478
           REGRP  A             A S +EE  FTWL AI+GLS+LFTW  I LSHIRFR+AM
Sbjct: 478 REGRPAAAMLVSALFGVIAFCASSKKEEDVFTWLLAISGLSQLFTWITICLSHIRFRRAM 537

Query: 479 KVQGRSLDEVGYKANTGIWGSYYGVFFNMLVFMAQFWVALSPIGNGGKCDAQAFFESYLA 538
           KVQGRSL EVGYK+  G+WGS Y V   +L  +AQFWVA++PIG GGK  AQ+FFE+YLA
Sbjct: 538 KVQGRSLGEVGYKSQVGVWGSAYAVLMMVLALIAQFWVAIAPIGGGGKLSAQSFFENYLA 597

Query: 539 APLWIFMYVGYMVYKRDFTFLNPLDKIDLDFHRRVYDPEIMRQEDEENKERLKN 592
            P+WI +Y+ Y V+K+D++   P DK+DL  HR ++D E+++QEDEE KERL+N
Sbjct: 598 MPIWIALYIFYKVWKKDWSLFIPADKVDLVSHRNIFDEELLKQEDEEYKERLRN 651

>AGR039C [4349] [Homologous to ScYDR046C (BAP3) - SH; ScYBR068C
           (BAP2) - SH] (779726..781486) [1761 bp, 586 aa]
          Length = 586

 Score =  574 bits (1479), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/544 (50%), Positives = 369/544 (67%), Gaps = 6/544 (1%)

Query: 54  RFVDSFRRAESQRLE--EDNDLEDGTKSMKSNNHLKKSMKSRHVVMMSLGTGIGTGLLVA 111
           RF DSF+RA+       E  D ++G    K+   LK ++K+RH+ M+SLGTGIGTGLLVA
Sbjct: 36  RFTDSFKRAQVDTAVDLEGKDADNGLN--KTQQTLKHNIKTRHLTMISLGTGIGTGLLVA 93

Query: 112 NAKGLSLAGPGSLVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFISKSFGFA 171
           + K L   GP  LVIGYV  S + Y +VQA  E+GV Y TLPGN+NAY +  + K FGFA
Sbjct: 94  SGKALHFGGPAGLVIGYVTTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDKGFGFA 153

Query: 172 TTWLFCIQWLTVLPLELITSSMTVKYWNDTINADXXXXXXXXXXXXXXXXGVKAYGETEF 231
              ++ +QW TVLPLEL+T+SMTVKYW  ++N D                G + Y E EF
Sbjct: 154 VALVYGLQWATVLPLELVTASMTVKYWTSSVNPDVFVAIFYVFLLFIHFFGSRGYAEAEF 213

Query: 232 IFNSCKILMVAGFIILSVVINCGGAGVDGYIGGKYWRDPGSFAEGSGATRFKGICYILVS 291
           IFNS K+L++AGFII+++ +  G A   GYIGG+YW DPG+F       RFKGIC + V 
Sbjct: 214 IFNSLKVLLMAGFIIMAISLTAG-ASEQGYIGGQYWHDPGAFGGDRAIDRFKGICSVWVQ 272

Query: 292 AYFSFGGIELFVLSINEQSNPRKSTPVAAKRSVYRXXXXXXXXXXXXGFNVPHNNDQLMG 351
           A F++GG E   L+  EQ+NPR+S P A KR +YR            GF VPHN+DQL+ 
Sbjct: 273 AAFAYGGSEFIALTAAEQANPRESVPKATKRWLYRVVVVFLLPVILIGFLVPHNSDQLLS 332

Query: 352 S-GGSATHASPYVLAASIHKVRVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYA 410
           + GGS + ASP+V+AA++H VRV+PHIIN +IL SVISV NSA+Y+APR++ SLA+ G  
Sbjct: 333 AEGGSGSRASPFVIAAALHGVRVVPHIINFIILTSVISVGNSAMYSAPRILLSLAEHGMC 392

Query: 411 PKFLNYIDREGRPLRAXXXXXXXXXXXXXACSPQEEQAFTWLAAIAGLSELFTWSGIMLS 470
           PK   Y+DR+GRPL               A S QEE  FTWL+AIAGLS+LFTW+ I +S
Sbjct: 393 PKIFTYVDRQGRPLVTLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLFTWTAIAVS 452

Query: 471 HIRFRKAMKVQGRSLDEVGYKANTGIWGSYYGVFFNMLVFMAQFWVALSPIGNGGKCDAQ 530
           H+RFR+AM+VQGRSL E+GY+ANTG  GSYY +FFN++V +AQFW+A++PI   G+ D +
Sbjct: 453 HVRFRRAMRVQGRSLGELGYRANTGALGSYYAIFFNVIVLIAQFWIAIAPIPKHGELDVE 512

Query: 531 AFFESYLAAPLWIFMYVGYMVYKRDFTFLNPLDKIDLDFHRRVYDPEIMRQEDEENKERL 590
            FF++YLA P+ +  Y+GY ++KRDF  + P  ++DL  HR+++D E++ QE+ E KERL
Sbjct: 513 FFFQNYLAFPVLVVFYLGYKLWKRDFRLVIPSSEVDLLSHRQIFDEEVLLQEEAERKERL 572

Query: 591 KNSS 594
           +NS+
Sbjct: 573 RNST 576

>Kwal_33.13204
          Length = 607

 Score =  560 bits (1444), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/556 (48%), Positives = 374/556 (67%), Gaps = 4/556 (0%)

Query: 39  EIKEHSEESRNGLVHRFVDSFRRAES-QRLEEDNDLEDGTK-SMKSNNHLKKSMKSRHVV 96
           + K H ++S++    RF  +F RA+        ND+E G + + ++   LK+++  RHV 
Sbjct: 42  DYKFHEDDSKSRF-RRFARTFHRADGLGDGASGNDVEFGAEVARQTETKLKQTITFRHVF 100

Query: 97  MMSLGTGIGTGLLVANAKGLSLAGPGSLVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGNF 156
           MMSLGTGIGTG+LV N K L   GP  LVIGY ++    Y ++QAAGE+ V+Y +L GNF
Sbjct: 101 MMSLGTGIGTGMLVGNGKALHNGGPAGLVIGYAIMGSCLYCIIQAAGELAVSYSSLSGNF 160

Query: 157 NAYNSIFISKSFGFATTWLFCIQWLTVLPLELITSSMTVKYWNDTINADXXXXXXXXXXX 216
           NAY S+ I ++FGF+  W++C+QWL VLPLEL+T+S+T+KYW  ++N D           
Sbjct: 161 NAYPSMLIEQAFGFSVAWIYCLQWLCVLPLELVTASITIKYWTTSVNPDIFVAIFYVLII 220

Query: 217 XXXXXGVKAYGETEFIFNSCKILMVAGFIILSVVINCGGAGVDGYIGGKYWRDPGSFAEG 276
                G + Y E EF FN CK+LM+ GF IL +++NCGGAG DGYIGG+YW +PG+F   
Sbjct: 221 LVNMFGARGYAEAEFFFNCCKVLMIIGFFILGIIVNCGGAGNDGYIGGRYWNNPGAFYGT 280

Query: 277 SGATRFKGICYILVSAYFSFGGIELFVLSINEQSNPRKSTPVAAKRSVYRXXXXXXXXXX 336
                FKGI   +V+A F+FG  E   L+  EQ+NPR++ P AAK+ VYR          
Sbjct: 281 KPIHHFKGIISTMVTAAFAFGATEFIALTAAEQANPRRAIPSAAKKVVYRILLIFLAPIV 340

Query: 337 XXGFNVPHNNDQLMGSGGSATHASPYVLAASIHKVRVIPHIINAVILISVISVANSALYA 396
             GF VPHN+ +LMGSG SATHASPYV+A + H VRV+PH INAVIL+SV+SV NSA Y+
Sbjct: 341 LIGFLVPHNSPELMGSGSSATHASPYVIAVASHGVRVVPHFINAVILLSVLSVGNSAFYS 400

Query: 397 APRLMCSLAQQGYAPKFLNYIDREGRPLRAXXXXXXXXXXXXXACSPQEEQAFTWLAAIA 456
           + RL+ +LA Q YAP +L +IDR GRP+RA             A SP+EE  FTWL AI+
Sbjct: 401 SSRLLLALADQHYAPAWLKFIDRSGRPMRAMLVSCVFGLISFVAASPKEETVFTWLLAIS 460

Query: 457 GLSELFTWSGIMLSHIRFRKAMKVQGRSLDEVGYKANTGIWGSYYGVFFNMLVFMAQFWV 516
           GLS+LFTW  I +SHIRFRKA+ VQG+ + E+GYK+ TG+ GSYY  F    + + QFWV
Sbjct: 461 GLSQLFTWISICVSHIRFRKALIVQGKPIGELGYKSQTGVAGSYYATFIMGCILIGQFWV 520

Query: 517 ALSPIGNGGKCDAQAFFESYLAAPLWIFMYVGYMVYKRDFTFLNPLDKIDLDFHRRVYDP 576
           A++P+G+  K DA +FFE+YLA PL++ +Y G+ ++KRD+    PL++IDLD HR+ +D 
Sbjct: 521 AIAPMGS-AKLDANSFFENYLALPLFVVLYFGFKIWKRDWRLYIPLEQIDLDSHRKTFDE 579

Query: 577 EIMRQEDEENKERLKN 592
           E+++QED E +E ++N
Sbjct: 580 ELLKQEDAEYEENIRN 595

>Kwal_33.13215
          Length = 598

 Score =  555 bits (1429), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/579 (48%), Positives = 386/579 (66%), Gaps = 10/579 (1%)

Query: 21  DSALYNNFNTSTTASLTPEIKEHSEESRNGLVHRFVDSFRRAESQRLEEDNDLEDGT--- 77
           D+ +  +F++     +  E    S+   +GL  RF DSFRR E+      +  ++     
Sbjct: 13  DNGVVESFDS---VEVLKEESPRSDSRSDGLFRRFADSFRRHEAHNGGGGDGDDEDHEGL 69

Query: 78  ---KSMKSNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLSLAGPGSLVIGYVMVSFV 134
              +S   +  LK++++ RHV+M+SL TGIGTG+LV N K L   GP SLVIGY +VS +
Sbjct: 70  TPIESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSM 129

Query: 135 TYFMVQAAGEMGVTYPTLPGNFNAYNSIFISKSFGFATTWLFCIQWLTVLPLELITSSMT 194
            Y ++Q+A E+ + Y +L G FNAY S+ + K+FGF+ +W++C+QWL VLPLEL+T+SMT
Sbjct: 130 LYCVIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMT 189

Query: 195 VKYWNDTINADXXXXXXXXXXXXXXXXGVKAYGETEFIFNSCKILMVAGFIILSVVINCG 254
           +KYWN TIN D                G   Y E EF FN CK+LM+ GF IL ++INCG
Sbjct: 190 IKYWNQTINPDAFVTIFYVVLVAINFVGAAGYAEAEFFFNCCKVLMIIGFFILGIIINCG 249

Query: 255 GAGVDGYIGGKYWRDPGSFAEGSGATRFKGICYILVSAYFSFGGIELFVLSINEQSNPRK 314
           GAG DGY+G +YW DPG+F       RFKGI  +LV+A F++GG E  VL+  EQ NP+K
Sbjct: 250 GAGNDGYLGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQK 309

Query: 315 STPVAAKRSVYRXXXXXXXXXXXXGFNVPHNNDQLMGSGGSATHASPYVLAASIHKVRVI 374
           S   A+K+ VYR            GF VP N+D+L+GSGGSATHASP+V+A + H VRV+
Sbjct: 310 SIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVRVV 369

Query: 375 PHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPKFLNYIDREGRPLRAXXXXXXXX 434
           PH INAVIL+SV+SVANSALY++ R++ SL++QG+AP+FLNY+DR GRP+          
Sbjct: 370 PHFINAVILLSVLSVANSALYSSSRILLSLSEQGFAPRFLNYVDRCGRPVLCLLVSCVFG 429

Query: 435 XXXXXACSPQEEQAFTWLAAIAGLSELFTWSGIMLSHIRFRKAMKVQGRSLDEVGYKANT 494
                A SP+EE  FTWL AI+GLSELFTW  I LSH+R R+AM VQGRS DE+GY A T
Sbjct: 430 LLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWT 489

Query: 495 GIWGSYYGVFFNMLVFMAQFWVALSPIGNGGKCDAQAFFESYLAAPLWIFMYVGYMVYKR 554
           G+WG+YY +   + + + QFWVA+SP+G+  K DA  FFE+YLA P+ IF+Y+GY ++ R
Sbjct: 490 GVWGAYYAMAMIVAILVGQFWVAISPVGS-NKLDANNFFENYLAMPILIFLYLGYKIWTR 548

Query: 555 DFTFLNPLDKIDLDFHRRVYDPEIMRQEDEENKERLKNS 593
           D+  L P  ++DL  HR+++D E++R E  E KE+L+++
Sbjct: 549 DWRLLIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHA 587

>AGR040C [4350] [Homologous to ScYBR069C (TAT1) - SH]
           (782289..784010) [1722 bp, 573 aa]
          Length = 573

 Score =  552 bits (1422), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/572 (46%), Positives = 368/572 (64%), Gaps = 15/572 (2%)

Query: 22  SALYNNFNTSTTASLTPEIKEHSEESRNGLVHRFVDSFRRAESQRLEEDNDLEDGTKSMK 81
           S++ ++    +   ++P      +E R G++  F+DSFRR     L    D EDGT +  
Sbjct: 6   SSISSSKKDESYVKVSPNTVGSGDERRTGIMRGFIDSFRRGRDVDLMCKADAEDGTTA-- 63

Query: 82  SNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLSLAGPGSLVIGYVMVSFVTYFMVQA 141
               +KK++K+RH++M++LGTGIGTGLLV N   L+ AGP  L++GYV+ S + Y +V+A
Sbjct: 64  ---KMKKTIKTRHLLMITLGTGIGTGLLVGNGSALAKAGPAGLILGYVVSSAMLYLIVEA 120

Query: 142 AGEMGVTYPTLPGNFNAYNSIFISKSFGFATTWLFCIQWLTVLPLELITSSMTVKYWNDT 201
           AGE+G+ Y  + GN+ AY+S+ +  + GF+ +W++CIQW+TV PL+L+T++M ++YW D 
Sbjct: 121 AGELGICYSGMTGNYTAYSSLLVDPAMGFSVSWVYCIQWMTVFPLQLVTAAMIIQYWTD- 179

Query: 202 INADXXXXXXXXXXXXXXXXGVKAYGETEFIFNSCKILMVAGFIILSVVINCGGAGVDGY 261
           IN D                G K Y E EF FN CK+LM+ GF+IL VVINCGGAG  GY
Sbjct: 180 INPDIFVAIIYAVIVFINLFGAKGYAEAEFFFNLCKVLMIIGFVILGVVINCGGAGTSGY 239

Query: 262 IGGKYWRDPGSFAEGSGATRFKGICYILVSAYFSFGGIELFVLSINEQSNPRKSTPVAAK 321
           IG KYW +P  F  G     FKG+C++   A F++GGIE+ VLS +EQ NPRKS   A K
Sbjct: 240 IGDKYWHEPRPFMNG-----FKGLCFVFCYAAFAYGGIEVMVLSASEQENPRKSISSACK 294

Query: 322 RSVYRXXXXXXXXXXXXGFNVPHNNDQLMGSGGSATHASPYVLAASIHKVRVIPHIINAV 381
           + +YR             F VP ++  L   G   + ASP V+A S H V+++PHIINAV
Sbjct: 295 KVIYRIVLIYLLTTVIVCFLVPADHPSLASEG---SRASPLVIAVSFHGVKIVPHIINAV 351

Query: 382 ILISVISVANSALYAAPRLMCSLAQQGYAPKFLNYIDREGRPLRAXXXXXXXXXXXXXAC 441
           ILI+V+SV NS+LY+APRL+ SLA+QGYAPK   YIDR+GRPL A             A 
Sbjct: 352 ILIAVVSVGNSSLYSAPRLLLSLAEQGYAPKIFTYIDRQGRPLPAFFVAMVFGLLAFLAA 411

Query: 442 SPQEEQAFTWLAAIAGLSELFTWSGIMLSHIRFRKAMKVQGRSLDEVGYKANTGIWGSYY 501
           SP ++  F WL AI+GLS++F W  I +SHIRFR AMK QGRS+ EVGYKA TG WGS+ 
Sbjct: 412 SPAQDDVFGWLLAISGLSQMFIWMSICISHIRFRDAMKAQGRSMGEVGYKARTGYWGSWI 471

Query: 502 GVFFNMLVFMAQFWVALSPIGNGGKCDAQAFFESYLAAPLWIFMYVGYMVYKRDFTFLNP 561
            V    L+ +AQFWVA+SP+   G  DA++FF+SYLA P+ +  Y GY +Y +D+    P
Sbjct: 472 AVVTAFLILIAQFWVAISPVETKG-VDARSFFQSYLAFPILLLAYFGYKIYHKDWRICIP 530

Query: 562 LDKIDLDFHRRVYDPEIMRQEDEENKERLKNS 593
             ++DL  HR+V+D + ++QED E K +LK+S
Sbjct: 531 ASEVDLISHRQVFDEDELKQEDLEWKLKLKSS 562

>YCL025C (AGP1) [519] chr3 complement(76131..77918) Broad substrate
           range amino acid permease with high affinity for
           asparagine and glutamine [1788 bp, 595 aa]
          Length = 595

 Score =  545 bits (1404), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 263/538 (48%), Positives = 349/538 (64%), Gaps = 27/538 (5%)

Query: 45  EESRNGLVHRFVDSFRRA-------------------------ESQRLEEDNDLED-GTK 78
           E+     V RF DSF+RA                         ++Q LE++   ++ G  
Sbjct: 49  EQHNTSAVRRFFDSFKRADQGPQDEVEATQMNDLTSAISPSSRQAQELEKNESSDNIGAN 108

Query: 79  SMKSNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLSLAGPGSLVIGYVMVSFVTYFM 138
           +   ++ LKK+++ RHV+M++LGTGIGTGLLV N   L  AGP  L+IGY ++  + Y +
Sbjct: 109 TGHKSDSLKKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYAIMGSILYCI 168

Query: 139 VQAAGEMGVTYPTLPGNFNAYNSIFISKSFGFATTWLFCIQWLTVLPLELITSSMTVKYW 198
           +QA GEM + Y  L G +NAY S  +   FGFA  W++C+QWL V PLEL+T+SMT+KYW
Sbjct: 169 IQACGEMALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYW 228

Query: 199 NDTINADXXXXXXXXXXXXXXXXGVKAYGETEFIFNSCKILMVAGFIILSVVINCGGAGV 258
             ++N D                G + Y E EF FN CKILM+ GF IL ++I+ GGAG 
Sbjct: 229 TTSVNPDVFVIIFYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFILGIIIDVGGAGN 288

Query: 259 DGYIGGKYWRDPGSFAEGSGATRFKGICYILVSAYFSFGGIELFVLSINEQSNPRKSTPV 318
           DG+IGGKYW DPG+F       RFKG+   LV+A F+FGG E   ++  EQSNPRK+ P 
Sbjct: 289 DGFIGGKYWHDPGAFNGKHAIDRFKGVAATLVTAAFAFGGSEFIAITTAEQSNPRKAIPG 348

Query: 319 AAKRSVYRXXXXXXXXXXXXGFNVPHNNDQLMGSGGSATHASPYVLAASIHKVRVIPHII 378
           AAK+ +YR            GF VP+N+DQL+GS G  T ASPYV+A + H VRV+PH I
Sbjct: 349 AAKQMIYRILFLFLATIILLGFLVPYNSDQLLGSTGGGTKASPYVIAVASHGVRVVPHFI 408

Query: 379 NAVILISVISVANSALYAAPRLMCSLAQQGYAPKFLNYIDREGRPLRAXXXXXXXXXXXX 438
           NAVIL+SV+S+ANS+ Y++ RL  +L++QGYAPK  +YIDR GRPL A            
Sbjct: 409 NAVILLSVLSMANSSFYSSARLFLTLSEQGYAPKVFSYIDRAGRPLIAMGVSALFAVIAF 468

Query: 439 XACSPQEEQAFTWLAAIAGLSELFTWSGIMLSHIRFRKAMKVQGRSLDEVGYKANTGIWG 498
            A SP+EEQ FTWL AI+GLS+LFTW+ I LSH+RFR+AMKVQGRSL E+G+K+ TG+WG
Sbjct: 469 CAASPKEEQVFTWLLAISGLSQLFTWTAICLSHLRFRRAMKVQGRSLGELGFKSQTGVWG 528

Query: 499 SYYGVFFNMLVFMAQFWVALSPIGNGGKCDAQAFFESYLAAPLWIFMYVGYMVYKRDF 556
           S Y     +L+ +AQFWVA++PIG  GK DAQAFFE+YLA P+ I +YVGY V+ +D+
Sbjct: 529 SAYACIMMILILIAQFWVAIAPIGE-GKLDAQAFFENYLAMPILIALYVGYKVWHKDW 585

>KLLA0C01606g complement(123485..125347) similar to sp|P48813
           Saccharomyces cerevisiae YDR508c GNP1 high-affinity
           glutamine permease, start by similarity
          Length = 620

 Score =  542 bits (1397), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/553 (47%), Positives = 372/553 (67%), Gaps = 5/553 (0%)

Query: 47  SRNGLVHRFVDSFRRAE--SQRLEEDNDLE-DGTKSM--KSNNHLKKSMKSRHVVMMSLG 101
           +++ + HRF DSF+RA+  +  +  + +LE + ++S+  +    LK+ +K RHVVMMSL 
Sbjct: 58  AKSSVWHRFKDSFKRADHINTNIHGNAELELNPSQSLLPEKGASLKRDIKPRHVVMMSLA 117

Query: 102 TGIGTGLLVANAKGLSLAGPGSLVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNS 161
           TGIGTGLLV N K L+  GP  L IGY ++    Y ++QAAGE+ V YPTL GNFN Y S
Sbjct: 118 TGIGTGLLVGNGKALATGGPAGLTIGYAIMGSCLYSIIQAAGELAVAYPTLTGNFNNYPS 177

Query: 162 IFISKSFGFATTWLFCIQWLTVLPLELITSSMTVKYWNDTINADXXXXXXXXXXXXXXXX 221
             +  +  FAT  L+CIQWL V PLE+I++++T+KYWN +IN +                
Sbjct: 178 FLVDPAMCFATAALYCIQWLCVFPLEVISAAITIKYWNTSINPNVWCVIFYVMIIGINMC 237

Query: 222 GVKAYGETEFIFNSCKILMVAGFIILSVVINCGGAGVDGYIGGKYWRDPGSFAEGSGATR 281
           G   Y E +F FN+CKILM AGF IL ++INCGGAG   YIGGKYW DPG+F   +G +R
Sbjct: 238 GSAGYAEADFFFNTCKILMFAGFFILGIIINCGGAGDSVYIGGKYWNDPGAFNGDTGISR 297

Query: 282 FKGICYILVSAYFSFGGIELFVLSINEQSNPRKSTPVAAKRSVYRXXXXXXXXXXXXGFN 341
           FK I   LV+A F+FG  E   L+ +EQ+NPRK+ P AAK+ +YR            GF 
Sbjct: 298 FKAIVSTLVTAAFAFGASEAVALTASEQANPRKAIPSAAKQVLYRIIAIYLASIILVGFL 357

Query: 342 VPHNNDQLMGSGGSATHASPYVLAASIHKVRVIPHIINAVILISVISVANSALYAAPRLM 401
           VP+N+ +LMGSG S+ H+SPYV+A + H V+V+P  INAVILISV+SV N + Y++ R++
Sbjct: 358 VPYNSPELMGSGSSSVHSSPYVIAVASHGVKVVPSFINAVILISVLSVGNFSFYSSSRIL 417

Query: 402 CSLAQQGYAPKFLNYIDREGRPLRAXXXXXXXXXXXXXACSPQEEQAFTWLAAIAGLSEL 461
             L++ GYAPKF  Y+DR+GRPL A             + S  EE  FTWL A++GLS+L
Sbjct: 418 LCLSEIGYAPKFFQYVDRQGRPLYAMIVGALVGCICFVSASSAEESVFTWLMAVSGLSQL 477

Query: 462 FTWSGIMLSHIRFRKAMKVQGRSLDEVGYKANTGIWGSYYGVFFNMLVFMAQFWVALSPI 521
           FTW+ I +SH+RFRKAM+VQ RS+ E+G+++  G+WGSYYG+F  +LVF+ QFWVAL P+
Sbjct: 478 FTWTNICISHVRFRKAMQVQNRSIGELGFRSQVGVWGSYYGIFMMILVFIGQFWVALFPV 537

Query: 522 GNGGKCDAQAFFESYLAAPLWIFMYVGYMVYKRDFTFLNPLDKIDLDFHRRVYDPEIMRQ 581
           G     DA+ FF +YLA P+++ +Y G+ ++K+D+    P  +IDL  HR+++D EI++Q
Sbjct: 538 GGTDGADAENFFANYLAMPVFLALYFGFKIWKKDWRLYIPASEIDLISHRKIFDEEILKQ 597

Query: 582 EDEENKERLKNSS 594
           EDEE K ++K++S
Sbjct: 598 EDEEYKIKMKHAS 610

>Scas_517.2
          Length = 679

 Score =  531 bits (1369), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/583 (46%), Positives = 361/583 (61%), Gaps = 31/583 (5%)

Query: 39  EIKEHSEESRNGLVHRFVDSFRRAESQRLEEDN-------DLE-------DGTKSMKSNN 84
           + +EH+  ++   +  F+DSF+RAE      +N       DLE       DGT     ++
Sbjct: 87  DFEEHT--TKPSRIRNFMDSFKRAEQHPTNVNNNGANSESDLENMILYNEDGTPKPLPHH 144

Query: 85  H------------LKKSMKSRHVVMMSLGTGIGTGLLVANAKGLSLAGPGSLVIGYVMVS 132
           H            LKK++K RHV+M+SLGTGIGTGLLV     L  AGP  L+IG+ ++ 
Sbjct: 145 HDAQINDNSKSDELKKTIKPRHVLMISLGTGIGTGLLVGLGSSLVQAGPAGLIIGFGIMG 204

Query: 133 FVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFISKSFGFATTWLFCIQWLTVLPLELITSS 192
              Y ++QA GE+ V Y  L G FNAY S  + ++F FA  WL+ IQWL V PLEL+T+S
Sbjct: 205 SCLYCIIQAVGELAVAYSDLVGGFNAYPSFLVDEAFCFAVAWLYAIQWLCVCPLELVTAS 264

Query: 193 MTVKYWNDTINADXXXXXXXXXXXXXXXXGVKA-YGETEFIFNSCKILMVAGFIILSVVI 251
           MT+KYW   ++ D                G  A Y E EFIFNSCKI+M+ GF IL + +
Sbjct: 265 MTIKYWTTKVDPDIFVIIFYILIIGINLLGGAAGYAEAEFIFNSCKIMMMIGFFILGITV 324

Query: 252 NCGGAGVDGYIGGKYWRDPGSFAEGSGATRFKGICYILVSAYFSFGGIELFVLSINEQSN 311
            CGGAG DGYIG KYW DPG+    +   RFKG    LV+A F+FG  E   ++ +EQSN
Sbjct: 325 ICGGAGTDGYIGAKYWHDPGALRGDTSIQRFKGCMATLVNAAFAFGMSEFIGVTASEQSN 384

Query: 312 PRKSTPVAAKRSVYRXXXXXXXXXXXXGFNVPHNNDQLMGSGGSATHASPYVLAASIHKV 371
           PRK+ P AAK+ +YR            GF VP+N+DQL+GS GS   ASPYVLA S H V
Sbjct: 385 PRKAIPSAAKKMIYRILCMFLSSITIVGFLVPYNSDQLLGSTGSGVKASPYVLAISTHGV 444

Query: 372 RVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPKFLNYIDREGRPLRAXXXXX 431
           RV+PH INAVILISV+SVANSA Y++ R++ SLA+QGYAPK  +YIDREGRPL       
Sbjct: 445 RVVPHFINAVILISVLSVANSAYYSSSRMLLSLAEQGYAPKIYSYIDREGRPLVGMATAA 504

Query: 432 XXXXXXXXACSPQEEQAFTWLAAIAGLSELFTWSGIMLSHIRFRKAMKVQGRSLDEVGYK 491
                   A SP+E++ F WL AI+GLS+LFTW  I +SHIRFR+AM VQGRS+ E+G++
Sbjct: 505 IFGVIAFCATSPKEDEVFVWLLAISGLSQLFTWMAICISHIRFRRAMHVQGRSIGELGFR 564

Query: 492 ANTGIWGSYYGVFFNMLVFMAQFWVALSPIGNGG--KCDAQAFFESYLAAPLWIFMYVGY 549
           +  G +GS Y      ++ +AQFWVAL PI      K DA+ FFE+YLA P+ +  Y GY
Sbjct: 565 SQVGWYGSAYAAIMMFMILIAQFWVALVPINADLTIKLDAKNFFENYLAMPILLAFYFGY 624

Query: 550 MVYKRDFTFLNPLDKIDLDFHRRVYDPEIMRQEDEENKERLKN 592
            ++K+D+        IDL  HR ++D E+++QE++E +ERL+ 
Sbjct: 625 KIWKKDWKLFIRAKNIDLISHRNIFDEELIKQEEDEYRERLRT 667

>AFR698C [3891] [Homologous to ScYDR508C (GNP1) - SH; ScYCL025C
           (AGP1) - SH] (1725946..1727775) [1830 bp, 609 aa]
          Length = 609

 Score =  516 bits (1330), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 255/543 (46%), Positives = 344/543 (63%), Gaps = 6/543 (1%)

Query: 54  RFVDSFRRAESQRLEEDNDLEDGTKSMKSNNHLKKSMKSRHVVMMSLGTGIGTGLLVANA 113
           RF+ SF+RA      +        ++ K  N LK+++KSRH++M+SLGTGIGTGLLV + 
Sbjct: 61  RFLSSFKRAHGSGGTDTEGGG--GQNAKHEN-LKQTIKSRHMIMISLGTGIGTGLLVGSG 117

Query: 114 KGLSLAGPGSLVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFISKSFGFATT 173
             L   GP    IG++++    Y ++QAAGE+ V Y +L G FNAY S  I  + GFAT 
Sbjct: 118 TALHDGGPAGSAIGFLIMGLCVYCVIQAAGELAVCYTSLAGGFNAYPSFLIDPALGFATA 177

Query: 174 WLFCIQWLTVLPLELITSSMTVKYW--NDTINADXXXXXXXXXXXXXXXXGVKAYGETEF 231
           W++C+QWL V PLEL+T+S+T+K+W  + ++N D                G + Y E EF
Sbjct: 178 WVYCLQWLCVFPLELVTASITIKFWPGSRSVNPDIYVAIFYVLIIVINFFGARGYAEAEF 237

Query: 232 IFNSCKILMVAGFIILSVVINCGGAGVDGYIGGKYWRDPGSFAEGSGATRFKGICYILVS 291
            FNSCK+LM+ GF I+ ++IN G  G  GYIGGKYWRDPGS    +    FKGI   LV+
Sbjct: 238 FFNSCKVLMMIGFFIVGILINTGAVGTSGYIGGKYWRDPGSLGGRTHFDHFKGIVATLVN 297

Query: 292 AYFSFGGIELFVLSINEQSNPRKSTPVAAKRSVYRXXXXXXXXXXXXGFNVPHNNDQLMG 351
           A FS G  E   L+  EQ+NPRKS P AAK+ +Y+            GF VP ++ +LMG
Sbjct: 298 AAFSLGCSEFVALTAAEQANPRKSIPAAAKKMIYKIFVVFLGSVILIGFLVPKDSHELMG 357

Query: 352 SGGSATHASPYVLAASIHKVRVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAP 411
           S  S  H SPYV+A  +H V V+P  INAVIL+SV+SV NSA Y++ RL+ SLA+Q YAP
Sbjct: 358 SNDSDLHVSPYVIAVRMHGVNVVPSFINAVILLSVLSVGNSAFYSSSRLLHSLAEQNYAP 417

Query: 412 KFLNYIDREGRPLRAXXXXXXXXXXXXXACSPQEEQAFTWLAAIAGLSELFTWSGIMLSH 471
           K   YIDR GRPL A             A SP+EE+ F WL AI+GLS+LFTWS I LSH
Sbjct: 418 KIFKYIDRAGRPLMAMIISILFGTICFVAASPKEEEVFKWLLAISGLSQLFTWSTICLSH 477

Query: 472 IRFRKAMKVQGRSLDEVGYKANTGIWGSYYGVFFNMLVFMAQFWVALSPIGNGGKCDAQA 531
           IRFR+A+ VQG S DE+G+KA TGI GSY      +L  + QFWV+L P+G   + DA++
Sbjct: 478 IRFRRALAVQGYSTDELGFKAQTGIIGSYVSAIMMVLALIGQFWVSLVPMG-ATEPDAES 536

Query: 532 FFESYLAAPLWIFMYVGYMVYKRDFTFLNPLDKIDLDFHRRVYDPEIMRQEDEENKERLK 591
           FF  YLA P+++  Y GY ++ +D+      D+IDL  HRR++D ++++QED E + +L+
Sbjct: 537 FFTGYLAMPMFLLFYFGYKIWNKDWRLFIRADQIDLVSHRRIFDADVLKQEDIEYRAKLR 596

Query: 592 NSS 594
           NSS
Sbjct: 597 NSS 599

>YBR069C (TAT1) [259] chr2 complement(376534..378393) Amino acid
           permease that transports valine, leucine, isoleucine,
           tyrosine, tryptophan, and threonine, member of the amino
           acid-polyamine-choline (APC) family of membrane
           transporters [1860 bp, 619 aa]
          Length = 619

 Score =  513 bits (1322), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 262/541 (48%), Positives = 349/541 (64%), Gaps = 15/541 (2%)

Query: 54  RFVDSFRRAESQRLEEDNDLEDGTKSMKSNNHLKKSMKSRHVVMMSLGTGIGTGLLVANA 113
            F DSF+R      + +++LE   K     N+L KS+KSRH+VM+SLGTGIGTGLLV N 
Sbjct: 65  EFFDSFKRQLPP--DRNSELESQEK-----NNLTKSIKSRHLVMISLGTGIGTGLLVGNG 117

Query: 114 KGLSLAGPGSLVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFISKSFGFATT 173
           + L  AGP  LV+GY + S + Y ++QAAGE+G+ Y  L GN+  Y SI +  S GFA +
Sbjct: 118 QVLGTAGPAGLVLGYGIASIMLYCIIQAAGELGLCYAGLTGNYTRYPSILVDPSLGFAVS 177

Query: 174 WLFCIQWLTVLPLELITSSMTVKYWNDTINADXXXXXXXXXXXXXXXXGVKAYGETEFIF 233
            ++ IQWLTVLPL+L+T++MTVKYW  ++NAD                G + Y E EFIF
Sbjct: 178 VVYTIQWLTVLPLQLVTAAMTVKYWT-SVNADIFVAVVFVFVIIINLFGSRGYAEAEFIF 236

Query: 234 NSCKILMVAGFIILSVVINCGGAGVDGYIGGKYWRDPGSFAEGSGATRFKGICYILVSAY 293
           NSCKILMV GF+IL+++INCGGAG   YIG +YW +PG FA G     FKG+C +   A 
Sbjct: 237 NSCKILMVIGFVILAIIINCGGAGDRRYIGAEYWHNPGPFAHG-----FKGVCTVFCYAA 291

Query: 294 FSFGGIELFVLSINEQSNPRKSTPVAAKRSVYRXXXXXXXXXXXXGFNVPHNNDQLMGSG 353
           FS+GGIE+ +LS  EQ NP KS P A K+ VYR             F VP+N+D+L+GS 
Sbjct: 292 FSYGGIEVLLLSAAEQENPTKSIPNACKKVVYRILLIYMLTTILVCFLVPYNSDELLGSS 351

Query: 354 GSATHAS-PYVLAASIHKVRVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPK 412
            S+   + P+V+A + H V+V+PH INAVILISVISVANS+LY+ PRL+ SLA+QG  PK
Sbjct: 352 DSSGSHASPFVIAVASHGVKVVPHFINAVILISVISVANSSLYSGPRLLLSLAEQGVLPK 411

Query: 413 FLNYIDREGRPLRAXXXXXXXXXXXXXACSPQEEQAFTWLAAIAGLSELFTWSGIMLSHI 472
            L Y+DR GRPL               A S  EEQ FTWL AI+ LS+LF W  + LSHI
Sbjct: 412 CLAYVDRNGRPLLCFFVSLVFGCIGFVATSDAEEQVFTWLLAISSLSQLFIWMSMSLSHI 471

Query: 473 RFRKAMKVQGRSLDEVGYKANTGIWGSYYGVFFNMLVFMAQFWVALSPIGNGGKCDAQAF 532
           RFR AM  QGRS++EVGYKA TG WGS+  V   +   + QFWVA++P+   GK + + F
Sbjct: 472 RFRDAMAKQGRSMNEVGYKAQTGYWGSWLAVLIAIFFLVCQFWVAIAPVNEHGKLNVKVF 531

Query: 533 FESYLAAPLWIFMYVGYMVYKRDFTFLNPLDKIDLDFHRRVY-DPEIMRQEDEENKERLK 591
           F++YLA P+ +F Y G+ +Y + ++F  P +KIDLD HR ++  P +   +  ++ + LK
Sbjct: 532 FQNYLAMPIVLFAYFGHKIYFKSWSFWIPAEKIDLDSHRNIFVSPSLTEIDKVDDNDDLK 591

Query: 592 N 592
            
Sbjct: 592 E 592

>Scas_718.41
          Length = 614

 Score =  474 bits (1221), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 261/574 (45%), Positives = 356/574 (62%), Gaps = 27/574 (4%)

Query: 3   DPIVTSSKME--KSAEFEVTDSALYNNFNTSTTASLTPEIKEHSEESRNGLVHRFVDSFR 60
           +P + S ++E  K  E EV++  + +   T +T          S+ +       F  SF+
Sbjct: 35  EPSMVSIEIESTKKREIEVSEKPIASADTTVST----------SKCNAKTYFQDFCHSFK 84

Query: 61  RAESQRLEEDNDLEDGTKSMKSNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLSLAG 120
           R +S   + D+D+E        +  L K++KSRH++M+SLGTGI TGLLV N + L+ AG
Sbjct: 85  RKDS---DLDSDVE------AQDTQLSKTIKSRHLLMISLGTGIATGLLVGNGQVLAKAG 135

Query: 121 PGSLVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFISKSFGFATTWLFCIQW 180
           P  L+IGY + S + Y ++ AAGE+G+ Y  L GNF  Y SI I  S GFA + L+ +QW
Sbjct: 136 PAGLIIGYTVSSIMIYCIIHAAGELGICYRGLVGNFTRYPSILIDPSLGFAISLLYTLQW 195

Query: 181 LTVLPLELITSSMTVKYWNDTINADXXXXXXXXXXXXXXXXGVKAYGETEFIFNSCKILM 240
           LTVLPL+L+T+++T+ +W D +N D                G + Y ETEF  N CKILM
Sbjct: 196 LTVLPLQLVTAAITISFWTD-VNPDIFVLCVFIVVIIVNLFGARGYAETEFFCNCCKILM 254

Query: 241 VAGFIILSVVINCGGAGVDGYIGGKYWRDPGSFAEGSGATRFKGICYILVSAYFSFGGIE 300
           + GFIILS+VI  GGAG DGYIG KYW  PG FA G     FKG+C +   A FS+GGIE
Sbjct: 255 ITGFIILSIVIITGGAGKDGYIGAKYWIHPGPFAHG-----FKGVCTVFTYAAFSYGGIE 309

Query: 301 LFVLSINEQSNPRKSTPVAAKRSVYRXXXXXXXXXXXXGFNVPHNNDQLMGSGGSATHAS 360
           + VLSI+EQ +P  + P A K+ VYR             F VP+++  L+GS  S +HAS
Sbjct: 310 VVVLSIDEQEDPVSAVPNACKKVVYRILLIYLLTTILVCFLVPYDSPNLLGSSHSGSHAS 369

Query: 361 PYVLAASIHKVRVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPKFLNYIDRE 420
           P+V+A   H V+V+PH INAVILISVISVANS+LY++ RL+ SL++QG  P++LN+ID  
Sbjct: 370 PFVIAIESHGVKVVPHFINAVILISVISVANSSLYSSSRLLLSLSEQGSLPQWLNFIDMN 429

Query: 421 GRPLRAXXXXXXXXXXXXXACSPQEEQAFTWLAAIAGLSELFTWSGIMLSHIRFRKAMKV 480
           GRP+R              A S + E  FTWL AI+GLS+LF W  + LSHIR R AMK 
Sbjct: 430 GRPIRCFIISILFGMIGFVAASDKREDVFTWLLAISGLSQLFIWMSMSLSHIRLRDAMKS 489

Query: 481 QGRSLDEVGYKANTGIWGSYYGVFFNMLVFMAQFWVALSPIGNGGKCDAQAFFESYLAAP 540
           QG+SLDE+GYKA TG WGS+  VF      + QFWVA++P+   G+ D   FF++YLA P
Sbjct: 490 QGKSLDEIGYKAQTGYWGSWLAVFIGFFSLVTQFWVAIAPVEKHGELDVVNFFQNYLAFP 549

Query: 541 LWIFMYVGYMVYKRDFTFLNPLDKIDLDFHRRVY 574
           + +  Y+G+ +Y +++    P DKIDLD HRR+Y
Sbjct: 550 IVLVAYLGHKIYYKNWRLWIPADKIDLDSHRRIY 583

>Sklu_2029.2 , Contig c2029 2095-3891
          Length = 598

 Score =  441 bits (1133), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 221/519 (42%), Positives = 314/519 (60%), Gaps = 11/519 (2%)

Query: 83  NNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLSLAGPGSLVIGYVMVSFVTYFMVQAA 142
           N  LK+S+K  HV M+++ TGIGTGLLV N K +S AG G  ++GY ++  +    +Q+ 
Sbjct: 67  NEKLKQSIKPYHVFMITMATGIGTGLLVGNGKSISDAGVGGTLVGYFIIGSMLVCCMQSV 126

Query: 143 GEMGVTYPTLPGNFNAYNSIFISKSFGFATTWLFCIQWLTVLPLELITSSMTVKYWNDTI 202
           GE+ V +P+L G FN+Y   F+  SFGF   WLFC+QW  VLPLEL+T+SMT+KYWN+++
Sbjct: 127 GELVVAFPSLAGGFNSYGKRFVDPSFGFTVAWLFCLQWQIVLPLELVTASMTIKYWNNSL 186

Query: 203 NADXXXXXXXXXXXXXXXXGVKAYGETEFIFNSCKILMVAGFIILSVVINCGGAGVDGYI 262
           N                  G + Y + EF+FN  K+LM+ GFIIL ++I+ G AG  GYI
Sbjct: 187 NPSIFVAIFYSLILGISFFGARGYADAEFLFNLSKVLMITGFIILGIIISFGAAGTSGYI 246

Query: 263 GGKYWRDPGSFAEGSGATRFKGICYILVSAYFSFGGIELFVLSINEQS--NPRKSTPVAA 320
           G KY + PG+F   +    FK IC  LV+A FS GG+E   LS  EQ+  N  KS   A 
Sbjct: 247 GIKYLKTPGAF---NTRNTFKSICSTLVNACFSCGGVEFLALSAAEQARGNISKSIKRAC 303

Query: 321 KRSVYRXXXXXXXXXXXXGFNVPHNNDQLMGSGGSATHASPYVLAASIHKVRVIPHIINA 380
            + + R            G  VP+N+ +LMGS     H+SPYV+A + H V+V+PH+INA
Sbjct: 304 GQVLVRMCVFYILSIFVIGLLVPYNSPELMGSSSEIIHSSPYVIAVASHGVKVVPHLINA 363

Query: 381 VILISVISVANSALYAAPRLMCSLAQQGYAPKFLNYIDREGRPLRAXXXXXXXXXXXXXA 440
           VILI+V+SVANSA+Y++ R + +LA+QG+AP +   +D +GRP R              A
Sbjct: 364 VILIAVVSVANSAMYSSSRTLHALAEQGFAPSYFAKLDSKGRPFRCLVVSGVFGLLSFIA 423

Query: 441 CSPQEEQAFTWLAAIAGLSELFTWSGIMLSHIRFRKAMKVQGRSLDEVGYKANTGIWGSY 500
               +E  F WL +I+GLS +FTW+ I ++H+RFR AMK Q  SL+E+G++A +GI+GSY
Sbjct: 424 EYKDQESVFVWLLSISGLSTIFTWTMICVAHLRFRAAMKDQNHSLEELGHRAWSGIYGSY 483

Query: 501 YGVFFNMLVFMAQFWVALSPIGNGGKCDAQAFFESYLAAPLWIFMYVGYMVYKRDFTFLN 560
           Y +  N L  + QFWV+L P+   G+ D   FF++Y+A P  + +YVG+ +Y R + F+ 
Sbjct: 484 YVIAINSLTLVVQFWVSLFPLDGDGRPDFVNFFQNYMAVPFALCLYVGHKIYTRSWQFII 543

Query: 561 PLDKIDLDFHRRVYDPE------IMRQEDEENKERLKNS 593
           P DKID+D  R +Y  E       M   D  N    K +
Sbjct: 544 PADKIDVDTSRDIYGVENRTGHIFMAHCDANNPNGFKET 582

>ADL272W [1469] [Homologous to ScYDR508C (GNP1) - NSH]
           complement(227416..229110) [1695 bp, 564 aa]
          Length = 564

 Score =  430 bits (1106), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 217/526 (41%), Positives = 317/526 (60%), Gaps = 8/526 (1%)

Query: 68  EEDNDLEDGTKSMKSNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLSLAGPGSLVIG 127
           E+ +D E  +        L++S+K RHV M+S+ TGIGTGLLV N K ++ AG G  +IG
Sbjct: 7   EDCSDAEKLSSEGSEPASLRQSIKPRHVFMISMATGIGTGLLVGNGKSIATAGVGGTLIG 66

Query: 128 YVMVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFISKSFGFATTWLFCIQWLTVLPLE 187
           Y+++  +    +Q+ GE+ V +P+L G FN+Y   FI  S GF  +WLFC+QW+ VLPLE
Sbjct: 67  YLIIGVMVVCCMQSVGELVVAFPSLAGGFNSYGKKFIDPSLGFCVSWLFCLQWMVVLPLE 126

Query: 188 LITSSMTVKYWNDTINADXXXXXXXXXXXXXXXXGVKAYGETEFIFNSCKILMVAGFIIL 247
           L+T+SMT+KYWN  ++                  G   Y E EFIFN  K++++A FI+L
Sbjct: 127 LVTASMTIKYWNSNLSPSLFVSAFYILICIVNFFGSGGYAEAEFIFNCVKVMVLASFIVL 186

Query: 248 SVVINCGGAGVDGYIGGKYWRDPGSFAEGSGATRFKGICYILVSAYFSFGGIELFVLSIN 307
            +VI  GG G  G IG +Y + PG+F   +    FK     LV+A FS GG+E   LS  
Sbjct: 187 GIVIITGGLGNSGPIGFQYLKTPGAF--NTNYNVFKATAGTLVNAAFSCGGVEFLALSAA 244

Query: 308 EQS--NPRKSTPVAAKRSVYRXXXXXXXXXXXXGFNVPHNNDQLMGSGGSATHASPYVLA 365
           EQ+  N  KS   A ++   R            G  VP+++  LMGSG   TH SPYV A
Sbjct: 245 EQNRDNMPKSIRRACRQVSIRMFVFYLLSISVVGLLVPYDSPMLMGSGSDTTHTSPYVAA 304

Query: 366 ASIHKVRVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPKFLNYIDREGRPLR 425
            ++H VR++PHIINAVILI+V+SVANSA+Y++ R + SLA+Q +AP++   +++ G+P+R
Sbjct: 305 IALHGVRIVPHIINAVILIAVVSVANSAMYSSSRTLHSLAEQNFAPRYFALLNKHGQPMR 364

Query: 426 AXXXXXXXXXXXXXACSPQEEQAFTWLAAIAGLSELFTWSGIMLSHIRFRKAMKVQGRSL 485
                         A    +E  F WL +I+GLS +FTW+ I ++HIRFR A+K+QG+SL
Sbjct: 365 CLVVSAIVGLISFIAEYRDQEAVFVWLLSISGLSTIFTWTTICIAHIRFRNALKLQGQSL 424

Query: 486 DEVGYKANTGIWGSYYGVFFNMLVFMAQFWVALSPIGNGGKCDAQAFFESYLAAPLWIFM 545
           D +GY++NTG+ GSY     N++V + QFWV+L P+ N GK DA  FF++Y+A P+ + +
Sbjct: 425 DTLGYRSNTGVIGSYIATAINVVVIIVQFWVSLFPLENNGKPDAVKFFQNYMAVPVAVLL 484

Query: 546 YVGYMVYKRDFTFLNPLDKIDLDFHRRVYDPEIMRQEDEENKERLK 591
           Y+G+ +Y  D+T       +D++  R VY P     +D   K  +K
Sbjct: 485 YLGHKLYTNDWTPWIRTHCVDINTDRDVYAPS----DDLSTKGVVK 526

>Sklu_2390.1 YGR191W, Contig c2390 5453-7270 reverse complement
          Length = 605

 Score =  428 bits (1100), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 212/521 (40%), Positives = 319/521 (61%), Gaps = 3/521 (0%)

Query: 71  NDLEDGTKSMKSNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLSLAGPGSLVIGYVM 130
           +D E+      +++ L K +  RH++ +++G  IGTGL V +   L+  GP SL++ +V+
Sbjct: 73  SDFENNVYDTANDSKLNKDLSVRHLLTLAVGGAIGTGLFVNSGASLNTGGPASLIVAWVI 132

Query: 131 VSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFISKSFGFATTWLFCIQWLTVLPLELIT 190
           VS   + +V A GE+   +P + G FN Y + F+  SFGFA    +  QW  +LPLEL+ 
Sbjct: 133 VSTCLFTIVNALGELAAVFPVV-GGFNVYITRFVEPSFGFAVNINYLAQWAVLLPLELVA 191

Query: 191 SSMTVKYWNDTINADXXXXXXXXXXXXXXXXGVKAYGETEFIFNSCKILMVAGFIILSVV 250
           +S+T++YWN+TIN+D                 VK++GETEF+ +  KIL + GF IL +V
Sbjct: 192 ASITIRYWNNTINSDAWVAIFYTAIFLANMLDVKSFGETEFVLSMIKILAIIGFTILGIV 251

Query: 251 INCGGAGVDGYIGGKYWRDPGSFAEGSGATRFKGICYILVSAYFSFGGIELFVLSINEQS 310
           + CGG     YIGG+YW DPG+F   +   RFKG+C + V+A FS+ G EL  +S  E  
Sbjct: 252 LACGGGPSGEYIGGRYWNDPGAFVGDTPGRRFKGVCAVFVTAAFSYSGTELVAVSAAESH 311

Query: 311 NPRKSTPVAAKRSVYRXXXXXXXXXXXXGFNVPHNNDQLM-GSGGSATHASPYVLAASIH 369
           NPR + P A+KR+ +             G  VP+N+++L+ G+      ASP V+A    
Sbjct: 312 NPRVTLPKASKRTFWLITLCYITVLTIIGCLVPYNDERLLNGNSSVDAAASPLVIAIENG 371

Query: 370 KVRVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPKFLNYIDREGRPLRAXXX 429
            ++ +P ++NA+ILI+++SVANSA+YA  R M ++A+ G  PK LNYID+ GRPL A   
Sbjct: 372 GIKGLPSLMNAIILIAILSVANSAVYACSRCMVAMAEIGNLPKRLNYIDKRGRPLYAIFA 431

Query: 430 XXXXXXXXXXACSPQEEQAFTWLAAIAGLSELFTWSGIMLSHIRFRKAMKVQGRSLDEVG 489
                     A S ++E+ FTWL+A++GLS LF W  I LSHIRFR+AMK Q RSL+E+ 
Sbjct: 432 TLIFGLLSFIAASDKQEEVFTWLSALSGLSTLFCWFSINLSHIRFRQAMKAQDRSLNELP 491

Query: 490 YKANTGIWGSYYGVFFNMLVFMAQFWVALSPIGNGGKCDAQAFFESYLAAPLWIFMYVGY 549
           + + TG++GS+YG     LV +A FW +L P+G+ G  DA++FFE YL+ P++I  Y+G+
Sbjct: 492 FVSITGVYGSWYGCIVIFLVLIASFWTSLFPVGSDG-ADAESFFEGYLSLPIFIVCYLGH 550

Query: 550 MVYKRDFTFLNPLDKIDLDFHRRVYDPEIMRQEDEENKERL 590
            VYK+D+        +DLD  RR  D +I++QE    +E++
Sbjct: 551 KVYKKDWRLYVKTKDMDLDTGRREIDLDILKQEIRLEREQM 591

>YKR039W (GAP1) [3292] chr11 (514705..516513) General amino acid
           permease, proton symport transporter for all
           naturally-occurring L-amino acids, 4-aminobutyric acid
           (GABA), ornithine, citrulline, some D-amino acids, and
           some toxic analogs [1809 bp, 602 aa]
          Length = 602

 Score =  426 bits (1095), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 227/538 (42%), Positives = 333/538 (61%), Gaps = 8/538 (1%)

Query: 53  HRFVDSFRRAESQRLEEDNDLEDGTKS--MKSNNHLKKSMKSRHVVMMSLGTGIGTGLLV 110
             F DSF+R +   +E D +L +  K   + +   LK  +K+RH+ M+++G  IGTGLLV
Sbjct: 53  QDFKDSFKRVKP--IEVDPNLSEAEKVAIITAQTPLKHHLKNRHLQMIAIGGAIGTGLLV 110

Query: 111 ANAKGLSLAGPGSLVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFISKSFGF 170
            +   L   GP SL+IG+     + Y MV A GE+ V +P + G F  Y + FI +SFG+
Sbjct: 111 GSGTALRTGGPASLLIGWGSTGTMIYAMVMALGELAVIFP-ISGGFTTYATRFIDESFGY 169

Query: 171 ATTWLFCIQWLTVLPLELITSSMTVKYW-NDTINADXXXXXXXXXXXXXXXXGVKAYGET 229
           A  + + +QWL VLPLE++++S+TV +W  D    D                GVK YGE 
Sbjct: 170 ANNFNYMLQWLVVLPLEIVSASITVNFWGTDPKYRDGFVALFWLAIVIINMFGVKGYGEA 229

Query: 230 EFIFNSCKILMVAGFIILSVVINCGGAGVDGYIGGKYWRDPGSFAEGSGATRFKGICYIL 289
           EF+F+  K++ V GFIIL +++NCGG    GYIGGKYW DPG+FA  +   +FKG+C + 
Sbjct: 230 EFVFSFIKVITVVGFIILGIILNCGGGPTGGYIGGKYWHDPGAFAGDTPGAKFKGVCSVF 289

Query: 290 VSAYFSFGGIELFVLSINEQSNPRKSTPVAAKRSVYRXXXXXXXXXXXXGFNVPHNNDQL 349
           V+A FSF G EL  L+ +E   PRKS P AAK+  +R            G  VP+N+  L
Sbjct: 290 VTAAFSFAGSELVGLAASESVEPRKSVPKAAKQVFWRITLFYILSLLMIGLLVPYNDKSL 349

Query: 350 MGSGGSATHASPYVLAASIHKVRVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGY 409
           +G+      ASP+V+A   H ++ +P ++N VILI+V+SV NSA+YA  R M +LA+Q +
Sbjct: 350 IGASSVDAAASPFVIAIKTHGIKGLPSVVNVVILIAVLSVGNSAIYACSRTMVALAEQRF 409

Query: 410 APKFLNYIDREGRPLRAXXXXXXXXXXXXXACSPQEEQAFTWLAAIAGLSELFTWSGIML 469
            P+  +Y+DR+GRPL               A S +E + F WL A++GLS LFTW GI +
Sbjct: 410 LPEIFSYVDRKGRPLVGIAVTSAFGLIAFVAASKKEGEVFNWLLALSGLSSLFTWGGICI 469

Query: 470 SHIRFRKAMKVQGRSLDEVGYKANTGIWGSYYGVFFNMLVFMAQFWVALSPIGNGGKCDA 529
            HIRFRKA+  QGR LDE+ +K+ TG+WGSY+G+F  +++F+AQF+VA+ P+G+     A
Sbjct: 470 CHIRFRKALAAQGRGLDELSFKSPTGVWGSYWGLFMVIIMFIAQFYVAVFPVGD--SPSA 527

Query: 530 QAFFESYLAAPLWIFMYVGYMVYKRDFTFLNPLDKIDLDFHRRVYDPEIMRQEDEENK 587
           + FFE+YL+ PL + MY+G+ +YKR++    P +K+D+D  RR  D ++++QE  E K
Sbjct: 528 EGFFEAYLSFPLVMVMYIGHKIYKRNWKLFIPAEKMDIDTGRREVDLDLLKQEIAEEK 585

>KLLA0A06886g complement(621646..623409) similar to sp|P19145
           Saccharomyces cerevisiae YKR039w GAP1 general amino acid
           permease, start by similarity
          Length = 587

 Score =  417 bits (1073), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 233/538 (43%), Positives = 324/538 (60%), Gaps = 13/538 (2%)

Query: 53  HRFVDSFRRAESQRLEEDNDLEDGTKS--MKSNNHLKKSMKSRHVVMMSLGTGIGTGLLV 110
            RF DSF+RA++Q L  D +L D  K   + +N  LK+++KSRH+ M+++G  IGTGL V
Sbjct: 43  ERFRDSFKRADTQDL--DPNLTDAEKMAILTANAPLKRTLKSRHLQMIAIGGAIGTGLFV 100

Query: 111 ANAKGLSLAGPGSLVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFISKSFGF 170
            + K L+ AGP  ++IG+ +   + Y MV A GE+ VT+P + G F  Y S F+ +SFGF
Sbjct: 101 GSGKALATAGPAGILIGWALTGTMIYCMVMAMGELAVTFP-IAGGFTTYASRFVDESFGF 159

Query: 171 ATTWLFCIQWLTVLPLELITSSMTVKYWNDTIN-ADXXXXXXXXXXXXXXXXGVKAYGET 229
           A   ++ +QWL VLPLE++ +S+TV YW       D                GVK YGE 
Sbjct: 160 AFNTIYMLQWLVVLPLEIVAASITVNYWGTPDKYRDGFVALFYVVIVAINFFGVKGYGEA 219

Query: 230 EFIFNSCKILMVAGFIILSVVINCGGAGVDGYIGGKYWRDPGSFAEGSGATRFKGICYIL 289
           EFIF+  K++ V G+IIL V++ CGG    GYIGG+ W +PG+FA G     FKG+C + 
Sbjct: 220 EFIFSFIKVITVIGYIILGVILVCGGGPQGGYIGGRLWHNPGAFANG-----FKGVCSVF 274

Query: 290 VSAYFSFGGIELFVLSINEQSNPRKSTPVAAKRSVYRXXXXXXXXXXXXGFNVPHNNDQL 349
           V+A FSF G EL  L+  E +NPRKS P AAK+  +R            G  VP+ +D+L
Sbjct: 275 VTAAFSFAGSELVGLAAAETANPRKSLPSAAKQVFWRITLFYILALLMVGLLVPYTSDRL 334

Query: 350 MGSGGSATHASPYVLAASIHKVRVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGY 409
           +G       ASP+V++     ++ +P +IN VILI+V+SV NSA++A  R M +LA QG 
Sbjct: 335 IGQSSVDAAASPFVISIQNAGIKGLPSVINVVILIAVLSVGNSAVFACSRSMAALANQGS 394

Query: 410 APKFLNYIDREGRPLRAXXXXXXXXXXXXXACSPQEEQAFTWLAAIAGLSELFTWSGIML 469
            PK   YIDR GRPL               A SP+E + F WL A++GLS LFTW GIML
Sbjct: 395 LPKIFGYIDRTGRPLVGIIVTCVFGLLSFIAASPKEGEVFDWLLALSGLSSLFTWGGIML 454

Query: 470 SHIRFRKAMKVQGRSLDEVGYKANTGIWGSYYGVFFNMLVFMAQFWVALSPIGNGGKCDA 529
            HIR R+A+  Q R+  E+ + A TG+WGS YG    +L+ MAQFW+AL PIG+  K  A
Sbjct: 455 CHIRVRRALAAQNRTTAELSFTAPTGVWGSVYGFVLIILILMAQFWIALFPIGD--KPSA 512

Query: 530 QAFFESYLAAPLWIFMYVGYMVYKRDFTFLNPLDKIDLDFHRRVYDPEIMRQEDEENK 587
            AFFE+YL+ P+ I  Y+G+ ++K+++        ID+D  RR  D E ++QE  E K
Sbjct: 513 SAFFEAYLSFPILIAFYIGHKIWKKNWKLFIRAKNIDIDTGRRETDIEALKQEIAEEK 570

>Kwal_27.12681
          Length = 593

 Score =  416 bits (1070), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 220/539 (40%), Positives = 321/539 (59%), Gaps = 4/539 (0%)

Query: 55  FVDSFRRAESQRLEEDNDLEDGTKSMKSNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAK 114
           F D F+R E + L+ +    +    + + + L++ +K+RH+ M+++G  IGTGL V + K
Sbjct: 46  FKDGFKRVELEELDPNLTEAEKIAIITAQSPLQRHLKNRHLQMIAIGGAIGTGLFVGSGK 105

Query: 115 GLSLAGPGSLVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFISKSFGFATTW 174
            L   GP  ++IG+ ++  + Y +V + GE+ VT+P + G F  Y + F+ +SFGFA  +
Sbjct: 106 ALRTGGPAGVLIGWGLIGLMIYCVVMSMGELAVTFP-VSGGFTTYATRFVDESFGFAINY 164

Query: 175 LFCIQWLTVLPLELITSSMTVKYWNDTIN-ADXXXXXXXXXXXXXXXXGVKAYGETEFIF 233
            + +QWL VLPLE++ +S+TV +W       D                GV+ YGE EF+F
Sbjct: 165 NYMLQWLVVLPLEIVAASITVNFWGTPPKYRDGFVALFYIVIVIINFFGVRGYGEAEFVF 224

Query: 234 NSCKILMVAGFIILSVVINCGGAGVDGYIGGKYWRDPGSFAEGSGATRFKGICYILVSAY 293
           +  K++ V GFIIL +V+ CGG  V GYIGGKYW +PG+F+     +RFKG+C + V+A 
Sbjct: 225 SFIKVITVIGFIILGIVLVCGGGPVGGYIGGKYWHNPGAFSGDDAGSRFKGVCSVFVTAA 284

Query: 294 FSFGGIELFVLSINEQSNPRKSTPVAAKRSVYRXXXXXXXXXXXXGFNVPHNNDQLMGSG 353
           FSF G EL  L+  E +NPRK+ P AAK+  +R            G  VPH +++L+G+ 
Sbjct: 285 FSFAGTELVGLASAETANPRKALPRAAKQVFWRILLFYIISLCLIGLLVPHTSERLIGTS 344

Query: 354 GSATHASPYVLAASIHKVRVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPKF 413
                ASP+VLA   H ++ +P +IN VILISV+SV NSA+YA  R M +LA+QG  P  
Sbjct: 345 SVDAAASPFVLAIQTHGIKGLPSVINVVILISVLSVGNSAVYACSRSMVALAEQGSLPHI 404

Query: 414 LNYIDREGRPLRAXXXXXXXXXXXXXACSPQEEQAFTWLAAIAGLSELFTWSGIMLSHIR 473
             YIDR+GRPL A             A S +E   F WL A++GLS LF+W  I + HIR
Sbjct: 405 FAYIDRKGRPLVAIITTCVFGLLSFIAQSEKEGDVFNWLLALSGLSTLFSWGAICICHIR 464

Query: 474 FRKAMKVQGRSLDEVGYKANTGIWGSYYGVFFNMLVFMAQFWVALSPIGNGGKCDAQAFF 533
           FR+A+  QGRS DE+ + +  GI GSY+GV   +LV +AQFWVA+ PI  GG  +A+ FF
Sbjct: 465 FRRALSAQGRSTDELAFVSYAGIAGSYFGVILVLLVLIAQFWVAVWPI--GGSPNAEDFF 522

Query: 534 ESYLAAPLWIFMYVGYMVYKRDFTFLNPLDKIDLDFHRRVYDPEIMRQEDEENKERLKN 592
            +YL+ P+ +  Y+ + ++KR++        ID+D  RR  D E +RQE  E K  L  
Sbjct: 523 SAYLSFPVLLAFYIFHKIWKRNWKLFTRAKDIDIDTGRREMDTEALRQEIAEEKMLLST 581

>CAGL0L03267g 372787..374580 highly similar to sp|P19145
           Saccharomyces cerevisiae YKR039w GAP1 general amino acid
           permease, hypothetical start
          Length = 597

 Score =  416 bits (1068), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 226/541 (41%), Positives = 324/541 (59%), Gaps = 4/541 (0%)

Query: 53  HRFVDSFRRAESQRLEEDNDLEDGTKSMKSNNHLKKSMKSRHVVMMSLGTGIGTGLLVAN 112
            +F DSF+  +   + +D    +      ++  LK  +K+RH+ M+++G  IGTGL V +
Sbjct: 48  RKFKDSFKPLDEAVVTDDMSDIEKIAHRTAHAPLKHHLKNRHLQMIAIGGAIGTGLFVGS 107

Query: 113 AKGLSLAGPGSLVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFISKSFGFAT 172
              L  AGP  ++IG+ +   + Y MV A GE+ V +P + G F  Y + FI +SFGFA 
Sbjct: 108 GTALRTAGPAGILIGWGLTGTMIYCMVMAMGELSVVFP-ISGGFTTYATRFIDESFGFAN 166

Query: 173 TWLFCIQWLTVLPLELITSSMTVKYW-NDTINADXXXXXXXXXXXXXXXXGVKAYGETEF 231
            + + +QWL VLPLE++ +S+TV YW  D    D                GVK YGE EF
Sbjct: 167 NFNYMLQWLCVLPLEIVAASITVNYWGTDPKYRDGFVALFWVVIVIINLFGVKGYGEAEF 226

Query: 232 IFNSCKILMVAGFIILSVVINCGGAGVDGYIGGKYWRDPGSFAEGSGATRFKGICYILVS 291
           +F+  K+L V GFII+ +V+NCGG    GYIGGKY+ DPG+F   +   RF+G+C + V+
Sbjct: 227 VFSIIKVLTVIGFIIMGIVLNCGGGPEGGYIGGKYFHDPGAFVGDTAGARFQGVCSVFVT 286

Query: 292 AYFSFGGIELFVLSINEQSNPRKSTPVAAKRSVYRXXXXXXXXXXXXGFNVPHNNDQLMG 351
           A FSF G EL  ++  E + PRKS P AAK+  +R            G  VP+ +++L+G
Sbjct: 287 AAFSFAGSELIGIAAAESAEPRKSVPKAAKQVFWRITLFYMLSLLMVGLLVPYTDERLIG 346

Query: 352 SGGSATHASPYVLAASIHKVRVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAP 411
           +      ASP+V+A + H +R +P ++N VILI+V+SV NSA+Y   R +C+LAQQ + P
Sbjct: 347 ASSVDAAASPFVIAITSHGIRGLPSVVNVVILIAVLSVGNSAVYGCSRTLCALAQQNFLP 406

Query: 412 KFLNYIDREGRPLRAXXXXXXXXXXXXXACSPQEEQAFTWLAAIAGLSELFTWSGIMLSH 471
           K   YIDR GRPL               A S +E + F WL A++GLS LFTW GI   H
Sbjct: 407 KIFGYIDRSGRPLFGIAFTSAFGLVAFVAQSKKEGEVFAWLLALSGLSSLFTWGGICFCH 466

Query: 472 IRFRKAMKVQGRSLDEVGYKANTGIWGSYYGVFFNMLVFMAQFWVALSPIGNGGKCDAQA 531
           IRFR A+  QGRS DE+ +KA  GI+GS +G+F  +L+FMAQF+VAL P   GGK  A+ 
Sbjct: 467 IRFRAALTAQGRSTDELPFKAPAGIYGSMWGLFMIVLMFMAQFYVALFP--PGGKPSAEV 524

Query: 532 FFESYLAAPLWIFMYVGYMVYKRDFTFLNPLDKIDLDFHRRVYDPEIMRQEDEENKERLK 591
           FF+SYL+ P+ +  Y G+ +Y R++  L PL K+D+D  RR  D +++RQE  E K+ + 
Sbjct: 525 FFQSYLSFPVVLAFYFGHKLYARNWKLLIPLSKLDIDTGRREMDLDVLRQEIAEEKQMMS 584

Query: 592 N 592
            
Sbjct: 585 T 585

>YGR191W (HIP1) [2141] chr7 (880423..882234) Histidine permease,
           member of the amino acid permease family of membrane
           transporters [1812 bp, 603 aa]
          Length = 603

 Score =  410 bits (1055), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 218/520 (41%), Positives = 311/520 (59%), Gaps = 14/520 (2%)

Query: 57  DSFRRAESQRLEEDNDLEDGTKSMKSNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGL 116
           D FRR E    E+ N           N +L K +  RH++ +++G  IGTGL V     L
Sbjct: 68  DRFRRNEDTEQEDIN-----------NTNLSKDLSVRHLLTLAVGGAIGTGLYVNTGAAL 116

Query: 117 SLAGPGSLVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFISKSFGFATTWLF 176
           S  GP SLVI +V++S   + ++ + GE+   +P + G FN Y+  FI  SF FA    +
Sbjct: 117 STGGPASLVIDWVIISTCLFTVINSLGELSAAFPVV-GGFNVYSMRFIEPSFAFAVNLNY 175

Query: 177 CIQWLTVLPLELITSSMTVKYWNDTINADXXXXXXXXXXXXXXXXGVKAYGETEFIFNSC 236
             QWL +LPLEL+ +S+T+KYWND IN+D                 VK++GETEF+ +  
Sbjct: 176 LAQWLVLLPLELVAASITIKYWNDKINSDAWVAIFYATIALANMLDVKSFGETEFVLSMI 235

Query: 237 KILMVAGFIILSVVINCGGAGVDGYIGGKYWRDPGSFAEGSGATRFKGICYILVSAYFSF 296
           KIL + GF IL +V++CGG    GYIGGKYW DPG+F   S  T+FKG+C + V+A FS+
Sbjct: 236 KILSIIGFTILGIVLSCGGGPHGGYIGGKYWHDPGAFVGHSSGTQFKGLCSVFVTAAFSY 295

Query: 297 GGIELFVLSINEQSNPRKSTPVAAKRSVYRXXXXXXXXXXXXGFNVPHNNDQLM-GSGGS 355
            GIE+  +S  E  NPR++ P AAKR+ +             G  VP N+ +L+ GS   
Sbjct: 296 SGIEMTAVSAAESKNPRETIPKAAKRTFWLITASYVTILTLIGCLVPSNDPRLLNGSSSV 355

Query: 356 ATHASPYVLAASIHKVRVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPKFLN 415
              +SP V+A     ++ +P ++NA+ILI+V+SVANSA+YA  R M ++A  G  PKFLN
Sbjct: 356 DAASSPLVIAIENGGIKGLPSLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLN 415

Query: 416 YIDREGRPLRAXXXXXXXXXXXXXACSPQEEQAFTWLAAIAGLSELFTWSGIMLSHIRFR 475
            +D+ GRP+ A             A S ++ + FTWL+A++GLS +F W  I LSHIRFR
Sbjct: 416 RVDKRGRPMNAILLTLFFGLLSFVAASDKQAEVFTWLSALSGLSTIFCWMAINLSHIRFR 475

Query: 476 KAMKVQGRSLDEVGYKANTGIWGSYYGVFFNMLVFMAQFWVALSPIGNGGKCDAQAFFES 535
           +AMKVQ RSLDE+ + + TG+ GS+YG     LV +A FW +L P+G  G   A++FFE 
Sbjct: 476 QAMKVQERSLDELPFISQTGVKGSWYGFIVLFLVLIASFWTSLFPLGGSG-ASAESFFEG 534

Query: 536 YLAAPLWIFMYVGYMVYKRDFTFLNPLDKIDLDFHRRVYD 575
           YL+ P+ I  YVG+ +Y R++T +  L+ +DLD  R+  D
Sbjct: 535 YLSFPILIVCYVGHKLYTRNWTLMVKLEDMDLDTGRKQVD 574

>CAGL0B03773g 373956..375773 highly similar to sp|P06775
           Saccharomyces cerevisiae YGR191w HIP1 Histidine
           permease, start by similarity
          Length = 605

 Score =  409 bits (1050), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 219/514 (42%), Positives = 317/514 (61%), Gaps = 3/514 (0%)

Query: 82  SNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLSLAGPGSLVIGYVMVSFVTYFMVQA 141
           +N +L K +  RH++ +++G  IGTGL V +   L+  GP SLVIG+V+VS   + ++ +
Sbjct: 84  NNTNLNKDLSVRHLLTLAVGGAIGTGLFVNSGASLTTGGPASLVIGWVIVSTCLFTVINS 143

Query: 142 AGEMGVTYPTLPGNFNAYNSIFISKSFGFATTWLFCIQWLTVLPLELITSSMTVKYWNDT 201
            GE+   +P + G FN Y + FI  SF FA    +  QWL +LPLEL+ +S+T++YWND 
Sbjct: 144 LGELAAAFPVV-GGFNVYITRFIEPSFAFAINLNYLAQWLVLLPLELVAASITIRYWNDK 202

Query: 202 INADXXXXXXXXXXXXXXXXGVKAYGETEFIFNSCKILMVAGFIILSVVINCGGAGVDGY 261
           IN+D                 VK++GETEFI +  KIL + GF IL +V+ CGG    GY
Sbjct: 203 INSDAWVAIFYTAIALANMLDVKSFGETEFILSMVKILAIIGFGILGIVLTCGGGPHGGY 262

Query: 262 IGGKYWRDPGSFAEGSGATRFKGICYILVSAYFSFGGIELFVLSINEQSNPRKSTPVAAK 321
           IGGKYW +PG+F   S  ++FKG+C + V+A FS+ GIE+  +S  E  NP+++ P AAK
Sbjct: 263 IGGKYWHNPGAFVGHSAGSQFKGLCSVFVTAAFSYSGIEMTAVSAAESRNPKETIPKAAK 322

Query: 322 RSVYRXXXXXXXXXXXXGFNVPHNNDQLM-GSGGSATHASPYVLAASIHKVRVIPHIINA 380
           R+ +             G  VP+N+ +L+ GS      ASP V+A     ++ +P ++NA
Sbjct: 323 RTFWLITVSYVGILTLIGCLVPYNDPRLLNGSSSVDAAASPLVIAIENGGIKGLPSLMNA 382

Query: 381 VILISVISVANSALYAAPRLMCSLAQQGYAPKFLNYIDREGRPLRAXXXXXXXXXXXXXA 440
           +ILI+++SVANSA+YA  R M S+A  G  PKFL+ +D+ GRPL A             A
Sbjct: 383 IILIAIVSVANSAVYACSRCMVSMAHIGNLPKFLSKVDKRGRPLNAILLTLFFGLLSFIA 442

Query: 441 CSPQEEQAFTWLAAIAGLSELFTWSGIMLSHIRFRKAMKVQGRSLDEVGYKANTGIWGSY 500
            S ++E+ FTWL+A++GLS +F W  I LS IRFR AMK QGRSLDE+ + + +G WG++
Sbjct: 443 ASDKQEEVFTWLSALSGLSTIFCWMAINLSLIRFRDAMKAQGRSLDEMPFLSQSGTWGAW 502

Query: 501 YGVFFNMLVFMAQFWVALSPIGNGGKCDAQAFFESYLAAPLWIFMYVGYMVYKRDFTFLN 560
           YGV    LV +A FW +L P+G+     A++FFE YL+ P+ I  YVG+ ++KRD+  L 
Sbjct: 503 YGVIVLFLVLVASFWTSLFPVGS-STASAKSFFEGYLSLPILIACYVGHKLWKRDWRLLV 561

Query: 561 PLDKIDLDFHRRVYDPEIMRQEDEENKERLKNSS 594
           PL ++DLD  RRV D E   +E    +E L N+S
Sbjct: 562 PLMEMDLDSGRRVLDAETREEELRVEREYLANAS 595

>Kwal_33.15407
          Length = 587

 Score =  405 bits (1041), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 218/562 (38%), Positives = 327/562 (58%), Gaps = 11/562 (1%)

Query: 41  KEHSEESRNGL--VHRFVDSFRRAESQRLEEDNDLED-----GTKSMKSNNHLKKSMKSR 93
           + + + SRN +  +      F++A++    E   LE+     GT   + + +  K +  R
Sbjct: 19  ETYKQSSRNDMSPLTSEAPDFKKADAASGNESWALENVESTSGTSDAEDSRY-NKDLSVR 77

Query: 94  HVVMMSLGTGIGTGLLVANAKGLSLAGPGSLVIGYVMVSFVTYFMVQAAGEMGVTYPTLP 153
           H++ +++G  IGTGL V +   L+  GPGSLVI +V++S   + +V A GE+  T+P + 
Sbjct: 78  HLLTLAVGGAIGTGLFVNSGSALTTGGPGSLVIDWVIISTCLFTIVNALGELSSTFPVV- 136

Query: 154 GNFNAYNSIFISKSFGFATTWLFCIQWLTVLPLELITSSMTVKYWNDTINADXXXXXXXX 213
           G FN Y S F+  SFGFA    +  QW  +LPLEL+ +S+T++YWN TIN+D        
Sbjct: 137 GGFNVYISRFVEPSFGFAVNLNYLAQWAVLLPLELVAASLTIRYWNSTINSDAWVAIFYT 196

Query: 214 XXXXXXXXGVKAYGETEFIFNSCKILMVAGFIILSVVINCGGAGVDGYIGGKYWRDPGSF 273
                    VK++GETEF+ +  KIL + GF IL +V+ CGG    GYIGGKYW +PG+F
Sbjct: 197 IIFLANLLDVKSFGETEFVLSMVKILAIIGFTILGIVLTCGGGPEGGYIGGKYWSNPGAF 256

Query: 274 AEGSGATRFKGICYILVSAYFSFGGIELFVLSINEQSNPRKSTPVAAKRSVYRXXXXXXX 333
              + + RF G+C + V+A FS+ G EL  +S  E  NPR + P A KR+ +        
Sbjct: 257 VGNTSSQRFHGLCSVFVTAAFSYSGTELIAVSAAESVNPRITLPKACKRTFWLITVCYIV 316

Query: 334 XXXXXGFNVPHNNDQLM-GSGGSATHASPYVLAASIHKVRVIPHIINAVILISVISVANS 392
                G  VP ++ +L+ GS      ASP V+A     ++ +P ++NA+ILI+V+SVANS
Sbjct: 317 VLTLVGCLVPSDDPRLLHGSSSVDVAASPLVIAIENGGIKGLPSLMNAIILIAVLSVANS 376

Query: 393 ALYAAPRLMCSLAQQGYAPKFLNYIDREGRPLRAXXXXXXXXXXXXXACSPQEEQAFTWL 452
           A+YA  R M S+A+ G  PK  +Y+DR+GRPL A             A S ++E  FTWL
Sbjct: 377 AVYACSRCMASMARIGNLPKTFSYVDRKGRPLYAILATLIFGLLSFIAASNKQETVFTWL 436

Query: 453 AAIAGLSELFTWSGIMLSHIRFRKAMKVQGRSLDEVGYKANTGIWGSYYGVFFNMLVFMA 512
           +A++GLS LF W  I +SHIRFR  MK +GRSLDE+ + + TG+WGSYYG     +V + 
Sbjct: 437 SALSGLSTLFCWFAINVSHIRFRYTMKQRGRSLDELPFVSMTGVWGSYYGCVIIFVVLVV 496

Query: 513 QFWVALSPIGNGGKCDAQAFFESYLAAPLWIFMYVGYMVYKRDFTFLNPLDKIDLDFHRR 572
            FW AL P    G   A++FFE+YL+ P+ +  Y+G+ +Y + +  L P  +ID+D  RR
Sbjct: 497 CFWTALFP-STEGVASAESFFETYLSFPILLVCYIGHKLYTKSWRLLTPTTEIDIDSGRR 555

Query: 573 VYDPEIMRQEDEENKERLKNSS 594
             D E+++ E    ++ ++  S
Sbjct: 556 AVDIEVLKDEKRMEEQAMREKS 577

>KLLA0F01012g complement(90772..92442) similar to sp|P48813
           Saccharomyces cerevisiae YDR508c GNP1 high-affinity
           glutamine permease, hypothetical start
          Length = 556

 Score =  396 bits (1018), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 199/507 (39%), Positives = 295/507 (58%), Gaps = 6/507 (1%)

Query: 71  NDLEDGTKSMKSNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLSLAGPGSLVIGYVM 130
           N ++         N LK+S+K  HV MMS  TGIGTGLLV N + +++AG G  ++GY++
Sbjct: 22  NSIDTTADVTLPKNELKQSIKPFHVFMMSTATGIGTGLLVGNGRSIAIAGVGGTLVGYLI 81

Query: 131 VSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFISKSFGFATTWLFCIQWLTVLPLELIT 190
           +  +    +Q  GE+ V +P++PG F +Y   FI  S GF  +WLF + W  VLPLE+  
Sbjct: 82  IGIMLTCCMQTVGELVVAFPSMPGGFTSYGKRFIDPSVGFTISWLFFLNWTVVLPLEICV 141

Query: 191 SSMTVKYWNDTINADXXXXXXXXXXXXXXXXGVKAYGETEFIFNSCKILMVAGFIILSVV 250
           +SMT+ +WN+ IN                  G + Y + + IFN  K+LM+ GFIIL + 
Sbjct: 142 ASMTINFWNENINPSIVVALCYSLVCGVNFFGARCYADADCIFNCLKVLMILGFIILGIF 201

Query: 251 INCGGAGVDGYIGGKYWRDPGSFAEGSGATRFKGICYILVSAYFSFGGIELFVLSINEQS 310
           +N G  G  GY+G KY+  PG F    G   FK I   L++A FS GG E   LS  EQ+
Sbjct: 202 VNTGVVGTSGYLGFKYFHSPGFFRNDEGL--FKSIAATLITACFSTGGTEFVALSCAEQN 259

Query: 311 N---PRKSTPVAAKRSVYRXXXXXXXXXXXXGFNVPHNNDQLMGSGGSATHASPYVLAAS 367
               PR S   A+ + V R            G  VP N+  LMGSG   THASPYV+A +
Sbjct: 260 TEDMPR-SIKRASIQVVVRIAIIFCVSLMIIGLLVPFNSPYLMGSGSELTHASPYVVALT 318

Query: 368 IHKVRVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPKFLNYIDREGRPLRAX 427
            + VR+IPHI+NA+IL+S+ISVAN+A+Y++ R + SLA+QG+A K+   +D  G+P R  
Sbjct: 319 TNGVRIIPHIVNAIILLSIISVANNAMYSSSRTLHSLAEQGFAMKYFCKLDESGKPFRCL 378

Query: 428 XXXXXXXXXXXXACSPQEEQAFTWLAAIAGLSELFTWSGIMLSHIRFRKAMKVQGRSLDE 487
                       A    +E  F WL +I+GLS +FTWS   +SH+RFRKAMK Q ++LD+
Sbjct: 379 CVSAFTGLFSFIAEYKDQETVFVWLLSISGLSTIFTWSMTCVSHLRFRKAMKDQDQALDQ 438

Query: 488 VGYKANTGIWGSYYGVFFNMLVFMAQFWVALSPIGNGGKCDAQAFFESYLAAPLWIFMYV 547
           +GY++  G++GSY  +F   ++ + QFWV+L P+ + G+ +  +F ++Y+A P+ I +Y+
Sbjct: 439 LGYQSPCGVYGSYISLFICAIILIVQFWVSLFPLESNGRLNVVSFLQNYMAVPITIVLYL 498

Query: 548 GYMVYKRDFTFLNPLDKIDLDFHRRVY 574
           G+  Y  ++       +ID+   R +Y
Sbjct: 499 GHKAYTGNWKPFIRAPEIDIQTDRDIY 525

>AGR319W [4630] [Homologous to ScYGR191W (HIP1) - SH]
           complement(1327939..1329819) [1881 bp, 626 aa]
          Length = 626

 Score =  398 bits (1022), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 220/558 (39%), Positives = 323/558 (57%), Gaps = 21/558 (3%)

Query: 54  RFVDSFRRA---ESQRLEEDNDLE-DGTK-------------SMKSNNHLKKSMKSRHVV 96
           R ++ F+RA   E+ R   D+D+E DG +             + ++++ L K++  RH++
Sbjct: 60  RLLNDFKRADEGETTRSVADSDMEVDGKRYKEMTDVERAVCDAARNSSQLSKNLSIRHLL 119

Query: 97  MMSLGTGIGTGLLVANAKGLSLAGPGSLVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGNF 156
            +++G  IGTGL V +   L+  GPGS++I + ++S   + +V + GE+   +P + G F
Sbjct: 120 TLAVGGAIGTGLFVNSGASLNTGGPGSILIAWTLISTCLFTIVNSLGELASAFPVV-GGF 178

Query: 157 NAYNSIFISKSFGFATTWLFCIQWLTVLPLELITSSMTVKYWNDTINADXXXXXXXXXXX 216
           N Y + F+  SFGFA    +  QW  +LPLEL  +S+T+KYWN+ IN+D           
Sbjct: 179 NVYITRFVEPSFGFAVNISYLAQWAVLLPLELAAASITIKYWNNKINSDAWVAIFYVCIA 238

Query: 217 XXXXXGVKAYGETEFIFNSCKILMVAGFIILSVVINCGGAGVDGYIGGKYWRDPGSFAEG 276
                 VK++GETEF+ +  KIL + GF IL  V+ CGG  V G+IG KYW DPG+F   
Sbjct: 239 LANMLDVKSFGETEFVLSMVKILAIFGFAILGTVLICGGGPVGGFIGAKYWHDPGAFVGD 298

Query: 277 SGATRFKGICYILVSAYFSFGGIELFVLSINEQSNPRKSTPVAAKRSVYRXXXXXXXXXX 336
           +   +FKG+C + V+A FS+ G EL  +S  E  NPR + P A+KRS +           
Sbjct: 299 TPGAQFKGLCSVFVTAAFSYSGTELVGVSAAESINPRYTIPRASKRSFWLITSSYLLVLT 358

Query: 337 XXGFNVPHNNDQLM-GSGGSATHASPYVLAASIHKVRVIPHIINAVILISVISVANSALY 395
             G  VP N+ +L+ G       ASP V+A     +R +P ++NA+ILI++ISVANS++Y
Sbjct: 359 IAGCLVPSNDPRLLNGMSSVDVAASPLVIAIENGGIRGVPSLMNAIILIAIISVANSSVY 418

Query: 396 AAPRLMCSLAQQGYAPKFLNYIDREGRPLRAXXXXXXXXXXXXXACSPQEEQAFTWLAAI 455
           A  R M S+AQ G  PK  NYIDR+GRPL A             A S ++E  FTWL+A+
Sbjct: 419 ACSRCMVSMAQVGNLPKVFNYIDRKGRPLVAILATLVFGLLSFVAASDKQEAIFTWLSAL 478

Query: 456 AGLSELFTWSGIMLSHIRFRKAMKVQGRSLDEVGYKANTGIWGSYYGVFFNMLVFMAQFW 515
           +GLS LF W  I +SHIRFR+AM  Q RSLDE+ Y + TG+ GS+YG    + V +  FW
Sbjct: 479 SGLSTLFCWFAINISHIRFRRAMCAQQRSLDELPYLSLTGVLGSWYGAAVLLFVLVLSFW 538

Query: 516 VALSPIGNGGKCDAQAFFESYLAAPLWIFMYVGYMVYKRDFTFLNPLDKIDLDFHRRVYD 575
            +L P G+ G   A++FFE YL+ P+++  Y+ + +YKRD+    P  +ID+D  RR  D
Sbjct: 539 TSLFPPGSSGP-SAESFFEGYLSFPIFLICYISHKLYKRDWRLFIPAGQIDVDSGRRALD 597

Query: 576 -PEIMRQEDEENKERLKN 592
             E+  Q+  E  E  K 
Sbjct: 598 IEELKEQKLREQAETAKK 615

>Scas_479.1
          Length = 595

 Score =  396 bits (1018), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 214/552 (38%), Positives = 324/552 (58%), Gaps = 16/552 (2%)

Query: 45  EESRNGL------VHRFVDSF-----RRAESQRLEEDNDLEDGTKSMKS--NNHLKKSMK 91
           EE   G+      VH F  +       +++   +E++ D+   +   K   N  L K + 
Sbjct: 24  EEGEEGIGRSSSQVHSFTSNTPSPFNEKSKDSPIEDNIDITSQSSVTKEDINKSLNKDLS 83

Query: 92  SRHVVMMSLGTGIGTGLLVANAKGLSLAGPGSLVIGYVMVSFVTYFMVQAAGEMGVTYPT 151
            RH++ +++G  IG GL V +   L+  GP SLVI +V++S   + ++ + GE+   +P 
Sbjct: 84  IRHLLTLAVGGAIGVGLFVNSGAALASGGPASLVIDWVIISTCLFTVINSLGELAAAFPV 143

Query: 152 LPGNFNAYNSIFISKSFGFATTWLFCIQWLTVLPLELITSSMTVKYWNDTINADXXXXXX 211
           + G FN Y + F+  SF FA    +  QWL +LPLEL+ +S+T+KYWN TIN+D      
Sbjct: 144 V-GGFNVYITRFVDPSFAFAVNLNYLAQWLVLLPLELVAASITIKYWNSTINSDAWVAIF 202

Query: 212 XXXXXXXXXXGVKAYGETEFIFNSCKILMVAGFIILSVVINCGGAGVDGYIGGKYWRDPG 271
                      VK++GETEF+ +  KIL + GF IL +V++CGG    GY+GGKYW +PG
Sbjct: 203 YTVITLANMLDVKSFGETEFVLSMVKILAIIGFTILGIVLSCGGGPKGGYLGGKYWHNPG 262

Query: 272 SFAEGSGATRFKGICYILVSAYFSFGGIELFVLSINEQSNPRKSTPVAAKRSVYRXXXXX 331
           +F   +  T+FKG+C + V+A FS+ GIE+  +S  E  +PRK+ P AAKR+ +      
Sbjct: 263 AFVGHTSGTKFKGLCSVFVTAAFSYSGIEMTAVSAAESKDPRKTIPKAAKRTFWLITASY 322

Query: 332 XXXXXXXGFNVPHNNDQLM-GSGGSATHASPYVLAASIHKVRVIPHIINAVILISVISVA 390
                  G  VP+++ +LM G+      ASP V+A     ++ +  ++NA+ILIS+ISVA
Sbjct: 323 VTILTLVGCLVPYDDPRLMSGTSSVDAAASPLVIAIENGGIKGLDSLMNAIILISIISVA 382

Query: 391 NSALYAAPRLMCSLAQQGYAPKFLNYIDREGRPLRAXXXXXXXXXXXXXACSPQEEQAFT 450
           NSA+YA  R M S+A  G  PK L  +D+ GRP+ A             A S ++ + FT
Sbjct: 383 NSAVYACSRCMVSMAHIGNLPKKLGKVDKRGRPINATLVTLFFGLLSFIAASDKQNEVFT 442

Query: 451 WLAAIAGLSELFTWSGIMLSHIRFRKAMKVQGRSLDEVGYKANTGIWGSYYGVFFNMLVF 510
           WL+A++GLS +F W  I +SHIRFR+AM  Q RSLDE+ Y + TG+WGS YGV    LV 
Sbjct: 443 WLSALSGLSTIFCWMAINISHIRFRQAMIKQNRSLDEMPYLSQTGVWGSLYGVVVLFLVL 502

Query: 511 MAQFWVALSPIGNGGKCDAQAFFESYLAAPLWIFMYVGYMVYKRDFTFLNPLDKIDLDFH 570
           +A FW +L P+G G   D Q+FFE YL+ P+ I  Y+G+ +Y ++++++  L+++DLD  
Sbjct: 503 VASFWTSLFPLG-GDSADVQSFFEGYLSLPILIVCYIGHKLYFKNWSWVVTLEEMDLDTG 561

Query: 571 RRVYDPEIMRQE 582
           R+  DP + R E
Sbjct: 562 RKALDPHLHRAE 573

>KLLA0A11770g 1014918..1016663 similar to sp|P06775 Saccharomyces
           cerevisiae YGR191w HIP1 histidine permease, start by
           similarity
          Length = 581

 Score =  392 bits (1008), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 211/532 (39%), Positives = 314/532 (59%), Gaps = 4/532 (0%)

Query: 62  AESQRLEEDNDLEDGTKSMKSNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLSLAGP 121
           AE +   + ND+E    + K ++ L K +  RH++ +++G  IGTGL V +   LS  GP
Sbjct: 41  AEEKDYADMNDVEKAIYNTK-DSKLNKDLSIRHLLTLAVGGAIGTGLFVNSGDSLSTGGP 99

Query: 122 GSLVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFISKSFGFATTWLFCIQWL 181
            SLVI + ++S   + +V + GE+  T+P + G FN Y + F+  SFGFA  + +  QW 
Sbjct: 100 ASLVIAWTIISTCLFTIVNSLGELSATFPVV-GGFNVYVTRFVEPSFGFAVNFNYLAQWA 158

Query: 182 TVLPLELITSSMTVKYWNDTINADXXXXXXXXXXXXXXXXGVKAYGETEFIFNSCKILMV 241
            +LPLEL  +S+T++YWN +IN D                 VK++GETEF+ +  KIL +
Sbjct: 159 ILLPLELCAASITIRYWNKSINPDAWVSIFYVAIAFANMLDVKSFGETEFVLSMVKILAI 218

Query: 242 AGFIILSVVINCGGAGVDGYIGGKYWRDPGSFAEGSGATRFKGICYILVSAYFSFGGIEL 301
            GF IL +V+ CGG    G+IGGKYW DPG+F   + A RFKG+  + ++A FS+ G+EL
Sbjct: 219 IGFTILGIVLICGGGPSGGFIGGKYWNDPGAFVGDTPAQRFKGLSAVFITAAFSYSGLEL 278

Query: 302 FVLSINEQSNPRKSTPVAAKRSVYRXXXXXXXXXXXXGFNVPHNNDQLM-GSGGSATHAS 360
             +S  E  NPR + P AAKR+ +             G  VP N+  L+ G+      AS
Sbjct: 279 VGVSAAESRNPRVTLPKAAKRTFWLITMSYLVILTLIGCLVPSNDPLLLNGTSSVDAAAS 338

Query: 361 PYVLAASIHKVRVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPKFLNYIDRE 420
           P V+A     ++ +P ++NA+ILI+++SVANSA+YA  R + S+A+ G  P+ L ++D++
Sbjct: 339 PLVIAIQNGGIKGLPSLMNAIILIALLSVANSAVYACSRCIISMAEIGNLPRSLAHVDKK 398

Query: 421 GRPLRAXXXXXXXXXXXXXACSPQEEQAFTWLAAIAGLSELFTWSGIMLSHIRFRKAMKV 480
           GRPL A             A S + ++ FTWL+A++GLS LF W  I L+H+RFR AMK 
Sbjct: 399 GRPLYAIAITLLVGLLSFIAASNKRDEVFTWLSALSGLSTLFCWFAINLAHLRFRHAMKH 458

Query: 481 QGRSLDEVGYKANTGIWGSYYGVFFNMLVFMAQFWVALSPIGNGGKCDAQAFFESYLAAP 540
           Q RSL+E+ Y + TG WGS+YG     LV +A FW +L P G  G  DA +FFESYL+ P
Sbjct: 459 QNRSLEELPYVSMTGEWGSWYGCIVIGLVLIASFWTSLFPAGGNG-ADATSFFESYLSLP 517

Query: 541 LWIFMYVGYMVYKRDFTFLNPLDKIDLDFHRRVYDPEIMRQEDEENKERLKN 592
           ++I  Y+G+ ++KR+      L ++D+D  R   D   ++QE E   E +K 
Sbjct: 518 IFIACYLGHKIWKRNLRLYIKLSEVDVDSGRTDTDAATLKQEKEAEAELMKT 569

>Scas_607.4
          Length = 599

 Score =  393 bits (1010), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 205/517 (39%), Positives = 304/517 (58%), Gaps = 16/517 (3%)

Query: 83  NNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLSLAGPGSLVIGYVMVSFVTYFMVQAA 142
            N+LK+S+K+RH++M+++G  IGTGL V + + ++  GP ++VIG+ +        +   
Sbjct: 82  TNNLKRSLKARHLIMIAIGGSIGTGLFVGSGQAIATGGPLAVVIGWAIAGSQIIGTIHGL 141

Query: 143 GEMGVTYPTLPGNFNAYNSIFISKSFGFATTWLFCIQWLTVLPLELITSSMTVKYWNDTI 202
           GE+ V +P + G F  Y++ F+  S  F  + ++ IQW  VLPLE+I+S+MTV+YWN +I
Sbjct: 142 GEITVRFPVV-GAFANYSTRFLDPSLSFVISTIYVIQWFFVLPLEIISSAMTVQYWNQSI 200

Query: 203 NADXXXXXXXXXXXXXXXXGVKAYGETEFIFNSCKILMVAGFIILSVVINCGGAGVDGYI 262
           +                  G + +GE EF+F+S K+L + GFIIL +V+ CGG     ++
Sbjct: 201 DPVVWVAIFYCAIVSINLFGARGFGEAEFVFSSVKVLTICGFIILCIVLICGGGPDHDFV 260

Query: 263 GGKYWRDPGSFAEGSGATRFKGICYILVSAYFSFGGIELFVLSINEQSNPRKSTPVAAKR 322
           G KYW DPG  A G     F G+  +LV A +S GG E+  L+  E ++P K  P A K+
Sbjct: 261 GAKYWHDPGCLAHG-----FPGVLSVLVVASYSLGGTEMVCLASGE-TDP-KELPSAIKQ 313

Query: 323 SVYRXXXXXXXXXXXXGFNVPHNNDQLMGSGGSATHASPYVLAASIHKVRVIPHIINAVI 382
           + +R            GF VP+ N+ L+G  GS+ + SP+V+A  +H+++V+P I+NAVI
Sbjct: 314 TFWRILFFFLVSLTLIGFLVPYTNENLLG--GSSVNNSPFVIAIKLHQIKVLPSIVNAVI 371

Query: 383 LISVISVANSALYAAPRLMCSLAQQGYAPKFLNYIDREGRPLRAXXXXXXXXXXXXXACS 442
           LIS++SV NS ++A+ R +CS+A QG  P+F  YIDR GRPL                 S
Sbjct: 372 LISILSVGNSCIFASSRTLCSMAHQGLIPRFFGYIDRAGRPLTGIITNSLFGLLAFLVKS 431

Query: 443 PQEEQAFTWLAAIAGLSELFTWSGIMLSHIRFRKAMKVQGRSLDEVGYKANTGIWGSYYG 502
               + F WL AIAGL+    W  I +SHIRFR AMK QGRSLDE+ + +  GIWGS Y 
Sbjct: 432 SSMSEVFDWLMAIAGLATCIVWLSINISHIRFRLAMKAQGRSLDELEFVSAVGIWGSAYS 491

Query: 503 VFFNMLVFMAQFWVALSPIG--NGGKCDAQAFFESYLAAPLWIFMYVGYMVYKR----DF 556
              N L+ +AQF+ AL PIG        A+ FF+SYL A + I ++VG+ ++ R     +
Sbjct: 492 AVINSLILVAQFYCALWPIGGWENSSIRAKKFFQSYLCALIMIVLFVGHKIFYRYKTGKW 551

Query: 557 TFLNPLDKIDLDFHRRVYDPEIMRQEDEENKERLKNS 593
             + PL+KIDL+  R+  D EI++QE  E    L+ S
Sbjct: 552 WSMLPLNKIDLETDRKNIDIEILKQEIAERNRHLRAS 588

>Kwal_33.14276
          Length = 596

 Score =  390 bits (1002), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 207/543 (38%), Positives = 306/543 (56%), Gaps = 10/543 (1%)

Query: 52  VHRFVDSFRRAESQRLEEDNDLEDGTKSMKSNNHLKKSMKSRHVVMMSLGTGIGTGLLVA 111
           +H FVD FR  +   ++ +    +      + + LK+ +K+RH+ M+++G  IGTGL V 
Sbjct: 50  IHNFVDGFREYKLDDVDPNLSSTERAAIATARSPLKRHLKNRHLQMIAIGGSIGTGLFVG 109

Query: 112 NAKGLSLAGPGSLVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFISKSFGFA 171
           + K L + GP ++++ +++   + Y +VQA GE+ V  P + G++ +Y S FI  SFGFA
Sbjct: 110 SGKALRIGGPAAVILAWILTGSMVYSVVQAIGELCVALP-VSGSYLSYVSRFIDPSFGFA 168

Query: 172 TTWLFCIQWLTVLPLELITSSMTVKYWN-DTINADXXXXXXXXXXXXXXXXGVKAYGETE 230
             + + +  L  +PLE++ +S+TV YWN D   AD                GVK YGE E
Sbjct: 169 IAYNYLVGNLVTMPLEIVAASITVDYWNVDHKYADGFVALFYVTVLLINFLGVKGYGEAE 228

Query: 231 FIFNSCKILMVAGFIILSVVINCGGAGVD-GYIGGKYWRDPGSFAEGSGATRFKGICYIL 289
           F+F+  K+L + GFIIL +V+ CGG   + GYIG KYW +PG FA G     FKG   I 
Sbjct: 229 FVFSIIKVLAIVGFIILGIVLVCGGGSNNTGYIGTKYWHNPGGFAHG-----FKGFAAIF 283

Query: 290 VSAYFSFGGIELFVLSINEQSNPRKSTPVAAKRSVYRXXXXXXXXXXXXGFNVPHNNDQL 349
           V++ FSF G E+F L   E  NPR+  P AAK+  +R            G  VP+ N  L
Sbjct: 284 VTSAFSFSGSEMFALGAAESKNPRRDLPKAAKQVFWRITLFYLISLTLIGCLVPYTNKHL 343

Query: 350 MGSGGSATHASPYVLAASIHKVRVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGY 409
             S      ASP+V+A     +  +P +IN VIL++V+SV N+ ++A+ R   SLA  GY
Sbjct: 344 FASSSVDASASPFVIAIKEAGISGLPSVINVVILVAVLSVGNTCVFASSRATLSLAHYGY 403

Query: 410 APKFLNYIDREGRPLRAXXXXXXXXXXXXXACSPQEEQAFTWLAAIAGLSELFTWSGIML 469
            PK   Y+DR+GRPL               + S  +   F W+ A++GL   FTW  I +
Sbjct: 404 LPKKFAYVDRKGRPLAGLILSMVFGLLSFLSSSKHKGVVFEWMLAVSGLCSFFTWGSICV 463

Query: 470 SHIRFRKAMKVQGRSLDEVGYKANTGIWGSYYGVFFNMLVFMAQFWVALSPIGNGGKCDA 529
            H+RFR+ ++ QGRS DE+ +KA TGIWGS YG+    +V   QFWVAL P+       A
Sbjct: 464 CHLRFRQGLRAQGRSTDELAFKAQTGIWGSIYGITLISVVLCFQFWVALFPLSKSP--SA 521

Query: 530 QAFFESYLAAPLWIFMYVGYMVYKRDFTFLNPLDKIDLDFHRRVYDPEIMRQEDEENKER 589
             FFE YL+ P+ I  Y+G+ VY R++  + P  ++DLD  RR  D E+++QE +E  E 
Sbjct: 522 YHFFEQYLSLPVVIVFYMGHKVYSRNWRLVIPAKELDLDTGRREVDLELLKQEIKEENES 581

Query: 590 LKN 592
           +++
Sbjct: 582 IRS 584

>Scas_507.1
          Length = 592

 Score =  389 bits (999), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 206/499 (41%), Positives = 302/499 (60%), Gaps = 5/499 (1%)

Query: 82  SNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLSLAGPGSLVIGYVMVSFVTYFMVQA 141
           +N +L K++  RH++ +++G  IG GL V +   L+  GP SLVI ++++S   + ++ A
Sbjct: 71  NNVNLNKNLSIRHLLTLAVGGSIGVGLFVNSGAALASGGPASLVIDWIIISTCLFTVINA 130

Query: 142 AGEMGVTYPTLPGNFNAYNSIFISKSFGFATTWLFCIQWLTVLPLELITSSMTVKYWNDT 201
            GEM   +P + G FN Y + FI  S GFA    +  QWL +LPLEL+ +SMT+KYWN+T
Sbjct: 131 LGEMAAAFPVV-GGFNVYITRFIDPSVGFAVNINYLAQWLVLLPLELVAASMTIKYWNET 189

Query: 202 INADXXXXXXXXXXXXXXXXGVKAYGETEFIFNSCKILMVAGFIILSVVINCGGAGVDGY 261
           IN+D                 VK++GETEF+ +  KIL + GF IL +V+ CGG    G+
Sbjct: 190 INSDAWVAIFYCVIALANMLEVKSFGETEFVLSMIKILAIIGFTILGIVLACGGGPHGGF 249

Query: 262 IGGKYWRDPGSFAEGSGATRFKGICYILVSAYFSFGGIELFVLSINEQSNPRKSTPVAAK 321
           IGGKYW  PGSF   +  T+FKG+C + V+A FS+ GIE+  +S  E  +PR + P AAK
Sbjct: 250 IGGKYWNHPGSFVGHNSGTKFKGLCSVFVTAAFSYSGIEMTAVSAAESKDPRTTIPKAAK 309

Query: 322 RSVYRXXXXXXXXXXXXGFNVPHNNDQLMGSGGSATHA--SPYVLAASIHKVRVIPHIIN 379
           R+ +             G  VP+++ +L+ SG S+  A  SP V+A     ++ +P ++N
Sbjct: 310 RTFWLITASYVTILTLIGCLVPYDDPRLL-SGTSSVDAASSPLVIAIENDGIKGLPSLMN 368

Query: 380 AVILISVISVANSALYAAPRLMCSLAQQGYAPKFLNYIDREGRPLRAXXXXXXXXXXXXX 439
           A+ILIS+ISVANSA+YA  R M ++A  G  P+ LN +D +GRP+ A             
Sbjct: 369 AIILISIISVANSAVYACSRCMVAMAHIGNVPRILNRVDTKGRPMNAIIFTLFFGLLSFV 428

Query: 440 ACSPQEEQAFTWLAAIAGLSELFTWSGIMLSHIRFRKAMKVQGRSLDEVGYKANTGIWGS 499
           A S ++   FTWL+A++GLS +F W  I LSHIRFR++M  Q RSLDE+ + + TG+WGS
Sbjct: 429 AASDRQADVFTWLSALSGLSTIFCWMAINLSHIRFRQSMAKQNRSLDELPFLSQTGVWGS 488

Query: 500 YYGVFFNMLVFMAQFWVALSPIGNGGKCDAQAFFESYLAAPLWIFMYVGYMVYKRDFTFL 559
           +YG     LV +A FW +L P+G G   DA++FFE YL+ P+ +  Y G+ +Y R   F+
Sbjct: 489 WYGTIVLFLVLVASFWTSLFPLG-GTSADAESFFEGYLSFPILLACYFGHKLYVRKREFM 547

Query: 560 NPLDKIDLDFHRRVYDPEI 578
             L  +DLD  RR  D ++
Sbjct: 548 VGLADMDLDTGRRQVDLDV 566

>AFR230C [3422] [Homologous to ScYKR039W (GAP1) - NSH]
           (855416..857230) [1815 bp, 604 aa]
          Length = 604

 Score =  385 bits (989), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 207/551 (37%), Positives = 312/551 (56%), Gaps = 6/551 (1%)

Query: 46  ESRNGLVHRFVDSFRRAESQRLEEDNDLEDGTKSMKSNNHLKKSMKSRHVVMMSLGTGIG 105
           E R G  + FVD+FRRAE   ++ +    +      +   L + +K+RH+ M+++G  IG
Sbjct: 44  EPRKGW-NGFVDTFRRAEMPVIDPNLSEAEKLAIRTAAAPLSRRLKNRHLQMIAIGGAIG 102

Query: 106 TGLLVANAKGLSLAGPGSLVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFIS 165
            GL V + K L+ AGP  ++IG+ + + +   M  + GE+ VT+P + G +  Y + FI 
Sbjct: 103 VGLFVGSGKALATAGPAGVLIGWGLTATMILIMCLSLGELAVTFP-VSGGYITYAARFID 161

Query: 166 KSFGFATTWLFCIQWLTVLPLELITSSMTVKYWN-DTINADXXXXXXXXXXXXXXXXGVK 224
           +S+GFA  + + +Q + V+PLE++ +S+TV YW+ D                     GV+
Sbjct: 162 ESWGFANNFNYMMQAMVVMPLEIVAASVTVGYWDTDPKYKLAFVALFWVVIVSINLFGVR 221

Query: 225 AYGETEFIFNSCKILMVAGFIILSVVINCGGAGVDGYIGGKYWRDPGSFAEGSGATRFKG 284
            +GE E IF+  K++ + GFII+ VV+  GG      IGGKYW DPG F   + + +FKG
Sbjct: 222 GFGEAESIFSLIKVITIIGFIIMGVVLISGGGPDHEVIGGKYWNDPGPFVGNAPSDKFKG 281

Query: 285 ICYILVSAYFSFGGIELFVLSINEQSNPRKSTPVAAKRSVYRXXXXXXXXXXXXGFNVPH 344
           +C + V+A FSF G EL  L+  E   PRKS P AAK+  +R            G  VP 
Sbjct: 282 VCSVFVTAAFSFAGSELIGLAAAETREPRKSIPKAAKQVFWRITLFYILSLLIVGLLVPS 341

Query: 345 NNDQLMGSGGSATHASPYVLAASIHKVRVIPHIINAVILISVISVANSALYAAPRLMCSL 404
           NN+ L+         SP+V+A  +H++RV+P IIN VIL +VISV NS++Y++ R MC+L
Sbjct: 342 NNEHLLAPQQIDAAHSPFVIAMDMHRIRVLPSIINVVILTAVISVGNSSVYSSSRTMCAL 401

Query: 405 AQQGYAPKFLNYIDREGRPLRAXXXXXXXXXXXXXACSPQEEQAFTWLAAIAGLSELFTW 464
           A+ G+ PK   YIDR+GRPL A             A + +E + F WL AI+GLS  FTW
Sbjct: 402 AEHGFLPKIFGYIDRKGRPLFAICFTSLFGLLCFVAGAKEEGEIFDWLLAISGLSSFFTW 461

Query: 465 SGIMLSHIRFRKAMKVQGRSLDEVGYKANTGIWGSYYGVFFNMLVFMAQFWVAL---SPI 521
             I L+H+RFR A+K QGR+ +E+ + + TG  GS Y V    +V +AQFWVAL   SP 
Sbjct: 462 LTINLAHMRFRMALKAQGRTTNELSFTSPTGFIGSCYAVGLICVVLVAQFWVALYPPSPD 521

Query: 522 GNGGKCDAQAFFESYLAAPLWIFMYVGYMVYKRDFTFLNPLDKIDLDFHRRVYDPEIMRQ 581
           G   K     FF+ YL+  + I MY+ + ++ R++ F     ++D+D  RR  D E+ ++
Sbjct: 522 GTSAKPSPILFFKQYLSFAVAIVMYLAHKIWSRNWKFFIKAKEMDIDTGRRELDLELFKE 581

Query: 582 EDEENKERLKN 592
           E  + +  L  
Sbjct: 582 ELAQERALLAQ 592

>KLLA0A06930g complement(625498..627261) similar to sp|P19145
           Saccharomyces cerevisiae YKR039w GAP1 general amino acid
           permease, hypothetical start
          Length = 587

 Score =  381 bits (979), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 226/548 (41%), Positives = 319/548 (58%), Gaps = 11/548 (2%)

Query: 43  HSEESRNGLV--HRFVDSFRRAESQRLEEDNDLEDGTKSMKSNNHLKKSMKSRHVVMMSL 100
            S+ SR G     RF DSFR AE+  L+      +    + +N  LK+++KSRH+ M+ +
Sbjct: 31  QSDTSRVGGTRWERFKDSFREAETVDLDPSLTPAEKMAILTANAPLKRTLKSRHLQMIGI 90

Query: 101 GTGIGTGLLVANAKGLSLAGPGSLVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGNFNAYN 160
           G  IGTGL V + K L+ AGP  ++IG+ +   + Y MV A GE+ VT+P + G +  Y 
Sbjct: 91  GGAIGTGLFVGSGKSLATAGPAGILIGWALTGTMIYCMVMAMGELAVTFP-VAGGYTTYA 149

Query: 161 SIFISKSFGFATTWLFCIQWLTVLPLELITSSMTVKYWNDTIN-ADXXXXXXXXXXXXXX 219
           S F+ +SFGFA   ++ + WL  LPLE++ +S+TV YW       D              
Sbjct: 150 SRFVDESFGFAFNTVYAMGWLITLPLEIVAASITVNYWGTPAKYRDAFVALFYVVIVGIN 209

Query: 220 XXGVKAYGETEFIFNSCKILMVAGFIILSVVINCGGAGVDGYIGGKYWRDPGSFAEGSGA 279
             GVK YGE EFIF+  K++ V GFIIL V++ CGG    GYIGG+ W +PG+FA G   
Sbjct: 210 LFGVKGYGEAEFIFSFIKVIAVIGFIILGVILVCGGGPQGGYIGGRLWHNPGAFANG--- 266

Query: 280 TRFKGICYILVSAYFSFGGIELFVLSINEQSNPRKSTPVAAKRSVYRXXXXXXXXXXXXG 339
             FKG+C + V+A FSF G EL  L+  E +NPRKS P AAK+  +R            G
Sbjct: 267 --FKGVCSVFVTAAFSFAGSELVGLAAAETANPRKSIPSAAKQVFWRITLFYILALLMVG 324

Query: 340 FNVPHNNDQLMGSGGSATHASPYVLAASIHKVRVIPHIINAVILISVISVANSALYAAPR 399
             VP+ +D+L+G       ASP+V++     ++ +P +IN VILI+V+SV N A++   R
Sbjct: 325 LLVPYTSDRLIGQSSVDAAASPFVISIQNAGIKGLPSVINVVILIAVLSVGNCAVFGCSR 384

Query: 400 LMCSLAQQGYAPKFLNYIDREGRPLRAXXXXXXXXXXXXXACSPQEEQAFTWLAAIAGLS 459
            M +LA QG  PK   YIDR GRPL               A SP+E + F WL A++GLS
Sbjct: 385 SMAALANQGSLPKIFGYIDRTGRPLVGIVVTCVFGLLSFIAASPKEGEVFDWLLALSGLS 444

Query: 460 ELFTWSGIMLSHIRFRKAMKVQGRSLDEVGYKANTGIWGSYYGVFFNMLVFMAQFWVALS 519
            LFTW GI+L HIR R+A+  Q R+  E+ + A T +WGS Y +   +L+ +AQFW+AL 
Sbjct: 445 SLFTWGGILLCHIRVRRALAAQNRTTAELSFTAPTDVWGSVYSLILIILILIAQFWIALF 504

Query: 520 PIGNGGKCDAQAFFESYLAAPLWIFMYVGYMVYKRDFTFLNPLDKIDLDFHRRVYDPEIM 579
           PI  GGK  A AFFE+YL+ P++I  Y+G+ ++K+++        ID+D  RR  D E +
Sbjct: 505 PI--GGKPSAAAFFEAYLSFPIYIVFYIGHKIWKKNWKLFIKASDIDIDSGRRETDIEAL 562

Query: 580 RQEDEENK 587
           +QE  E K
Sbjct: 563 KQEIAEEK 570

>AEL030W [2476] [Homologous to ScYOL020W (TAT2) - SH]
           complement(577332..579551) [2220 bp, 739 aa]
          Length = 739

 Score =  375 bits (964), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 204/590 (34%), Positives = 326/590 (55%), Gaps = 30/590 (5%)

Query: 5   IVTSSKMEKSAEFEVTDSALYNNFNTSTTASLTPEIKEHSEESRNGLVHRFVDSFRRAES 64
           ++    +EK+A      SA+       ++      + E S  ++ GLV R +DSF+    
Sbjct: 158 MIHQKDVEKAASELSNTSAVQRVLKKRSSVLEESRLLEESRTNKRGLVRRCIDSFKPPVD 217

Query: 65  QRLEEDNDLEDGTKSMKSNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLSLAGPGSL 124
              + DN              LK+++KSRH++M+++G  IGTGL + + K L+  GP ++
Sbjct: 218 GSFDPDN--------------LKRTLKSRHLIMIAIGGSIGTGLFIGSGKALATGGPLAV 263

Query: 125 VIGYVMVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFISKSFGFATTWLFCIQWLTVL 184
           +IG+ +        +   GE+ V +P + G F  Y++ F+  S  F  + ++ +QW  VL
Sbjct: 264 LIGWTLAGTQMVGTIHGLGEVTVRFPVV-GAFANYSTRFLDPSVSFVVSSIYVLQWFFVL 322

Query: 185 PLELITSSMTVKYWNDTINADXXXXXXXXXXXXXXXXGVKAYGETEFIFNSCKILMVAGF 244
           PLE+I S++T+++W  +++                  GV+ +G+ +F+F+  K++ + GF
Sbjct: 323 PLEIIASAITMEFWTTSVDPVVWVAVFYTLIISINLFGVRWFGKPKFVFSVIKMVPICGF 382

Query: 245 IILSVVINCGGAGVDGYIGGKYWRDPGSFAEGSGATRFKGICYILVSAYFSFGGIELFVL 304
           IIL +V+  GG     +IG +YW DPG+ A G     FKG+  ++V+A +S GG E+  L
Sbjct: 383 IILCLVLILGGGPTHEFIGARYWHDPGALANG-----FKGVAAVMVTASYSLGGSEMTCL 437

Query: 305 SINEQSNPRKSTPVAAKRSVYRXXXXXXXXXXXXGFNVPHNNDQLMGSGGSATHASPYVL 364
           +  E ++P K  P A K+  +R            GF VP+ NDQL+G  GS  + SP+V+
Sbjct: 438 ASGE-TDP-KEIPHAIKQIFWRIIFFFLVSLTLVGFLVPYTNDQLLG--GSNVNNSPFVI 493

Query: 365 AASIHKVRVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPKFLNYIDREGRPL 424
           A  +H +RV+PHIIN VIL+S++SV NS ++A+ R +CS+A QG  P+   Y+DR GRPL
Sbjct: 494 AIKMHNIRVLPHIINGVILVSILSVGNSCIFASSRTLCSMAHQGLLPRIFGYVDRAGRPL 553

Query: 425 RAXXXXXXXXXXXXXACSPQEEQAFTWLAAIAGLSELFTWSGIMLSHIRFRKAMKVQGRS 484
                            S      FTWL A+AGL+    W  I +SHIRFR AMK QG+S
Sbjct: 554 TGILTNSLFGLLAFLVKSSSTGTVFTWLMAVAGLATAVVWLSINVSHIRFRLAMKAQGKS 613

Query: 485 LDEVGYKANTGIWGSYYGVFFNMLVFMAQFWVALSPIG--NGGKCDAQAFFESYLAAPLW 542
           LDE+ + +  G+WGS Y    N++V +AQF+V+L PI      +   +AFF++YL A + 
Sbjct: 614 LDELEFVSAVGMWGSVYSGVMNVVVLVAQFYVSLWPIEGWKDPRGRTEAFFQNYLCALIL 673

Query: 543 IFMYVGYMVYKRDFT----FLNPLDKIDLDFHRRVYDPEIMRQEDEENKE 588
           +FM+V + +Y R  T     + PL +IDL+  R+  D E+++ E    K+
Sbjct: 674 LFMFVAHKIYYRSTTGQWWKILPLAEIDLESGRKNIDIEVVKHEVAARKK 723

>YOL020W (TAT2) [4796] chr15 (286172..287950) High affinity
           tryptophan permease, also transports other aromatic
           amino acids, alanine and glycine, member of the amino
           acid permease family [1779 bp, 592 aa]
          Length = 592

 Score =  371 bits (952), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 207/554 (37%), Positives = 302/554 (54%), Gaps = 30/554 (5%)

Query: 45  EESRNGLVHRFVDSFRRAESQRLEEDNDLEDGTKSMKSNNHLKKSMKSRHVVMMSLGTGI 104
           +  +  +  R VDSF+       +  N              LK+++K RH++M+++G  I
Sbjct: 51  QHGKRNIFQRCVDSFKSPLDGSFDTSN--------------LKRTLKPRHLIMIAIGGSI 96

Query: 105 GTGLLVANAKGLSLAGPGSLVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFI 164
           GTGL V + K ++  GP  +VIG+ +        +   GE+ V +P + G F  Y + F+
Sbjct: 97  GTGLFVGSGKAIAEGGPLGVVIGWAIAGSQIIGTIHGLGEITVRFPVV-GAFANYGTRFL 155

Query: 165 SKSFGFATTWLFCIQWLTVLPLELITSSMTVKYWNDTINADXXXXXXXXXXXXXXXXGVK 224
             S  F  + ++ +QW  VLPLE+I ++MTV+YWN +I+                  GV+
Sbjct: 156 DPSISFVVSTIYVLQWFFVLPLEIIAAAMTVQYWNSSIDPVIWVAIFYAVIVSINLFGVR 215

Query: 225 AYGETEFIFNSCKILMVAGFIILSVVINCGGAGVDGYIGGKYWRDPGSFAEGSGATRFKG 284
            +GE EF F++ K + V GFIIL VV+ CGG     +IG KYW DPG  A G     F G
Sbjct: 216 GFGEAEFAFSTIKAITVCGFIILCVVLICGGGPDHEFIGAKYWHDPGCLANG-----FPG 270

Query: 285 ICYILVSAYFSFGGIELFVLSINEQSNPRKSTPVAAKRSVYRXXXXXXXXXXXXGFNVPH 344
           +  +LV A +S GGIE+  L+  E ++P K  P A K+  +R            GF VP+
Sbjct: 271 VLSVLVVASYSLGGIEMTCLASGE-TDP-KGLPSAIKQVFWRILFFFLISLTLVGFLVPY 328

Query: 345 NNDQLMGSGGSATHASPYVLAASIHKVRVIPHIINAVILISVISVANSALYAAPRLMCSL 404
            N  L+G  GS+   SP+V+A  +H ++ +P I+NAVILISV+SV NS ++A+ R +CS+
Sbjct: 329 TNQNLLG--GSSVDNSPFVIAIKLHHIKALPSIVNAVILISVLSVGNSCIFASSRTLCSM 386

Query: 405 AQQGYAPKFLNYIDREGRPLRAXXXXXXXXXXXXXACSPQEEQAFTWLAAIAGLSELFTW 464
           A QG  P +  YIDR GRPL                 S    + F WL AIAGL+    W
Sbjct: 387 AHQGLIPWWFGYIDRAGRPLVGIMANSLFGLLAFLVKSGSMSEVFNWLMAIAGLATCIVW 446

Query: 465 SGIMLSHIRFRKAMKVQGRSLDEVGYKANTGIWGSYYGVFFNMLVFMAQFWVALSPIG-- 522
             I LSHIRFR AMK QG+SLDE+ + +  GIWGS Y    N L+ +AQF+ +L PIG  
Sbjct: 447 LSINLSHIRFRLAMKAQGKSLDELEFVSAVGIWGSAYSALINCLILIAQFYCSLWPIGGW 506

Query: 523 NGGKCDAQAFFESYLAAPLWIFMYVGYMVYKRDFT----FLNPLDKIDLDFHRRVYDPEI 578
             GK  A+ FF++YL A + +F+++ + +Y +  T     +  L  IDL+  R+  D EI
Sbjct: 507 TSGKERAKIFFQNYLCALIMLFIFIVHKIYYKCQTGKWWGVKALKDIDLETDRKDIDIEI 566

Query: 579 MRQEDEENKERLKN 592
           ++QE  E K  L +
Sbjct: 567 VKQEIAEKKMYLDS 580

>CAGL0D02178g 222597..224330 highly similar to sp|P38967
           Saccharomyces cerevisiae YOL020w SCM2 high affinity
           tryptophan transport protein, hypothetical start
          Length = 577

 Score =  370 bits (950), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 203/579 (35%), Positives = 314/579 (54%), Gaps = 31/579 (5%)

Query: 20  TDSALYNNFNTSTTASLTPEIKEHSEESRNGLVHRFVDSFRRAESQRLEEDNDLEDGTKS 79
           T ++ +  +++      + E  E     RN +  R VDSF+       +  N        
Sbjct: 12  TSTSEFTKYDSQKPYYSSGESPEPVVTKRN-IFQRCVDSFKPPVDGSFDTSN-------- 62

Query: 80  MKSNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLSLAGPGSLVIGYVMVSFVTYFMV 139
                 LK+++KSRH++M+++G  IGTGL + + + L+  GP +++IG+ +        +
Sbjct: 63  ------LKRTLKSRHLIMIAIGGSIGTGLFIGSGQALATGGPLAVIIGWTIAGSQIVGTI 116

Query: 140 QAAGEMGVTYPTLPGNFNAYNSIFISKSFGFATTWLFCIQWLTVLPLELITSSMTVKYWN 199
              GE+ V +P + G F  Y++ F+  S  F  + ++ IQW  VLPLE+I S++T++YWN
Sbjct: 117 HGLGEITVRFPVV-GAFADYSTRFLDPSISFVVSTIYVIQWFFVLPLEIIASAITIQYWN 175

Query: 200 DTINADXXXXXXXXXXXXXXXXGVKAYGETEFIFNSCKILMVAGFIILSVVINCGGAGVD 259
            +I+                  G + +GE EF+F++ K + + GFIIL +V+ CGG    
Sbjct: 176 SSIDPVVWVAIFYGVIVSINLFGARGFGEAEFVFSTIKAITICGFIILCIVLICGGGPDH 235

Query: 260 GYIGGKYWRDPGSFAEGSGATRFKGICYILVSAYFSFGGIELFVLSINEQSNPRKSTPVA 319
            +IG KYW DPG+ A G     F G+  +LV A +S GG E+  L+  E ++P K  P A
Sbjct: 236 EFIGAKYWHDPGALAHG-----FPGVLSVLVVASYSLGGTEMTCLASGE-TDP-KELPSA 288

Query: 320 AKRSVYRXXXXXXXXXXXXGFNVPHNNDQLMGSGGSATHASPYVLAASIHKVRVIPHIIN 379
            K+  +R            GF VP+ N+ L+G  GS+   SP+V+A  +H ++ +P I+N
Sbjct: 289 IKQVFWRILFFFLASLTLVGFLVPYTNENLLG--GSSVDNSPFVIAIKLHHIKALPSIVN 346

Query: 380 AVILISVISVANSALYAAPRLMCSLAQQGYAPKFLNYIDREGRPLRAXXXXXXXXXXXXX 439
           AVILIS++SV NS ++A+ R +CS+A QG  P+F  YIDR GRPL               
Sbjct: 347 AVILISILSVGNSCIFASSRTLCSMAHQGLIPRFFGYIDRAGRPLAGIVTNSLFGLLAFL 406

Query: 440 ACSPQEEQAFTWLAAIAGLSELFTWSGIMLSHIRFRKAMKVQGRSLDEVGYKANTGIWGS 499
             S    + F WL AIAGL+    W  I LSHIRFR AMK Q ++LDE+ + +  GIWGS
Sbjct: 407 VKSSSVSEVFDWLMAIAGLATCIVWLSINLSHIRFRLAMKAQNKTLDELEFVSAVGIWGS 466

Query: 500 YYGVFFNMLVFMAQFWVALSPIGNGGKCD--AQAFFESYLAAPLWIFMYVGYMVYKR--- 554
            Y    N+L+ +AQF+++L PIG        A+ FF+SYL A + + ++  + VY R   
Sbjct: 467 AYSALINVLILIAQFYISLWPIGGWTDSSQRAKKFFQSYLCALIMLLIFCIHKVYYRVSF 526

Query: 555 -DFTFLNPLDKIDLDFHRRVYDPEIMRQEDEENKERLKN 592
             +  + PL  IDL+  R+  D ++++ E  E K  LK 
Sbjct: 527 GKWWDVKPLKDIDLETGRKNVDIDVIKAEIAERKMYLKK 565

>KLLA0A10813g complement(936126..937880) similar to sp|P38967
           Saccharomyces cerevisiae YOL020w SCM2 high affinity
           tryptophan transport protein, hypothetical start
          Length = 584

 Score =  343 bits (879), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 200/564 (35%), Positives = 311/564 (55%), Gaps = 37/564 (6%)

Query: 39  EIKEHSEESRN-GLVHRFVDSFRRAESQRLEEDNDLEDGTKSMKSNNHLKKSMKSRHVVM 97
           EI    +E +N  +V R +DSF+         DN              LK+ +KSRH++M
Sbjct: 36  EIDLDKKEDKNKNIVRRMIDSFKPPLDGSYHSDN--------------LKRKLKSRHLIM 81

Query: 98  MSLGTGIGTGLLVANAKGLSLAGPGSLVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGNFN 157
           +++G  IGTGL V + K L+  GP +++IG+ +        +   GE+ + +P + G F 
Sbjct: 82  IAIGGSIGTGLFVGSGKALATGGPLAMIIGWSIAGSQMVGTIHGLGEITMRFPVV-GAFA 140

Query: 158 AYNSIFISKSFGFATTWLFCIQWLTVLPLELITSSMTVKYWNDTINADXXXXXXXXXXXX 217
            Y++  +  S  F  + ++  QW  VLP+ELI S+MTV++W   ++              
Sbjct: 141 NYSTRLLDPSISFMVSSIYICQWYFVLPIELIASAMTVQFWTTKVDPVVWVAIFYVIVVS 200

Query: 218 XXXXGVKAYGETEFIFNSCKILMVAGFIILSVVINCGGAGVDGYIGGKYWRDPGSFAEGS 277
               GVK +GE EF F+  K++ + GFIILS+++ CGG     +IG +YW  PG+ A G 
Sbjct: 201 VNLFGVKVFGEAEFAFSLVKVITIIGFIILSIILICGGGPDHRFIGTEYWHHPGALANG- 259

Query: 278 GATRFKGICYILVSAYFSFGGIELFVLSINEQSNPRKSTPVAAKRSVYRXXXXXXXXXXX 337
               FKG+  + V+A +S GG E+  L  + +++P K  P A K+  +R           
Sbjct: 260 ----FKGVASVFVTASYSLGGSEMVCLC-SAETDP-KELPHAIKQVFWRIVFFFLVSLTL 313

Query: 338 XGFNVPHNNDQLMGSGGSATHASPYVLAASIHKVRVIPHIINAVILISVISVANSALYAA 397
            GF VP+ N+ L+G  GS+ + SP+V+A  +  +RV+P IINAVILIS++SV NS ++A+
Sbjct: 314 VGFLVPYTNENLLG--GSSVNNSPFVIAIKLSGIRVLPSIINAVILISILSVGNSCIFAS 371

Query: 398 PRLMCSLAQQGYAPKFLNYIDREGRPLRAXXXXXXXXXXXXXACSPQEEQAFTWLAAIAG 457
            R +CS+A QG  P+   Y+DR GRPL                 S      F WL AIAG
Sbjct: 372 SRTLCSMAHQGLIPRVFGYVDRAGRPLVGIIVNSLFGLLAFLVKSASMGVVFDWLMAIAG 431

Query: 458 LSELFTWSGIMLSHIRFRKAMKVQGRSLDEVGYKANTGIWGSYYGVFFNMLVFMAQFWVA 517
           L+    W  I +SHIRFR AMK Q RSLDE+ +K++ G++GS Y    N+L+ +AQF+++
Sbjct: 432 LATCVVWLSINISHIRFRLAMKAQNRSLDELEFKSSVGVYGSIYSATVNILILIAQFYIS 491

Query: 518 LSPIG--NGGKCDAQAFFESYLAAPLWIFMYVGYMVYKR-------DFTFLNPLDKIDLD 568
           L P+G     +   ++FF++YL A + +F++V + +Y +       DF    PL +IDL+
Sbjct: 492 LWPVGGWTSSQQRTESFFKNYLCALVLVFVFVTHKIYFKCSTGKWFDF---KPLAEIDLE 548

Query: 569 FHRRVYDPEIMRQEDEENKERLKN 592
             R+  D EI++QE  E +  L +
Sbjct: 549 TDRKNIDIEIVKQEVREREMYLAS 572

>Kwal_34.16254
          Length = 481

 Score =  323 bits (829), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 176/466 (37%), Positives = 253/466 (54%), Gaps = 25/466 (5%)

Query: 37  TPEIKEHSEESRN-GLVHRFVDSFRRAESQRLEEDNDLEDGTKSMKSNNHLKKSMKSRHV 95
           TPE       S N  ++ R VDSF+  E      DN              LKKS+K+RH+
Sbjct: 37  TPENDGVRRRSTNRNVLQRMVDSFKPPEDGSFHSDN--------------LKKSLKARHL 82

Query: 96  VMMSLGTGIGTGLLVANAKGLSLAGPGSLVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGN 155
           VM+++G  IGTGL + + K L+L GP +L+IG+ +        +   GE+ V +P + G 
Sbjct: 83  VMIAIGGSIGTGLFIGSGKALALGGPLALIIGWTIAGTQMVGTIHGLGEITVRFPVV-GA 141

Query: 156 FNAYNSIFISKSFGFATTWLFCIQWLTVLPLELITSSMTVKYWNDTINADXXXXXXXXXX 215
           F  Y + F+  S  F    ++ +QW  VLPLE+I ++MTV+YW+ +++            
Sbjct: 142 FADYGTRFLEPSISFVVVLIYVLQWCFVLPLEIIAAAMTVEYWDTSVSPVVWVAIFYGII 201

Query: 216 XXXXXXGVKAYGETEFIFNSCKILMVAGFIILSVVINCGGAGVDGYIGGKYWRDPGSFAE 275
                 GV+ +GE EF+F+  K++ + GFIIL +V+ CGG     ++G KYW DPG  A 
Sbjct: 202 ALINLVGVRGFGEAEFVFSLIKVITIVGFIILCIVLICGGGPKKEFVGAKYWHDPGPLAN 261

Query: 276 GSGATRFKGICYILVSAYFSFGGIELFVLSINEQSNPRKSTPVAAKRSVYRXXXXXXXXX 335
           G     FKG+  +LV A +S GG E+  L+  E ++P K  P A K+  +R         
Sbjct: 262 G-----FKGVAGVLVIASYSLGGTEMACLASGE-TDP-KELPSAIKQVFWRIVFFFLVSL 314

Query: 336 XXXGFNVPHNNDQLMGSGGSATHASPYVLAASIHKVRVIPHIINAVILISVISVANSALY 395
              GF VP+ N  LMG  GS+   SP+V+A  +H +  +P I+NAVIL+S++SV NS ++
Sbjct: 315 TLVGFLVPYTNQNLMG--GSSVDNSPFVIAIRLHGINALPSIVNAVILVSLLSVGNSCIF 372

Query: 396 AAPRLMCSLAQQGYAPKFLNYIDREGRPLRAXXXXXXXXXXXXXACSPQEEQAFTWLAAI 455
           A+ R +CS+A QG  P+   YIDR GRPL                 S      FTWL AI
Sbjct: 373 ASSRTLCSMAHQGLIPRVFGYIDRAGRPLTGILTNLLFGLLAFLVKSGSAGDVFTWLMAI 432

Query: 456 AGLSELFTWSGIMLSHIRFRKAMKVQGRSLDEVGYKANTGIWGSYY 501
           AGL+    W  I +SHIRFR AMK QG  L+E+ + +  GI+GS Y
Sbjct: 433 AGLATCVVWLSINISHIRFRLAMKAQGVDLEELEFVSGVGIYGSVY 478

>Kwal_56.22951
          Length = 596

 Score =  314 bits (804), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 209/587 (35%), Positives = 318/587 (54%), Gaps = 30/587 (5%)

Query: 18  EVTDSALYNNFNTSTTASLTPEIKEHSEESRNGLVHRFVDSFRRAESQRLEEDNDLEDGT 77
           +   S     +N  T+ SL    K+ S       +H    SF+R E+    E  DL   +
Sbjct: 12  QAVSSVESRTWNGETSGSLINRFKQKSRRQ----IHDIAHSFQRQEAPN-SEGVDLSLLS 66

Query: 78  KSMKSNNHL-----KKSMKSRHVVMMSLGTGIGTGLLVANAKGLSLA-GPGSLVIGYVMV 131
           +  + N  L     +KS+  RH++M+S+G  +GTGL +    G SLA GPGSL+IG+++V
Sbjct: 67  EEQRRNYELANQPYEKSLSQRHLMMISIGGTLGTGLFIG--LGFSLASGPGSLLIGFLIV 124

Query: 132 SFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFISKSFGFATTWLFCIQWLTVLPLELITS 191
             + + +VQ+A EM   YP + G+F+ + S F+  S GF  +  + + WL   P ELI  
Sbjct: 125 GLMMFCVVQSAAEMACQYP-VSGSFSTHVSRFMEPSIGFTVSTNYALAWLISFPSELIGC 183

Query: 192 SMTVKYWNDTINADXXXXXXXXXXXXXXXXGVKAYGETEFIFNSCKILMVAGFIILSVVI 251
           ++T++YW+ ++N                  GV+ YGE EF  +  K++ +  FII+ +V+
Sbjct: 184 AITLRYWS-SVNGAVWVAIFYVFIMQLNLFGVRGYGEAEFWMSLFKVVAIVIFIIIGIVL 242

Query: 252 NCGGA-GVDGYIGGKYWRDPGSFAEGSGATRFKGICYILVSAYFSFGGIELFVLSINEQS 310
            CGG     GYIG KYW +PGSFA+      FKG+C   +SA FSFGG EL VL+ +E S
Sbjct: 243 ICGGGPHSSGYIGTKYWHNPGSFAK----PVFKGLCNTFISAAFSFGGAELVVLTASE-S 297

Query: 311 NPRKSTPVAAKRSVYRXXXXXXXXXXXXGFNVPHNNDQLMGSG-GSATHASPYVLAASIH 369
              +S   AAK + +R            G  VP+ +D+L+G   G    ASP+V+A S  
Sbjct: 298 KKVESVSRAAKGTFWRIAIFYITTVVVIGCLVPYTDDRLLGGDTGEDITASPFVIALSGQ 357

Query: 370 KV--RVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPKFLNYIDREGRPLRAX 427
                 + H +NAVILI+V+SV NS +YA+ R++ +L   G  P+   YID++GRPL   
Sbjct: 358 GSMGTKVSHFMNAVILIAVLSVCNSCVYASSRVIQALGACGQLPRACGYIDKKGRPLVGI 417

Query: 428 XXXXXXXXXXXXACSPQEEQAFTWLAAIAGLSELFTWSGIMLSHIRFRKAMKVQGRSLDE 487
                           +++  FTWL A+  +S  FTW  I +S +RFR A++ QGRS DE
Sbjct: 418 AICGVFGLLGFLVACDKQDDVFTWLFALCSISSFFTWFCICVSQVRFRLALRAQGRSTDE 477

Query: 488 VGYKANTGIWGSYYGVFFNMLVFMAQFWVALSPIGNGGKCDAQAFFESYLAAPLWIFMYV 547
           + +K+  GI+G   G   N+L+   + +V++ P+  GG   A+ FF+  ++ P+ I +Y 
Sbjct: 478 IAHKSMLGIYGGILGGVLNILLIAGEIYVSIFPL--GGSPSAEQFFQYCMSIPIMIVVYA 535

Query: 548 GYMVYK---RDFT-FLNPLDKIDLDFHRRVYDPEIMRQEDEENKERL 590
            +  YK   RD    L PL +IDLD  RR+ D E+ + E EE+K R+
Sbjct: 536 LHKTYKATRRDAKRILVPLSEIDLDSGRRIQDIELFKHELEEDKARI 582

>KLLA0B06776g 594172..595938 similar to sgd|S0006195 Saccharomyces
           cerevisiae YPL274w SAM3 high affinity
           S-adenosylmethionine permease, start by similarity
          Length = 588

 Score =  310 bits (793), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 207/578 (35%), Positives = 315/578 (54%), Gaps = 29/578 (5%)

Query: 30  TSTTASLTPEIKEHSEESRNGLVHRFVDSFRRAESQRLEEDNDLEDGTKSM---KSNNHL 86
           T  + + T  +    + SR+ L  R  DSF+R   Q L E   ++  T SM   +  N+L
Sbjct: 13  TQVSENFTQSLYTDEDGSRS-LFTRVKDSFKR---QELVETEGIDLDTYSMTDYQRTNYL 68

Query: 87  ------KKSMKSRHVVMMSLGTGIGTGLLVANAKGLSLA-GPGSLVIGYVMVSFVTYFMV 139
                 +K++  RH+ M+++G  +GTGL +    G SLA GPG+L+IG+++     + +V
Sbjct: 69  LAKQPYQKNLSQRHLTMIAIGGTLGTGLFIG--IGWSLASGPGNLLIGFLLTGLAIFCVV 126

Query: 140 QAAGEMGVTYPTLPGNFNAYNSIFISKSFGFATTWLFCIQWLTVLPLELITSSMTVKYWN 199
           Q A E+   YP + G+F ++ S F+  S+GF  T  +C+ W    P ELI  +MT+ YW+
Sbjct: 127 QCAAELSCQYP-VSGSFASHVSRFVDPSWGFTVTTNYCLAWSISFPSELIGCAMTIGYWD 185

Query: 200 DTINADXXXXXXXXXXXXXXXXGVKAYGETEFIFNSCKILMVAGFIILSVVINCGGA-GV 258
            ++N                  GV+ + ETE++ +  KIL +  F+I+ VV+ CGG    
Sbjct: 186 SSVNPVVWVIIFWLFIMALNLFGVRGFAETEYVLSIFKILAIIIFLIIGVVLICGGGPNS 245

Query: 259 DGYIGGKYWRDPGSFAEGSGATRFKGICYILVSAYFSFGGIELFVLSINEQSNPRKSTPV 318
           +GYIG KYW DPGSF     A  FK +C   VSA FSFGG EL VL+  E S   +S   
Sbjct: 246 NGYIGTKYWHDPGSFK----APVFKSLCNTFVSAAFSFGGTELVVLTAAE-SRKVESISR 300

Query: 319 AAKRSVYRXXXXXXXXXXXXGFNVPHNNDQLMGSGGSA-THASPYVLA-ASIHKV-RVIP 375
           AAK + +R            G  VP+ +++L+G   S    ASP+V+A A+  K    + 
Sbjct: 301 AAKGTFWRVIVFYVSTVVVIGCLVPYTDERLLGGDTSEDIAASPFVIALANTGKFGERVS 360

Query: 376 HIINAVILISVISVANSALYAAPRLMCSLAQQGYAPKFLNYIDREGRPLRAXXXXXXXXX 435
           + +NAVILI+V+SV NS +YAA R++ SL   G  P    Y+DR+GRPL           
Sbjct: 361 NFMNAVILIAVLSVCNSCVYAASRVIQSLGASGQLPSICGYVDRKGRPLFGILVVGLFGF 420

Query: 436 XXXXACSPQEEQAFTWLAAIAGLSELFTWSGIMLSHIRFRKAMKVQGRSLDEVGYKANTG 495
                 S +  + F WL A+  +S +F W  I  S++R+R A+K Q RS DE+ YK+  G
Sbjct: 421 LPFIVASNKVSEVFDWLFALCSISSMFIWFSICYSYLRYRWALKKQNRSADEIAYKSMLG 480

Query: 496 IWGSYYGVFFNMLVFMAQFWVALSPIGNGGKCDAQAFFESYLAAPLWIFMYVGYMVYKRD 555
           IWG+Y G+  + L+ + + +V+L P+G      A+AFF+  L+ P+ I +Y+G+  Y  +
Sbjct: 481 IWGAYLGLLLSALLIVGEIYVSLFPLGESP--SAEAFFKYCLSIPIMIAVYIGHKSYTGN 538

Query: 556 F-TFLNPLDKIDLDFHRRVYDPEIMRQEDEENKERLKN 592
           + +F+ PL  IDLD      D EIM+ E E  + +L +
Sbjct: 539 WKSFVIPLSGIDLDTGLSHSDVEIMKHELEIQRVKLAS 576

>Scas_536.1
          Length = 372

 Score =  293 bits (749), Expect = 7e-94,   Method: Compositional matrix adjust.
 Identities = 161/361 (44%), Positives = 228/361 (63%), Gaps = 4/361 (1%)

Query: 233 FNSCKILMVAGFIILSVVINCGGAGVDGYIGGKYWRDPGSF-AEGSGATRFKGICYILVS 291
           F+  K+  V GFIIL +V+ CGG    G++G KYW DPG+F   GSGA +FKG+C + V+
Sbjct: 3   FSIIKVTTVIGFIILGIVLVCGGGPKGGFVGAKYWHDPGAFVGHGSGA-QFKGVCSVFVT 61

Query: 292 AYFSFGGIELFVLSINEQSNPRKSTPVAAKRSVYRXXXXXXXXXXXXGFNVPHNNDQLMG 351
           A FSF G EL  ++  E +NPRKS P AAK+ V+R            G  VP+N+ +L+G
Sbjct: 62  AAFSFAGSELIGITAAEAANPRKSIPGAAKQVVWRIVLFYMGTLTMIGLLVPYNDKRLIG 121

Query: 352 SGGSATHASPYVLAASIHKVRVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAP 411
           +      ASP+V+A   H ++ +P +IN VILI+V+SV NSA++A  R + +L+ QG+ P
Sbjct: 122 ASSVDAAASPFVIAIVTHGIKGLPSVINVVILIAVLSVGNSAIFACSRTIAALSDQGFLP 181

Query: 412 KFLNYIDREGRPLRAXXXXXXXXXXXXXACSPQEEQAFTWLAAIAGLSELFTWSGIMLSH 471
           K   YIDR GRPL               A S +E + F WL A++GLS LFTW GI L H
Sbjct: 182 KVFGYIDRSGRPLVGIAITSTFGLLAFVAASKKEGEVFNWLLALSGLSSLFTWGGICLCH 241

Query: 472 IRFRKAMKVQGRSLDEVGYKANTGIWGSYYGVFFNMLVFMAQFWVALSPIGNGGKCDAQA 531
           IRFR A+K QGR  +E+ + +  G+ GSY+G+F  +L+F+AQF+VAL P   GGK DA+ 
Sbjct: 242 IRFRMALKAQGRDTNELTFVSPAGVAGSYWGLFMIVLMFIAQFYVALFP--PGGKPDAEV 299

Query: 532 FFESYLAAPLWIFMYVGYMVYKRDFTFLNPLDKIDLDFHRRVYDPEIMRQEDEENKERLK 591
           FF+SYL+ P+ +  Y G+ +YKR++    PL+ +D+D  RR  D E+++QE  E K  L 
Sbjct: 300 FFQSYLSFPIVVATYFGHKIYKRNWKLFIPLEDMDIDTGRRETDMELLKQEIMEEKAILA 359

Query: 592 N 592
           +
Sbjct: 360 S 360

>YLL061W (MMP1) [3363] chr12 (17956..19707) High affinity
           S-methylmethionine permease, member of the amino
           acid-polyamine-choline (APC) family of membrane
           transporters [1752 bp, 583 aa]
          Length = 583

 Score =  298 bits (762), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 192/557 (34%), Positives = 296/557 (53%), Gaps = 25/557 (4%)

Query: 49  NGLVHRFVDSFRRAESQRLEEDNDLEDGTKSMK-----SNNHLKKSMKSRHVVMMSLGTG 103
           N L+HRF +SF+R +S  ++E     + ++  K     +N   KK +  RH+ M+++G  
Sbjct: 27  NNLIHRFKNSFKRNDSPAIQEGLLYSELSEEEKIQWDLANQPYKKVLDQRHLTMIAIGGT 86

Query: 104 IGTGLLVANAKGLSLAGPGSLVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIF 163
           +GTGL +   + L+ +GP SL+IG+++V      +VQ   E+   YP + G++  + S F
Sbjct: 87  LGTGLFIGLGESLA-SGPASLLIGFLLVGASMLCVVQCGAELSCQYP-VSGSYALHASRF 144

Query: 164 ISKSFGFATTWLFCIQWLTVLPLELITSSMTVKYWNDTINADXXXXXXXXXXXXXXXXGV 223
           I  S GF+    + + WL   P EL+  S+T+ YW  ++N                  G 
Sbjct: 145 IDPSVGFSIGINYLLMWLISYPSELVGCSLTISYWAPSVNPAAWVAIAFVLSMLLNLFGA 204

Query: 224 KAYGETEFIFNSCKILMVAGFIILSVVINCGGAGVD--GYIGGKYWRDPGSFAEGSGATR 281
           + + E+EF  +  KI+ +  FII+ +V+  GG G D  GYIG KYW DPGSFA       
Sbjct: 205 RGFAESEFYMSIFKIVALFIFIIIGIVLIAGG-GPDSTGYIGTKYWHDPGSFA----VPV 259

Query: 282 FKGICYILVSAYFSFGGIELFVLSINEQSNPRKSTPVAAKRSVYRXXXXXXXXXXXXGFN 341
           FK +C   VSA +SF G E+ VL+  E +    S   AAK + +R            G  
Sbjct: 260 FKNLCNTFVSAAYSFSGTEMVVLTSTE-ARSVSSVSRAAKGTFWRIIIFYIVTVIIIGCL 318

Query: 342 VPHNNDQLM-GSGGSATHASPYVLAAS---IHKVRVIPHIINAVILISVISVANSALYAA 397
           VP+N+ +L+ GS      ASP+V+A S       RV  H +NAVILI+V SV NS +YA+
Sbjct: 319 VPYNDPRLISGSSSEDITASPFVIALSNTGAMGTRV-SHFMNAVILIAVFSVCNSCVYAS 377

Query: 398 PRLMCSLAQQGYAPKFLNYIDREGRPLRAXXXXXXXXXXXXXACSPQEEQAFTWLAAIAG 457
            RL+  LA  G  PK   Y+DR GRPL                 S  +   FTWL A+  
Sbjct: 378 SRLIQGLATAGQLPKICAYMDRNGRPLVGMAICGAFGLLGFLVVSKNQGTVFTWLFALCS 437

Query: 458 LSELFTWSGIMLSHIRFRKAMKVQGRSLDEVGYKANTGIWGSYYGVFFNMLVFMAQFWVA 517
           +S   TW  I    +RFR AMK QGRS D++ Y++  GI+G  +G   N+L+ + + +V+
Sbjct: 438 ISFFTTWFCICFCQVRFRMAMKAQGRSKDDIIYRSTLGIYGGIFGCILNVLLVIGEIYVS 497

Query: 518 LSPIGNGGKCDAQAFFESYLAAPLWIFMYVGYMVYKRDFT--FLNPLDKIDLDFHRRVYD 575
            +P+G+     A  FFE  ++ P+ I +Y+G+ +Y+RD+   ++  +D IDLD    + D
Sbjct: 498 AAPVGS--PSSAANFFEYCMSIPIMIAVYIGHRIYRRDWRHWYIKRMD-IDLDSGHSLED 554

Query: 576 PEIMRQEDEENKERLKN 592
            E  + E +E+K+ + +
Sbjct: 555 FEATKLERDEDKKYVSS 571

>YPL274W (SAM3) [5177] chr16 (22938..24701) High affinity
           S-adenosylmethionine permease, member of the amino acid
           permease family of membrane transporters [1764 bp, 587
           aa]
          Length = 587

 Score =  285 bits (729), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 190/561 (33%), Positives = 302/561 (53%), Gaps = 22/561 (3%)

Query: 44  SEESRNG-LVHRFVDSFRRAESQRLEEDNDLEDGTKSMK-----SNNHLKKSMKSRHVVM 97
           ++  R+G L+ R  DSF+++    + ED +  + T+  K     ++   +K +  RH+ M
Sbjct: 25  NDSDRSGSLIRRMKDSFKQSNLHVIPEDLENSEQTEQEKIQWKLASQPYQKVLSQRHLTM 84

Query: 98  MSLGTGIGTGLLVANAKGLSLA-GPGSLVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGNF 156
           +++G  +GTGL +    G SLA GP +L+IG+++V    + +VQ+A E+   +P + G++
Sbjct: 85  IAIGGTLGTGLFIG--LGYSLASGPAALLIGFLLVGTSMFCVVQSAAELSCQFP-VSGSY 141

Query: 157 NAYNSIFISKSFGFATTWLFCIQWLTVLPLELITSSMTVKYWNDTINADXXXXXXXXXXX 216
             + S FI +S GF     + + WL   P ELI  ++T+ YWN T+N             
Sbjct: 142 ATHVSRFIDESVGFTVATNYALAWLISFPSELIGCALTISYWNQTVNPAVWVAIFYVFIM 201

Query: 217 XXXXXGVKAYGETEFIFNSCKILMVAGFIILSVVINCGGA-GVDGYIGGKYWRDPGSFAE 275
                GV+ + ETEF  +  K++ +  FII+ +V+  GG     GYIG KYW DPG+FA+
Sbjct: 202 VLNLFGVRGFAETEFALSIIKVIAIFIFIIIGIVLIAGGGPNSTGYIGAKYWHDPGAFAK 261

Query: 276 GSGATRFKGICYILVSAYFSFGGIELFVLSINEQSNPRKSTPVAAKRSVYRXXXXXXXXX 335
                 FK +C   VSA FSFGG EL +L+  E  N   +   AAK + +R         
Sbjct: 262 ----PVFKNLCNTFVSAAFSFGGSELVLLTSTESKNI-SAISRAAKGTFWRIAIFYITTV 316

Query: 336 XXXGFNVPHNNDQLM-GSGGSATHASPYVLAASIHKVR--VIPHIINAVILISVISVANS 392
              G  VP+N+ +L+ GS      ASP+V+A S        + + +N VIL++V+SV NS
Sbjct: 317 VIIGCLVPYNDPRLLSGSNSEDVSASPFVIALSNTGSMGAKVSNFMNVVILVAVVSVCNS 376

Query: 393 ALYAAPRLMCSLAQQGYAPKFLNYIDREGRPLRAXXXXXXXXXXXXXACSPQEEQAFTWL 452
            +YA+ RL+ +L   G  P   +Y+DR+GRPL                 S +E++ FTWL
Sbjct: 377 CVYASSRLIQALGASGQLPSVCSYMDRKGRPLVGIGISGAFGLLGFLVASKKEDEVFTWL 436

Query: 453 AAIAGLSELFTWSGIMLSHIRFRKAMKVQGRSLDEVGYKANTGIWGSYYGVFFNMLVFMA 512
            A+  +S  FTW  I +S IRFR A+K QGRS DE+ YK+  G++G   G   N L+   
Sbjct: 437 FALCSISSFFTWFCICMSQIRFRMALKAQGRSNDEIAYKSILGVYGGILGCVLNALLIAG 496

Query: 513 QFWVALSPIGNGGKCDAQAFFESYLAAPLWIFMYVGYMVYKRDFT-FLNPLDKIDLDFHR 571
           + +V+ +P+G+     A+AFFE  L+ P+ I +Y  +  Y+RD+  F     +IDLD   
Sbjct: 497 EIYVSAAPVGS--PSSAEAFFEYCLSIPIMIVVYFAHRFYRRDWKHFYIKRSEIDLDTGC 554

Query: 572 RVYDPEIMRQEDEENKERLKN 592
            V + E+ + + E  ++ + +
Sbjct: 555 SVENLELFKAQKEAEEQLIAS 575

>KLLA0C02365g 208462..210201 similar to sp|P32487 Saccharomyces
           cerevisiae YNL268w LYP1 lysine-specific high-affinity
           permease, hypothetical start
          Length = 579

 Score =  274 bits (701), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 168/528 (31%), Positives = 269/528 (50%), Gaps = 15/528 (2%)

Query: 64  SQRLEEDNDLEDGTKSMKSNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLSLAGPGS 123
           S  L +  + E+G         +K+++K RHV M++LG  IGTGL V  AK LSL+GP  
Sbjct: 52  SSELYDHAESEEGEGDFH-ETEVKRALKPRHVSMIALGGTIGTGLFVGIAKPLSLSGPVG 110

Query: 124 LVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFISKSFGFATTWLFCIQWLTV 183
            +I Y+ +  V YF+ Q+ GEM  T+  +  +   ++  F+S +FG A  +++   W   
Sbjct: 111 SLIAYIFMGSVVYFVTQSLGEMA-TFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAIT 169

Query: 184 LPLELITSSMTVKYWNDTINADXXXXXXXXXXXXXXXXGVKAYGETEFIFNSCKILMVAG 243
             +EL      + YW D +                    VK YGE EF   S K++ + G
Sbjct: 170 YAVELSVLGQIINYWTDAVPLAAWIAIFWVLLTAANFFPVKWYGEFEFCVASIKVIAIVG 229

Query: 244 FIILSVVINCGGAGVDGYIGGKYWRDPGSFAEGSGA-----TRFKGICYILVSAYFSFGG 298
           +++ +++I CGG+   G IG +YWR+PG +  G+ A      RF G    LV+A F++ G
Sbjct: 230 YLLYALIIVCGGSS-QGPIGFRYWRNPGPWGTGTIAKNVNKARFLGWVGSLVNASFTYQG 288

Query: 299 IELFVLSINEQSNPRKSTPVAAKRSVYRXXXXXXXXXXXXGFNVPHNNDQLMGSGGSATH 358
            EL  ++  E SNPRK+ P A  +  +R            G  VP+N+ QL  S  +   
Sbjct: 289 TELVGITAGEASNPRKTVPKAINKVFFRILVFYIGSLFFVGLLVPYNSPQLE-SNSAVIA 347

Query: 359 ASPYVLAASIHKVRVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPKFLNYID 418
           +SP+V++      +V+P I NAV+L++++S  NS +Y   R++ SLA  G APK  +Y+ 
Sbjct: 348 SSPFVISIQNAGTKVLPDIFNAVVLVTILSAGNSNVYVGSRVLYSLALSGNAPKQFSYVT 407

Query: 419 REGRPLRAXXXXXXXXXXXXXACSPQEEQAFTWLAAIAGLSELFTWSGIMLSHIRFRKAM 478
           ++G P                A +     AF WL  I+ L+ L  W  I ++HIRF + +
Sbjct: 408 KQGVPYLGVICTALLGLLAFLATNENANTAFNWLINISTLAGLCAWFFISVAHIRFMQCL 467

Query: 479 KVQGRSLDEVGYKANTGIWGSYYGVFFNMLVFMAQFWVALSPIGNGGKCDAQAFFESYLA 538
           K++G S D + +KA    WG+YY  FF  L+   Q + A +P     + D   FF +Y++
Sbjct: 468 KLRGISRDSLPFKAKLMPWGAYYAAFFVGLIVFIQGFTAFAP-----RFDVSEFFTAYIS 522

Query: 539 APLWIFMYVGYMVYKRDFTFLNPLDKIDLDFHRRVYDPEIMRQEDEEN 586
             L + +++   +Y R   FL  ++ ID+D  RR  D  I   ++ +N
Sbjct: 523 LILLVVLFILCQLYYRC-RFLTKIEDIDIDSDRREIDAIIWEDDEPKN 569

>CAGL0J08162g complement(801555..803348) Highly similar to sp|P32487
           Saccharomyces cerevisiae YNL268w LYP1 or sp|P04817
           Saccharomyces cerevisiae YEL063c CAN1 or sp|P38971
           Saccharomyces cerevisiae YNL270c ALP1, hypothetical
           start
          Length = 597

 Score =  273 bits (697), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 163/509 (32%), Positives = 261/509 (51%), Gaps = 14/509 (2%)

Query: 83  NNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLSLAGPGSLVIGYVMVSFVTYFMVQAA 142
           +  +K+++K RH+ M++LG  IGTGL V  +  LS +GP   +I Y+ +  + YF+ Q+ 
Sbjct: 88  DTRVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNSGPVGALIAYIFMGTIIYFVTQSL 147

Query: 143 GEMGVTYPTLPGNFNAYNSIFISKSFGFATTWLFCIQWLTVLPLELITSSMTVKYWNDTI 202
           GEM  T+  +  +   ++  F+S +FG A  +++   W     +E+      ++YW   +
Sbjct: 148 GEMA-TFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEVSVIGQVIQYWTFKV 206

Query: 203 NADXXXXXXXXXXXXXXXXGVKAYGETEFIFNSCKILMVAGFIILSVVINCGGAGVDGYI 262
                               VK YGE EF   S K++ + G++I +++I CGG+   G I
Sbjct: 207 PLAAWIGIFWVLITLMNFFPVKIYGEFEFWVASIKVIAIVGYLIYALIIVCGGSH-QGPI 265

Query: 263 GGKYWRDPGSFAEGS-----GATRFKGICYILVSAYFSFGGIELFVLSINEQSNPRKSTP 317
           G +YWR+PG+   G      G  RF G    L++A F++ G EL  ++  E +NPRKS P
Sbjct: 266 GFRYWRNPGAMGAGIISSDLGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 325

Query: 318 VAAKRSVYRXXXXXXXXXXXXGFNVPHNNDQLMGSGGSATHASPYVLAASIHKVRVIPHI 377
            A  + V+R            G  VP+N+ +L  S  +   +SP+V++      +V+P I
Sbjct: 326 RAINKVVFRIVLFYIMSLFFVGLLVPYNDPRLSASS-AVIASSPFVISIQNAGTKVLPDI 384

Query: 378 INAVILISVISVANSALYAAPRLMCSLAQQGYAPKFLNYIDREGRPLRAXXXXXXXXXXX 437
            NAV+L++VIS ANS +Y   R++ +LAQ G APK   Y+ R G P              
Sbjct: 385 FNAVVLVTVISAANSNVYVGSRVLYALAQSGNAPKQFAYVTRHGVPYLGVICTALLGLLA 444

Query: 438 XXACSPQEEQAFTWLAAIAGLSELFTWSGIMLSHIRFRKAMKVQGRSLDEVGYKANTGIW 497
               +     AF WL  I+ L+ L  W  I L+HIRF +A+K +G S D++ +KA    W
Sbjct: 445 FLVVNHNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKFRGISRDDLPFKAKFMPW 504

Query: 498 GSYYGVFFNMLVFMAQFWVALSPIGNGGKCDAQAFFESYLAAPLWIFMYVGYMVYKRDFT 557
           G+YY  FF  ++   Q + A +P     K D   FF +Y++  L + ++ G  +Y R   
Sbjct: 505 GAYYASFFVTVIIFIQGFQAFAP-----KFDVSEFFTAYISLILLVVLFAGCQLYYRC-R 558

Query: 558 FLNPLDKIDLDFHRRVYDPEIMRQEDEEN 586
           FL  L+ ID+D  RR  D  +   ++ +N
Sbjct: 559 FLWKLEDIDIDSDRREIDAIVWEDDEPQN 587

>YNL268W (LYP1) [4340] chr14 (138549..140384) High affinity lysine
           permease, also transports methionine [1836 bp, 611 aa]
          Length = 611

 Score =  271 bits (693), Expect = 9e-83,   Method: Compositional matrix adjust.
 Identities = 168/541 (31%), Positives = 274/541 (50%), Gaps = 18/541 (3%)

Query: 52  VHRFVDSFRRAESQRLEEDNDLEDGTKSMKSNNHLKKSMKSRHVVMMSLGTGIGTGLLVA 111
           V+   +S  R +    E D + ED  ++   + H+K+++K RH+ M++LG  IGTGL V 
Sbjct: 73  VNSITNSLTRLQVVSHETDIN-EDEEEAHYEDKHVKRALKQRHIGMIALGGTIGTGLFVG 131

Query: 112 NAKGLSLAGPGSLVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFISKSFGFA 171
            +  LS AGP   +I Y+ +  + YF+ Q+ GEM  T+  +  +   ++  F+S +FG +
Sbjct: 132 ISTPLSNAGPVGSLIAYIFMGTIVYFVTQSLGEMA-TFIPVTSSITVFSKRFLSPAFGVS 190

Query: 172 TTWLFCIQWLTVLPLELITSSMTVKYWNDTINADXXXXXXXXXXXXXXXXGVKAYGETEF 231
             +++   W     +E+      ++YW D +                    VK YGE EF
Sbjct: 191 NGYMYWFNWAITYAVEVSVIGQVIEYWTDKVPLAAWIAIFWVIITLMNFFPVKVYGEFEF 250

Query: 232 IFNSCKILMVAGFIILSVVINCGGAGVDGYIGGKYWRDPGSFAEG-----SGATRFKGIC 286
              S K+L + G++I +++I CGG+   G IG +YWR+PG++  G         RF G  
Sbjct: 251 WVASVKVLAIMGYLIYALIIVCGGSH-QGPIGFRYWRNPGAWGPGIISSDKSEGRFLGWV 309

Query: 287 YILVSAYFSFGGIELFVLSINEQSNPRKSTPVAAKRSVYRXXXXXXXXXXXXGFNVPHNN 346
             L++A F++ G EL  ++  E +NPRK+ P A  + V+R            G  VP+N+
Sbjct: 310 SSLINAAFTYQGTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIMSLFFIGLLVPYND 369

Query: 347 DQLMGSGGSATHASPYVLAASIHKVRVIPHIINAVILISVISVANSALYAAPRLMCSLAQ 406
            +L  +  +   +SP+V++        +P I NAV+LI+V+S ANS +Y   R++ SLA+
Sbjct: 370 SRLS-ASSAVIASSPFVISIQNAGTYALPDIFNAVVLITVVSAANSNVYVGSRVLYSLAR 428

Query: 407 QGYAPKFLNYIDREGRPLRAXXXXXXXXXXXXXACSPQEEQAFTWLAAIAGLSELFTWSG 466
            G APK   Y+ R+G P                  +     AF WL  I+ L+ L  W  
Sbjct: 429 TGNAPKQFGYVTRQGVPYLGVVCTAALGLLAFLVVNNNANTAFNWLINISTLAGLCAWLF 488

Query: 467 IMLSHIRFRKAMKVQGRSLDEVGYKANTGIWGSYYGVFFNMLVFMAQFWVALSPIGNGGK 526
           I L+HIRF +A+K +G S D++ +KA    +G+YY  FF  ++   Q + A  P      
Sbjct: 489 ISLAHIRFMQALKHRGISRDDLPFKAKLMPYGAYYAAFFVTVIIFIQGFQAFCPF----- 543

Query: 527 CDAQAFFESYLAAPLWIFMYVGYMVYKRDFTFLNPLDKIDLDFHRRVYDPEIMRQEDEEN 586
                FF SY++  L   +++G  +Y +   F+  L+ ID+D  RR  + E +  ED+E 
Sbjct: 544 -KVSEFFTSYISLILLAVVFIGCQIYYK-CRFIWKLEDIDIDSDRR--EIEAIIWEDDEP 599

Query: 587 K 587
           K
Sbjct: 600 K 600

>Scas_706.36d
          Length = 607

 Score =  266 bits (681), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 165/538 (30%), Positives = 275/538 (51%), Gaps = 15/538 (2%)

Query: 52  VHRFVDSFRRAESQRLEEDNDLEDGTKSMKSNNHLKKSMKSRHVVMMSLGTGIGTGLLVA 111
           +H   DS  R+    L +D+D ED  ++   +  +K+++K RH+ M++LG  IGTGL V 
Sbjct: 67  IHSITDSLARSRLPHLGDDDDEEDAEEAQYHDTEVKRALKQRHIGMIALGGTIGTGLFVG 126

Query: 112 NAKGLSLAGPGSLVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFISKSFGFA 171
            +  L+ +GP   +I Y+ +  + Y + Q+ GEM  T+  +  +   ++  F+S +FG A
Sbjct: 127 ISVPLTNSGPVGSLIAYLFMGSIIYSITQSLGEMA-TFIPVTSSITVFSKRFLSPAFGVA 185

Query: 172 TTWLFCIQWLTVLPLELITSSMTVKYWNDTINADXXXXXXXXXXXXXXXXGVKAYGETEF 231
             +++   W     +E+      ++YW   +                    VK YGE EF
Sbjct: 186 NGYMYWFNWAITYAVEISVVGQVIEYWTKKVPLAAWIAIFWVFVTLMNFFPVKVYGEIEF 245

Query: 232 IFNSCKILMVAGFIILSVVINCGGAGVDGYIGGKYWRDPGSFAEG-----SGATRFKGIC 286
                K+L +AG+++ +++I CGG+   G IG +YWR+PG +  G        +RF G  
Sbjct: 246 WIAFMKVLAIAGYLLYALIIVCGGSS-QGPIGFRYWRNPGPWGAGIISKDKNTSRFLGWV 304

Query: 287 YILVSAYFSFGGIELFVLSINEQSNPRKSTPVAAKRSVYRXXXXXXXXXXXXGFNVPHNN 346
             L++A F++ G EL  ++  E +NPRKS P A  + V+R            G  VP+++
Sbjct: 305 SSLINAAFTYQGTELVGITAGEAANPRKSVPRAINKVVFRIALFYIMSLFFIGLLVPYDD 364

Query: 347 DQLMGSGGSATHASPYVLAASIHKVRVIPHIINAVILISVISVANSALYAAPRLMCSLAQ 406
            +L  S  +   +SP+V++      +++P I NA+++I+VIS ANS +Y   R++ +LAQ
Sbjct: 365 PRLS-SDSAVVASSPFVISIQNAGTKILPDIFNAIVMITVISAANSNVYVGSRVLYALAQ 423

Query: 407 QGYAPKFLNYIDREGRPLRAXXXXXXXXXXXXXACSPQEEQAFTWLAAIAGLSELFTWSG 466
            G APK   Y+ R G P                  +     AF WL  I+ L+ L  W  
Sbjct: 424 TGNAPKQFAYVTRHGVPYLGVLCTAALGLLAFLVVNNNANTAFNWLINISTLAGLCAWLF 483

Query: 467 IMLSHIRFRKAMKVQGRSLDEVGYKANTGIWGSYYGVFFNMLVFMAQFWVALSPIGNGGK 526
           I +SHIRF +A+K +G S D++ +KA    W +YY  FF  ++   Q + A SP      
Sbjct: 484 ISISHIRFMQALKFRGISRDDLPFKAKFMPWAAYYATFFVTVIIFIQGFQAFSP-----H 538

Query: 527 CDAQAFFESYLAAPLWIFMYVGYMVYKRDFTFLNPLDKIDLDFHRRVYDPEIMRQEDE 584
            D  AFF +Y++  +   +++G  +Y R   F   L+ ID+D  RR  + E++ ++DE
Sbjct: 539 FDVTAFFTAYISLIILAVLFIGCQIYYRC-RFFWKLEDIDIDTDRREIE-EVIWEDDE 594

>CAGL0J08184g 804507..806225 similar to sp|P04817 Saccharomyces
           cerevisiae YEL063c CAN1 or sp|P38971 Saccharomyces
           cerevisiae YNL270c ALP1 or sp|P32487 Saccharomyces
           cerevisiae YNL268w LYP1, hypothetical start
          Length = 572

 Score =  266 bits (679), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 164/533 (30%), Positives = 269/533 (50%), Gaps = 16/533 (3%)

Query: 60  RRAESQRLEEDNDLEDGTKSMKSNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLSLA 119
           +R  S    +  DL      +  ++ +K+S+K RH+ M++LG  IGTGL +  A  L+ A
Sbjct: 40  KRKTSVSSTQYEDLATEKDELLEHHDVKRSLKQRHIGMIALGGTIGTGLFIGIATPLANA 99

Query: 120 GPGSLVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFISKSFGFATTWLFCIQ 179
           GP   ++ Y+ +  V + + Q+ GEM    P +  +F+ +   F+S + G A  +++ + 
Sbjct: 100 GPVGALVAYLFMGTVVFSVTQSLGEMATFIP-VTSSFSVFAQRFLSPALGAANGYMYFLS 158

Query: 180 WLTVLPLELITSSMTVKYWNDTINADXXXXXXXXXXXXXXXXGVKAYGETEFIFNSCKIL 239
           W     LEL      +++W   +                    VK YGE EF   S K+L
Sbjct: 159 WCFTFALELSVVGQIIQFWTFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVL 218

Query: 240 MVAGFIILSVVINCGGAGVDGYIGGKYWRDPGSFAEG-----SGATRFKGICYILVSAYF 294
            + GF+I S+ I CG AG  G IG +YWR+PG+   G     +G  RF G    L++A F
Sbjct: 219 ALMGFLIYSLCIVCG-AGKTGPIGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAF 277

Query: 295 SFGGIELFVLSINEQSNPRKSTPVAAKRSVYRXXXXXXXXXXXXGFNVPHNNDQLMGSGG 354
           ++ G EL  ++  E +NPRK+ P A ++ + R            G  VP+N+ +L  S  
Sbjct: 278 TYQGTELVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLT-STD 336

Query: 355 SATHASPYVLAASIHKVRVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPKFL 414
           S   +SP+++       RV+PHI NAVIL ++IS  NS +Y   R++ S+A+ G APKFL
Sbjct: 337 SYVSSSPFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFL 396

Query: 415 NYIDREGRPLRAXXXXXXXXXXXXXACSPQEEQAFTWLAAIAGLSELFTWSGIMLSHIRF 474
                +G P  +               S    +AF WL  I G++  F W  I  SH+RF
Sbjct: 397 AKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRF 456

Query: 475 RKAMKVQGRSLDEVGYKANTGIWGSYYGVFFNMLVFMAQFWVALSPIGNGGKCDAQAFFE 534
            +A+K +G S D++ YKA    W +YY +FF +++ + Q + + +P  +G     + F  
Sbjct: 457 MQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAPHFSG-----RDFVA 511

Query: 535 SYLAAPLWIFMYVGYMVYKRDFTFLNPLDKIDLDFHRRVYDPEIMRQEDEENK 587
           +Y++  L++  +  + +Y R    +  L+ +D+D  RR  + E +  ED+  K
Sbjct: 512 AYISVGLFLVFWGFFQIYFRC-RIIWKLEDVDIDTDRR--EIESVVWEDDAPK 561

>YEL063C (CAN1) [1365] chr5 complement(31694..33466) Permease for
           basic amino acids, arginine, lysine, and histidine,
           member of the amino acid-polyamine-choline (APC) family
           of membrane transporters [1773 bp, 590 aa]
          Length = 590

 Score =  262 bits (670), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 176/584 (30%), Positives = 276/584 (47%), Gaps = 17/584 (2%)

Query: 9   SKMEKSAEFEVTDSALYNNFNTSTTASLTPEIKEHSEESRNGLVHRFVDSFRRAESQRLE 68
           + +E+   +    + L+++   S T      I    E+S+     R   +    E     
Sbjct: 8   ADIEEKHMYNEPVTTLFHDVEASQTHHRRGSIPLKDEKSKELYPLRSFPTRVNGEDTFSM 67

Query: 69  EDNDLEDGTKSMKSNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLSLAGPGSLVIGY 128
           ED  + D  +    N  +K+ +K RH+ M++LG  IGTGL +  +  L+ AGP   +I Y
Sbjct: 68  EDG-IGDEDEGEVQNAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLTNAGPVGALISY 126

Query: 129 VMVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFISKSFGFATTWLFCIQWLTVLPLEL 188
           + +  + Y + Q+ GEM    P +  +F  ++  F+S +FG A  +++   W     LEL
Sbjct: 127 LFMGSLAYSVTQSLGEMATFIP-VTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALEL 185

Query: 189 ITSSMTVKYWNDTINADXXXXXXXXXXXXXXXXGVKAYGETEFIFNSCKILMVAGFIILS 248
                 +++W   +                    VK YGE EF   S K+L + GF+I  
Sbjct: 186 SVVGQVIQFWTYKVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYC 245

Query: 249 VVINCGGAGVDGYIGGKYWRDPGSFAEG-----SGATRFKGICYILVSAYFSFGGIELFV 303
             + CG AGV G +G +YWR+PG++  G         RF G    L++A F+F G EL  
Sbjct: 246 FCMVCG-AGVTGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVG 304

Query: 304 LSINEQSNPRKSTPVAAKRSVYRXXXXXXXXXXXXGFNVPHNNDQLMGSGGSATHASPYV 363
           ++  E +NPRKS P A K+ V+R            G  VP+N+ +L  S  S    SP++
Sbjct: 305 ITAGEAANPRKSVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQST-SYVSTSPFI 363

Query: 364 LAASIHKVRVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPKFLNYIDREGRP 423
           +A      +V+PHI NAVIL ++IS ANS +Y   R++  L++   APKFL+   + G P
Sbjct: 364 IAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVP 423

Query: 424 LRAXXXXXXXXXXXXXACSPQEEQAFTWLAAIAGLSELFTWSGIMLSHIRFRKAMKVQGR 483
             A               S   ++ F WL  I G++  F W  I +SHIRF +A+K +G 
Sbjct: 424 YIAVFVTAAFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGI 483

Query: 484 SLDEVGYKANTGIWGSYYGVFFNMLVFMAQFWVALSPIGNGGKCDAQAFFESYLAAPLWI 543
           S DE+ +KA      +YY   F  ++ + Q + A +P  NG    A A+   +L   +WI
Sbjct: 484 SRDELPFKAKLMPGLAYYAATFMTIIIIIQGFTAFAPKFNGVSF-AAAYISIFLFLAVWI 542

Query: 544 FMYVGYMVYKRDFTFLNPLDKIDLDFHRRVYDPEIMRQEDEENK 587
                +        F+  +  +D+D  RR  D E +  ED E K
Sbjct: 543 LFQCIFRC-----RFIWKIGDVDIDSDRR--DIEAIVWEDHEPK 579

>Kwal_33.13411
          Length = 560

 Score =  261 bits (666), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 168/568 (29%), Positives = 275/568 (48%), Gaps = 32/568 (5%)

Query: 22  SALYNNFNTSTTASLTPEIKEHSEESRNGLVHRFVDSFRRAESQRLEEDN-DLEDGTKSM 80
           S L +      T S   ++  +S E++NG             +   E+D  DL++G    
Sbjct: 6   SELSSPLTQGKTRSDEFQMYVYSNETQNG---------GSGHNSSFEDDEGDLQEG---- 52

Query: 81  KSNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLSLAGPGSLVIGYVMVSFVTYFMVQ 140
                +K+++K RHV M++LG  IGTGL V  A  LS AGP   +I Y+ +  + YF+ Q
Sbjct: 53  ----QVKRALKPRHVSMIALGGTIGTGLFVGIASPLSSAGPVGALIAYIFMGSIVYFVTQ 108

Query: 141 AAGEMGVTYPTLPGNFNAYNSIFISKSFGFATTWLFCIQWLTVLPLELITSSMTVKYWND 200
           + GEM  T+  +  +   +++ F+S +FG A  +++   W     +E+      ++YW  
Sbjct: 109 SMGEMA-TFIPVTSSITVFSNRFLSPAFGVANGYMYWFNWAITYAVEISVIGQVIQYWTK 167

Query: 201 TINADXXXXXXXXXXXXXXXXGVKAYGETEFIFNSCKILMVAGFIILSVVINCGGAGVDG 260
            +                    V+ YGE EF   S K++ + G+++ +++I CGG+   G
Sbjct: 168 AVPLAAWIGIFWVAITLANFFPVRFYGEVEFWVASIKVIAIVGYLLYALIIVCGGSK-QG 226

Query: 261 YIGGKYWRDPGSFAEG--SGAT---RFKGICYILVSAYFSFGGIELFVLSINEQSNPRKS 315
            IG +YWR+PG + +G  SG     RF G    L++A F++ G EL  ++  E +NPRK+
Sbjct: 227 PIGFRYWRNPGPWGDGIISGDKDKGRFLGWVASLINASFTYQGTELVGITAGEAANPRKT 286

Query: 316 TPVAAKRSVYRXXXXXXXXXXXXGFNVPHNNDQLMGSGGSATHASPYVLAASIHKVRVIP 375
            P A  +  +R            G  VP+N+  L     S   +SP+V++      R++P
Sbjct: 287 VPKAINKVFFRILFFYILSLFFVGLLVPYNHPGL-DKHTSVIASSPFVISIQSAGTRILP 345

Query: 376 HIINAVILISVISVANSALYAAPRLMCSLAQQGYAPKFLNYIDREGRPLRAXXXXXXXXX 435
            I NAV+L+++IS ANS +Y   R++ SLA  G APK  +Y+  +G P            
Sbjct: 346 DIFNAVVLVTIISAANSNVYVGSRILFSLAHTGIAPKQFSYVTNQGVPYLGVICTALLGL 405

Query: 436 XXXXACSPQEEQAFTWLAAIAGLSELFTWSGIMLSHIRFRKAMKVQGRSLDEVGYKANTG 495
                      + F WL  I+ L+ L  W  I +SHIRF + +K +G S D++ +K+   
Sbjct: 406 LAFLVVDDNANEGFNWLINISTLAGLCAWLFISISHIRFMQCLKQRGISRDDLPFKSKLM 465

Query: 496 IWGSYYGVFFNMLVFMAQFWVALSPIGNGGKCDAQAFFESYLAAPLWIFMYVGYMVYKRD 555
            +G+YY  F+  ++   Q + A  P     K     FF  Y++  L   ++    +Y R 
Sbjct: 466 PYGAYYAAFWVAVIIFVQGFQAFCP-----KFKVAEFFTGYISLILLAVVFCLAQLYYRC 520

Query: 556 FTFLNPLDKIDLDFHRRVYDPEIMRQED 583
             F N L+ ID+D  RR  D  I  +E+
Sbjct: 521 -RFFNRLEDIDIDSDRREIDALIWEEEE 547

>Scas_706.37
          Length = 544

 Score =  259 bits (661), Expect = 7e-79,   Method: Compositional matrix adjust.
 Identities = 167/539 (30%), Positives = 268/539 (49%), Gaps = 18/539 (3%)

Query: 56  VDSFRRAESQRLEEDNDLEDGTKSMKSNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKG 115
           V SF+   +      + L+D     +    +K+ +K RH+ M++LG  IGTGL +  A+ 
Sbjct: 8   VHSFQVDSNDTPTTISTLDD---DQEKQQDVKRELKKRHISMIALGGTIGTGLFLGIARP 64

Query: 116 LSLAGPGSLVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFISKSFGFATTWL 175
           L +AGP   +I Y+ +  V + + Q+ GEM  T+  +  +F  +   F+S +FG A  ++
Sbjct: 65  LIIAGPIGALIAYLFMGTVVFSVTQSLGEM-CTFIPVTASFTVFAQRFLSPAFGAANGYM 123

Query: 176 FCIQWLTVLPLELITSSMTVKYWNDTINADXXXXXXXXXXXXXXXXGVKAYGETEFIFNS 235
           +   W     LEL      +++W   +                    V+ YGE EF   S
Sbjct: 124 YWFSWAMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIAS 183

Query: 236 CKILMVAGFIILSVVINCGGAGVDGYIGGKYWRDPGSFAEG-----SGATRFKGICYILV 290
            K+L + GFII  + I CG AGV G +G +YW++PG +  G         RF G    L+
Sbjct: 184 VKVLAILGFIIYGICIICG-AGVTGPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLI 242

Query: 291 SAYFSFGGIELFVLSINEQSNPRKSTPVAAKRSVYRXXXXXXXXXXXXGFNVPHNNDQLM 350
           +A F+F G EL  ++  E  NPRK+ P A K+ V+R            G  VP+N+ +L 
Sbjct: 243 NAAFTFQGTELVGITAGEAKNPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQ 302

Query: 351 GSGGSATHASPYVLAASIHKVRVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYA 410
            S  S   +SP+++       +++PHI NAVILI++IS  NS +Y   R++  LA+   A
Sbjct: 303 -SNDSYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAA 361

Query: 411 PKFLNYIDREGRPLRAXXXXXXXXXXXXXACSPQEEQAFTWLAAIAGLSELFTWSGIMLS 470
           PKF     + G P                  +   ++AFTWL  I G++  F W  I  S
Sbjct: 362 PKFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCS 421

Query: 471 HIRFRKAMKVQGRSLDEVGYKANTGIWGSYYGVFFNMLVFMAQFWVALSPIGNGGKCDAQ 530
           HIRF KA+K +G S +++ YKA    W +YY VFF +++ + Q + + +P     K    
Sbjct: 422 HIRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAP-----KFKVA 476

Query: 531 AFFESYLAAPLWIFMYVGYMVYKRDFTFLNPLDKIDLDFHRRVYDPEIMRQEDEENKER 589
            FF +Y++  L+I  +V + ++ +    +  L  +DLD  RR  + E+   +D E+K +
Sbjct: 477 NFFAAYISVFLFIIFWVAFQIWFKC-RLVWKLQDVDLDTDRRDIEEEVW-SDDVEDKNK 533

>Kwal_33.13401
          Length = 559

 Score =  258 bits (660), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 162/547 (29%), Positives = 269/547 (49%), Gaps = 16/547 (2%)

Query: 37  TPEIKEHSEESRNGLVHRFVDSF-RRAESQRLEEDNDLEDGTKSMKSNNHLKKSMKSRHV 95
           T E +  S+++   L    + SF   A  Q  +   D + G+ S    N +++ +K RHV
Sbjct: 4   TSEKEGMSQKTETRLEDYEMGSFAEEALDQEAQSSQDSQLGS-SGHGRNAVQRQLKPRHV 62

Query: 96  VMMSLGTGIGTGLLVANAKGLSLAGPGSLVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGN 155
            M++LG  IGTGL +     L  AGP   +I Y+ +  + Y + Q+ GEM    P +  +
Sbjct: 63  SMIALGGTIGTGLFIGIESPLRNAGPVGALISYLFMGSIAYCVTQSLGEMATFIP-VTSS 121

Query: 156 FNAYNSIFISKSFGFATTWLFCIQWLTVLPLELITSSMTVKYWNDTINADXXXXXXXXXX 215
           F  +   F+S   G A  +++C  W     LEL      ++YW   +             
Sbjct: 122 FTVFTRRFLSLPLGAANGYMYCFSWSVTYALELSIVGQIIEYWTSAVPNAAWIAIFWVPI 181

Query: 216 XXXXXXGVKAYGETEFIFNSCKILMVAGFIILSVVINCGGAGVDGYIGGKYWRDPGSFAE 275
                  VK YGE +F     K++ + GF++  + + CG AG  G +G +YWR+PG + +
Sbjct: 182 TLSNLVPVKFYGEFQFWIALIKVVAIIGFLVYCLCMVCG-AGKTGPVGFRYWRNPGPWGD 240

Query: 276 GSGAT-----RFKGICYILVSAYFSFGGIELFVLSINEQSNPRKSTPVAAKRSVYRXXXX 330
           G  +      RF G    LV+A F++ G EL  +S  E +NPRK+ P A  +  +R    
Sbjct: 241 GIISHDIHEGRFLGWVSSLVNAAFTYQGTELVGISAGESANPRKTVPKAINKVFFRILLF 300

Query: 331 XXXXXXXXGFNVPHNNDQLMGSGGSATHASPYVLAASIHKVRVIPHIINAVILISVISVA 390
                   G  VP N+++L  S  S +  SP+++A      +++P I NAVIL ++IS A
Sbjct: 301 YVGSLFFIGLLVPFNDEKLTSSD-SYSAGSPFIIAIQNSGTKILPDIFNAVILATIISAA 359

Query: 391 NSALYAAPRLMCSLAQQGYAPKFLNYIDREGRPLRAXXXXXXXXXXXXXACSPQEEQAFT 450
           NS +Y   R++  LA++  AP+F    +R G P  A             + S    +AF 
Sbjct: 360 NSNVYVGSRVLYGLAKERLAPRFFARTNRHGVPDVAVLFVANFGFLGYLSVSNGASKAFD 419

Query: 451 WLAAIAGLSELFTWSGIMLSHIRFRKAMKVQGRSLDEVGYKANTGIWGSYYGVFFNMLVF 510
           WL  I  ++  F+W  I L H+RF +A+K+QG S D++ +KA    WG+YY  FF  L+ 
Sbjct: 420 WLLNITAIAGFFSWLFISLCHVRFMQALKLQGISRDDLPFKAKLMPWGAYYSAFFITLII 479

Query: 511 MAQFWVALSPIGNGGKCDAQAFFESYLAAPLWIFMYVGYMVYKRDFTFLNPLDKIDLDFH 570
           + Q + +L+P  N        FF +Y++  +++ ++  +  + R    ++ ++ +D+D  
Sbjct: 480 IIQGFTSLAPTFN-----VSNFFAAYISVFMFLVIWAVFQCWYRT-RIIHRIEHVDIDSD 533

Query: 571 RRVYDPE 577
           RR  D +
Sbjct: 534 RREVDAQ 540

>AER405C [2905] [Homologous to ScYPL274W (SAM3) - NSH]
           (1413790..1415283) [1494 bp, 497 aa]
          Length = 497

 Score =  255 bits (652), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 165/502 (32%), Positives = 268/502 (53%), Gaps = 21/502 (4%)

Query: 97  MMSLGTGIGTGLLVANAKGLSLAGPGSLVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGNF 156
           M+S+G  +GTGL +   + L  +GPG+L+IG+++V    + ++Q+A E+   YP + G+F
Sbjct: 1   MISIGGTLGTGLFIGIGQSLQ-SGPGTLLIGFLIVGVSIFCVIQSAAELSCQYP-VSGSF 58

Query: 157 NAYNSIFISKSFGFATTWLFCIQWLTVLPLELITSSMTVKYWNDTINADXXXXXXXXXXX 216
           +++ S FI  S GF  +  + + WL   P EL+  +MT+ YWN+ I              
Sbjct: 59  SSHVSRFIEPSLGFTVSCAYALSWLISFPNELVGLAMTIGYWNEDIPPAVWVLIGYLLVI 118

Query: 217 XXXXXGVKAYGETEFIFNSCKILMVAGFIILSVVINCGGA--GVDGYIGGKYWRDPGSFA 274
                 V+ + E+EF  +  K+L +  F+I+ +VI CGG     +GY+GGKYW DPG+F 
Sbjct: 119 GLNLFAVRGFAESEFWLSIIKVLAIIIFLIIGIVIICGGGPNNKEGYLGGKYWHDPGAFR 178

Query: 275 EGSGATRFKGICYILVSAYFSFGGIELFVLSINEQSNPRKSTPVAAKRSVYRXXXXXXXX 334
                  F  +C   VSA F+FGG EL +L+ NE S   +S   AAK + +R        
Sbjct: 179 P----PFFSSLCQTFVSAAFTFGGAELVLLTANE-SRKIESISRAAKGTFWRIAIFYIST 233

Query: 335 XXXXGFNVPHNNDQLMGSGGSATHASPYVLAASIHKV--RVIPHIINAVILISVISVANS 392
               G  VP+ +  L    G +  ASP+V+A S        + H +NAVI+ +V+SV NS
Sbjct: 234 VIVIGCLVPYTSPAL---DGESIRASPFVIALSNTGSFGTNVSHFMNAVIVAAVLSVCNS 290

Query: 393 ALYAAPRLMCSLAQQGYAPKFLNYIDREGRPLRAXXXXXXXXXXXXXACSPQEEQAFTWL 452
            +YAA R++ SL   G  P+   YID++GRPL                 + + +  F WL
Sbjct: 291 CVYAASRVIQSLGACGQLPEIFGYIDKKGRPLVGIGVCAVFGLLAFLVETTKVKDVFNWL 350

Query: 453 AAIAGLSELFTWSGIMLSHIRFRKAMKVQGRSLDEVGYKANTGIWGSYYGVFFNMLVFMA 512
            A+  ++  F W  I +S +R+R+A+KVQG   +E+ Y++  G W    G   N L+   
Sbjct: 351 FALCSIAAFFVWFCICVSQLRYRRALKVQGFPTEEIAYQSMLGKWSGVIGTLLNFLLICG 410

Query: 513 QFWVALSPIGNGGKCDAQAFFESYLAAPLWIFMYVGYMVYKRDF-TFLNPLDKIDLDFHR 571
           + +V+   + +G   D + FF++ ++ PL I  Y  + +Y+RD+ T+L P   +DL+  R
Sbjct: 411 EIYVS---VKDG---DVETFFQNCMSIPLLIIFYFCHRLYRRDWKTWLIPARDLDLNTGR 464

Query: 572 RVYDPEIMRQEDEENKERLKNS 593
           +  D E+M+ E   ++ R+ +S
Sbjct: 465 KPEDLEMMKHELIVSRARIASS 486

>Scas_520.2*
          Length = 372

 Score =  250 bits (638), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 141/358 (39%), Positives = 202/358 (56%), Gaps = 17/358 (4%)

Query: 224 KAYGETEFIFNSCKILMVAGFIILSVVINCGGAGVDGYIGGKYWRDPGSFAEGSGATRFK 283
           K++GETEF+ +  +IL + GF IL +V+ CGG     +I G+YW  PGSF   +  T+FK
Sbjct: 3   KSFGETEFVLSMVRILAIIGFTILGIVLACGGGPHGSFIDGQYWNYPGSFVGHNSGTKFK 62

Query: 284 GICYILVSAYFSFGGIELFVLSINEQSNPRKSTPVAAKRSVYRXXXXXXXXXXXXGFNVP 343
           G+C + V A FS+ GIE+  +S  E  +PR + P AAKR+               G  VP
Sbjct: 63  GLCSVFVIAAFSYSGIEMTAVSPVENKDPRITIPKAAKRTF-----------VLIGCFVP 111

Query: 344 HNNDQLMGSGGSATHAS-PYVLAASIHKVRVIPHIINAVILISVISVANSALYAAPRLMC 402
           ++N +L+        AS P V+A      + +  ++NA+ILIS+ISVANSA+Y   R M 
Sbjct: 112 YDNPRLLSRTSFVDAASSPLVIAIENGGNKGLLTLMNAIILISIISVANSAVYTCSRCMV 171

Query: 403 SLAQQGYAPKFLNYIDREGRPLRAXXXXXXXXXXXXXACSPQEEQAFTWLAAIAGLSELF 462
           ++   G  P+ LN +D +GRP+ A             A S ++   FTWL+A++GL  +F
Sbjct: 172 AMVHIGNVPRILNRVDTKGRPMNAIIFTLFFGLLSFVAASDRQADVFTWLSALSGLFTIF 231

Query: 463 TWSGIMLSHIRFRKAMKVQGRSLDEVGYKANTGIWGSYYG--VFFNMLVFMAQFWVALSP 520
            W  I LSHIR R+AM  Q RSLDE+ + + TG+WGS+YG  V F+ LV  A FW +L P
Sbjct: 232 RWMAINLSHIRVRQAMAKQNRSLDELPFLSQTGVWGSWYGTIVLFSDLV--ASFWTSLFP 289

Query: 521 IGNGGKCDAQAFFESYLAAPLWIFMYVGYMVYKRDFTFLNPLDKIDLDFHRRVYDPEI 578
           +G G   DA+ FFE +      I M +   +Y R   F+  L  +DLD  RR  D ++
Sbjct: 290 LG-GTSADAELFFEVFFTVSHLISMLLCPNLYMRKREFMVGLTDMDLDTGRRQMDLDV 346

>KLLA0C02343g complement(203552..205297) similar to sp|P04817
           Saccharomyces cerevisiae YEL063c CAN1 amino acid
           permease, start by similarity
          Length = 581

 Score =  252 bits (644), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 170/561 (30%), Positives = 276/561 (49%), Gaps = 28/561 (4%)

Query: 43  HSEESRNGLVHRFVDSFRRAESQRLEEDNDL-----EDGTKSM------KSNNHLKKSMK 91
            S+ +R+G+    V + +  +  R  +DN+L     +D +  M           +K+++K
Sbjct: 22  QSQSARSGM---HVSNSKIDDPLRFSKDNNLTLEAIDDDSSRMFDPEGSIGQAEVKRALK 78

Query: 92  SRHVVMMSLGTGIGTGLLVANAKGLSLAGPGSLVIGYVMVSFVTYFMVQAAGEMGVTYPT 151
            RHV M++LG  IGTGL ++ +  L  AGP   +I ++++  + Y + Q+ GEM  T+  
Sbjct: 79  PRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMA-TFIP 137

Query: 152 LPGNFNAYNSIFISKSFGFATTWLFCIQWLTVLPLELITSSMTVKYWNDTINADXXXXXX 211
           +  +F  ++  FIS + G A  +++   W     LEL      ++YW D +  +      
Sbjct: 138 VTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLEAWIAIF 197

Query: 212 XXXXXXXXXXGVKAYGETEFIFNSCKILMVAGFIILSVVINCGGAGVDGYIGGKYWRDPG 271
                      VK YGE EF   S K++ + GF+I S+ + CG AG +G IG +YWR PG
Sbjct: 198 WVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCG-AGPEGPIGFRYWRKPG 256

Query: 272 SFAEGSGA-----TRFKGICYILVSAYFSFGGIELFVLSINEQSNPRKSTPVAAKRSVYR 326
            +  G  A      RF G    L+SA F++ G EL  ++  E  NPRK+ P A  +  +R
Sbjct: 257 PWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAINKVFFR 316

Query: 327 XXXXXXXXXXXXGFNVPHNNDQLMGS-GGSATHASPYVLAASIHKVRVIPHIINAVILIS 385
                       G  VP+N+ +L GS  GS    SP+++A    +  V+PHI NAVIL +
Sbjct: 317 ILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTT 376

Query: 386 VISVANSALYAAPRLMCSLAQQGYAPKFLNYIDREGRPLRAXXXXXXXXXXXXXACSPQE 445
           +IS  NS +Y   R++  L++   APKF +   + G P  A               S   
Sbjct: 377 IISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDA 436

Query: 446 EQAFTWLAAIAGLSELFTWSGIMLSHIRFRKAMKVQGRSLDEVGYKANTGIWGSYYGVFF 505
           ++ F WL  I  ++   TW  I +SHIRF + +K +G S D++ YKA    + +YY  FF
Sbjct: 437 QEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKAKFMPYAAYYAAFF 496

Query: 506 NMLVFMAQFWVALSPIGNGGKCDAQAFFESYLAAPLWIFMYVGYMVYKRDFTFLNPLDKI 565
             ++ + Q + A +P       +   FF +Y++  L+  ++  +    R   F   LD++
Sbjct: 497 ITVIIIIQGFTAFAP-----HFNVSDFFAAYISVFLFFIVWAIFQTIYRTKLF-RTLDEV 550

Query: 566 DLDFHRRVYDPEIMRQEDEEN 586
           D+D  RR  D  I  +E+ +N
Sbjct: 551 DIDSDRRDIDVIIWEEEEPKN 571

>AFR667C [3860] [Homologous to ScYNL268W (LYP1) - SH]
           (1657064..1658755) [1692 bp, 563 aa]
          Length = 563

 Score =  251 bits (641), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 158/544 (29%), Positives = 261/544 (47%), Gaps = 30/544 (5%)

Query: 63  ESQRLEEDNDLEDGTKSMK------------SNNHLKKSMKSRHVVMMSLGTGIGTGLLV 110
           + + LE D +L+  T +                  +K+++K+RH+ M++LG  IGTGL +
Sbjct: 20  KGKTLENDIELQSVTPATGEFPEDHTEEGDYQETEVKRALKARHISMIALGGTIGTGLFI 79

Query: 111 ANAKGLSLAGPGSLVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFISKSFGF 170
             A  L  AGP   ++ Y+ +  V Y + Q+ GEM    P +  +   ++  F+S +FG 
Sbjct: 80  VIASPLRTAGPVGSLLAYIFIGTVVYSITQSLGEMATFIP-VTSSVTVFSKRFLSPAFGV 138

Query: 171 ATTWLFCIQWLTVLPLELITSSMTVKYWNDTINADXXXXXXXXXXXXXXXXGVKAYGETE 230
           A  +++   W     +EL      ++YW D +                    V+ YGE E
Sbjct: 139 ANGYMYWFNWAITFAVELSVVGQIIQYWTDRVPIAAWIVIFWVLVTLVNFFPVRFYGEIE 198

Query: 231 FIFNSCKILMVAGFIILSVVINCGGAGVDGYIGGKYWRDPGSFAEGSGATR--------F 282
           F   S K+L + G++I + +I CGG+   G IG       G  A G+ A+         F
Sbjct: 199 FWIASVKVLTIVGYLIYAFIIVCGGSK-QGPIGLP--ATGGIPARGARASSRTTRKRHGF 255

Query: 283 KGICYILVSAYFSFGGIELFVLSINEQSNPRKSTPVAAKRSVYRXXXXXXXXXXXXGFNV 342
            G    L+ A F++ G EL  ++  E +NPRK+ P A  +  +R            G  V
Sbjct: 256 LGWVSSLIKAAFTYQGTELVGITAGESTNPRKNVPKAINKVFFRILFFYIGSLLFVGLLV 315

Query: 343 PHNNDQLMGSGGSATHASPYVLAASIHKVRVIPHIINAVILISVISVANSALYAAPRLMC 402
           P+++ +L     +  +ASP+V++      +++P I NAV+LI+VIS ANS +Y   R+  
Sbjct: 316 PYDDPRLNSESSTDVNASPFVISIKNAGTKILPDIFNAVVLITVISAANSNVYIGSRVAY 375

Query: 403 SLAQQGYAPKFLNYIDREGRPLRAXXXXXXXXXXXXXACSPQEEQAFTWLAAIAGLSELF 462
           SLA  G APK L ++ ++G P                  +     AF WL  I+ L+ L 
Sbjct: 376 SLALAGNAPKQLAFVTKQGVPYFGVLITSLMGLMSFLVLNHNASTAFDWLVNISTLAGLC 435

Query: 463 TWSGIMLSHIRFRKAMKVQGRSLDEVGYKANTGIWGSYYGVFFNMLVFMAQFWVALSPIG 522
            W  I L+HIRF + +K +G S D++ +KA    W +YY  FF  ++   Q + A +P  
Sbjct: 436 AWLFISLAHIRFMQCLKHRGISRDDLPFKAKFMPWAAYYATFFVTVIIFIQGYTAFTP-- 493

Query: 523 NGGKCDAQAFFESYLAAPLWIFMYVGYMVYKRDFTFLNPLDKIDLDFHRRVYDPEIMRQE 582
              K D   FF SY++  L + +++G  +Y +   FL  ++ ID+D  RR  D  +  ++
Sbjct: 494 ---KFDVTTFFTSYISLFLMLLVFIGCQIYYKC-RFLWAVEDIDIDSDRREIDAIVWEED 549

Query: 583 DEEN 586
           + +N
Sbjct: 550 EPKN 553

>KLLA0E16335g 1455271..1457088 gi|28565044|gb|AAO32605.1
           Kluyveromyces lactis DIP5, start by similarity
          Length = 605

 Score =  245 bits (626), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 154/517 (29%), Positives = 261/517 (50%), Gaps = 19/517 (3%)

Query: 85  HLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLSLAGPGSLVIGYVMVSFVTYFMVQAAGE 144
            LKK++++RHV M+++G  +GTGLL+     L+LAGP +++I Y  V  + +F++   GE
Sbjct: 78  RLKKALEARHVSMIAIGGSLGTGLLIGTGSSLALAGPAAILIAYAFVGLLVFFVMSCLGE 137

Query: 145 MGVTYPTLPGNFNAYNSIFISKSFGFATTWLFCIQWLTVLPLELITSSMTVKYW--NDTI 202
           M    P     F +Y++ +   + GFA  + +  ++  ++P +L   ++ ++YW   D +
Sbjct: 138 MAAYIPL--DGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWVDRDKV 195

Query: 203 NADXXXXXXXXXXXXXXXXGVKAYGETEFIFNSCKILMVAGFIILSVVINCGGAGVDGYI 262
           N                  GV+ +GE E+  ++ KI ++ G IIL +V+ CGG      +
Sbjct: 196 NPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMLGLIILLLVLACGGGPNHEVL 255

Query: 263 GGKYWRDPGSFAEGSGAT-----RFKGICYILVSAYFSFGGIELFVLSINEQSNPRKSTP 317
           G KYW++PG+F E S A      RF     + V A F++ G EL  + ++E  NPRK+ P
Sbjct: 256 GFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKNPRKAVP 315

Query: 318 VAAKRSVYRXXXXXXXXXXXXGFNVPHNNDQLMG--SGGSATHASPYVLAASIHKVRVIP 375
            A K ++YR            G  VP N+  L+   S  ++  ASP+V+A     + V+P
Sbjct: 316 KAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLISAKSAKTSASASPFVVAIVNAGIPVLP 375

Query: 376 HIINAVILISVISVANSALYAAPRLMCSLAQQGYAPKFLNYIDREGRPLRAXXXXXXXXX 435
           HI+NA ILI V S ANS LY A R +  LA    AP+     +++G P  +         
Sbjct: 376 HIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVGVLFAL 435

Query: 436 XXXXACSPQEEQAFTWLAAIAGLSELFTWSGIMLSHIRFRKAMKVQGRSLDEVGYKANTG 495
                 S    + FT+      +  L +W  I++++IRF KA +VQG     + Y++   
Sbjct: 436 LAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAYQSPLQ 495

Query: 496 IWGSYYGVFFNMLVFMAQFWVALSPIGNGGKCDAQAFFESYLAAPLWIFMYVGYMVYKRD 555
            +G+++ +FF +L+ + + +    P   G   D ++F   Y+  P +I  Y+GY ++ + 
Sbjct: 496 PYGAWFSLFFCILIGLIKNF----PAFLGDTFDYKSFITGYIGIPTYIISYIGYKLWYK- 550

Query: 556 FTFLNPLDKIDLDFHRRVYD--PEIMRQEDEENKERL 590
            T + P +++DL   +   D   E  +  DEE    L
Sbjct: 551 -TKIIPSEEVDLVSFKEAVDLEEEEGKMLDEERAAHL 586

>YPL265W (DIP5) [5186] chr16 (41043..42869) Dicarboxylic amino acid
           permease, also transports alanine, glycine, serine,
           asparagine and glutamine [1827 bp, 608 aa]
          Length = 608

 Score =  244 bits (622), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 161/524 (30%), Positives = 261/524 (49%), Gaps = 23/524 (4%)

Query: 83  NNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLSLAGPGSLVIGYVMVSFVTYFMVQAA 142
           N  L+K +K+RH+ M+++G  +GTGLL+     L   GP +++I Y  V  + ++ +   
Sbjct: 79  NTRLRKDLKARHISMIAIGGSLGTGLLIGTGTALLTGGPVAMLIAYAFVGLLVFYTMACL 138

Query: 143 GEMGVTYPTLPGNFNAYNSIFISKSFGFATTWLFCIQWLTVLPLELITSSMTVKYW--ND 200
           GEM  +Y  L G F +Y S ++  + GFA  + +  ++  + P +L  +++ ++YW   D
Sbjct: 139 GEMA-SYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRD 196

Query: 201 TINADXXXXXXXXXXXXXXXXGVKAYGETEFIFNSCKILMVAGFIILSVVINCGGAGVDG 260
            +N                  GVK +GE EF  +S K++++ G I+L  +I  GG     
Sbjct: 197 RVNPGVWITIFLVVIVAINVVGVKFFGEFEFWLSSFKVMVMLGLILLLFIIMLGGGPNHD 256

Query: 261 YIGGKYWRDPGSFAEGS-----GATRFKGICYILVSAYFSFGGIELFVLSINEQSNPRKS 315
            +G +YWRDPG+F E S     G  +F     + V + FS+ GIEL  +  +E  NPRKS
Sbjct: 257 RLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPRKS 316

Query: 316 TPVAAKRSVYRXXXXXXXXXXXXGFNVPHNNDQLMGSGGSATH--ASPYVLAASIHKVRV 373
            P A K +VYR            G  V +N+ +L+ + G +    ASP+V+A     + V
Sbjct: 317 VPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIEV 376

Query: 374 IPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPKFLNYIDREGRPLRAXXXXXXX 433
           +PHI NA +L+ V S  NS LY + R + +LA  G APK      R G P  A       
Sbjct: 377 LPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSVLF 436

Query: 434 XXXXXXACSPQEEQAFTWLAAIAGLSELFTWSGIMLSHIRFRKAMKVQGRSLDEVGYKAN 493
                   S    + F +   +  +  + +W  I++ +I F KA + QG    +  Y A 
Sbjct: 437 CGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAP 496

Query: 494 TGIWGSYYGVFFNMLV-FMAQFWVALSPIGNGGKCDAQAFFESYLAAPLWIFMYVGY-MV 551
              +G+Y+ +FF +L+  +  F V L     G K D + F   Y+  P++I  + GY ++
Sbjct: 497 GQRYGAYFALFFCILIALIKNFTVFL-----GHKFDYKTFITGYIGLPVYIISWAGYKLI 551

Query: 552 YKRDFTFLNPLDKIDLDFHRRVYD--PEIMRQEDEENKERLKNS 593
           YK   T +     +DL   + +YD   E  R +D+E +ERLK++
Sbjct: 552 YK---TKVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKSN 592

>YNL270C (ALP1) [4339] chr14 complement(135939..137660) Arginine
           permease, has strong similarity to basic amino acid
           permeases Can1p and Lyp1p, member of the amino acid
           permease family of membrane transporters [1722 bp, 573
           aa]
          Length = 573

 Score =  241 bits (614), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 164/568 (28%), Positives = 279/568 (49%), Gaps = 31/568 (5%)

Query: 10  KMEKSAEFEVTDSALYNNFNTSTTASLTPEIKEHSEESRNGLVHRFVDSFRRAESQRLEE 69
           +M K  ++E+  S++                +E  +E  +G      +  +   ++R  E
Sbjct: 8   QMSKEGQYEINSSSIIKE-------------EEFVDEQYSG-----ENVTKAITTERKVE 49

Query: 70  DNDLEDGTKSMKSNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLSLAGPGSLVIGYV 129
           D+  ++   S +    +K+ +K RH+ M++LG  IGTGL++     L+ AGP   +I Y+
Sbjct: 50  DDAAKETESSPQERREVKRKLKQRHIGMIALGGTIGTGLIIGIGPPLAHAGPVGALISYL 109

Query: 130 MVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFISKSFGFATTWLFCIQWLTVLPLELI 189
            +  V Y + Q+ GEM VT+  +  +F+ +   F+S + G    +++ + W     LEL 
Sbjct: 110 FMGTVIYSVTQSLGEM-VTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELS 168

Query: 190 TSSMTVKYWNDTINADXXXXXXXXXXXXXXXXGVKAYGETEFIFNSCKILMVAGFIILSV 249
                ++YW + +                    VK YGE EF   S K++ + GFII S 
Sbjct: 169 VLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSF 228

Query: 250 VINCGGAGVDGYIGGKYWRDPGSFAEGSGAT-----RFKGICYILVSAYFSFGGIELFVL 304
            + CG    DG IG +YWR+PG++  G  ++     RF G    L++A F++ G EL  +
Sbjct: 229 CVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGI 288

Query: 305 SINEQSNPRKSTPVAAKRSVYRXXXXXXXXXXXXGFNVPHNNDQLMGSGGSATHASPYVL 364
           +  E +NPRK+ P A K+ V R            G  VP+N+ +L  S G    +SP+++
Sbjct: 289 TAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKL-DSDGIFVSSSPFMI 347

Query: 365 AASIHKVRVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPKFLNYIDREGRPL 424
           +      +V+P I NAV+LI+++S  NS +Y   R++ SL++   AP+FL+ + R G P 
Sbjct: 348 SIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPY 407

Query: 425 RAXXXXXXXXXXXXXACSPQEEQAFTWLAAIAGLSELFTWSGIMLSHIRFRKAMKVQGRS 484
            +               S    +AF WL  I G++  F W  I  SHIRF +A++ +G S
Sbjct: 408 FSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGIS 467

Query: 485 LDEVGYKANTGIWGSYYGVFFNMLVFMAQFWVALSPIGNGGKCDAQAFFESYLAAPLWIF 544
            D++ YKA    + +YY  FF  L+ + Q + A +P           F  +Y++  L++ 
Sbjct: 468 RDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAP-----TFQPIDFVAAYISIFLFLA 522

Query: 545 MYVGYMVYKRDFTFLNPLDKIDLDFHRR 572
           +++ + V+ +    L  L  ID+D  RR
Sbjct: 523 IWLSFQVWFKC-RLLWKLQDIDIDSDRR 549

>CAGL0A01199g 121067..122908 similar to sp|P53388 Saccharomyces
           cerevisiae YPL265w DIP5 dicarboxylic amino acid
           permease, hypothetical start
          Length = 613

 Score =  240 bits (613), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 163/546 (29%), Positives = 266/546 (48%), Gaps = 28/546 (5%)

Query: 64  SQRLE----EDNDLEDGTKSMKSNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLSLA 119
           S RLE    +D+ ++DG      +  L+K +K+RH+ M+++G  IGTGLL+     L  A
Sbjct: 63  SSRLEDSEKQDDYMDDGKDE---HTRLRKDLKARHISMIAIGGSIGTGLLIGTGNSLYTA 119

Query: 120 GPGSLVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFISKSFGFATTWLFCIQ 179
           GP S+ I Y  V  + +F + A GEM  +Y  L G F +Y S +   + GFA  + +  +
Sbjct: 120 GPMSMFIAYAFVGVLVFFTMAALGEMA-SYIPLDG-FTSYASRYCDPALGFAVGYAYLCK 177

Query: 180 WLTVLPLELITSSMTVKYWND--TINADXXXXXXXXXXXXXXXXGVKAYGETEFIFNSCK 237
           +L + P +L  +++ ++YW D   +N                  GVK +GE EF  ++ K
Sbjct: 178 YLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFK 237

Query: 238 ILMVAGFIILSVVINCGGAGVDGYIGGKYWRDPGSFAEGSGAT-----RFKGICYILVSA 292
           ++++ G IIL  VI  GG      +G +++  PG+F   S +      +F     +LV A
Sbjct: 238 VIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKFVAFVAVLVYA 297

Query: 293 YFSFGGIELFVLSINEQSNPRKSTPVAAKRSVYRXXXXXXXXXXXXGFNVPHNNDQL--M 350
            F++ GIEL  +   E +NPRKS P A K ++YR            G  V +++  L   
Sbjct: 298 LFAYLGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLKKA 357

Query: 351 GSGGSATHASPYVLAASIHKVRVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYA 410
            + G+   ASPYV+A     ++ +PHI NA +L+ V S  NS LY A R +  LA    A
Sbjct: 358 KTSGTGAAASPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKA 417

Query: 411 PKFLNYIDREGRPLRAXXXXXXXXXXXXXACSPQEEQAFTWLAAIAGLSELFTWSGIMLS 470
           PK     +R G P  +             + S    + F +   +  +  L +W  I+++
Sbjct: 418 PKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILIT 477

Query: 471 HIRFRKAMKVQGRSLDEVGYKANTGIWGSYYGVFFNMLV-FMAQFWVALSPIGNGGKCDA 529
           ++ F +A+K Q        Y+A    +GSY+ + F +L+ F+  F V L+        D 
Sbjct: 478 YLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFLN-----HHFDY 532

Query: 530 QAFFESYLAAPLWIFMYVGYMVYKRDFTFLNPLDKIDLDFHRRVYDPEIMRQE--DEENK 587
           + F   Y+  P+++  Y GY   K+  T +   +++DL   +   D E  + +  D E +
Sbjct: 533 KNFITGYIGIPVFVISYFGYKFVKK--TKIWKPEEVDLYTFKAAIDEEEEQGKIADAERR 590

Query: 588 ERLKNS 593
           ERLKNS
Sbjct: 591 ERLKNS 596

>AFR668W [3861] [Homologous to ScYEL063C (CAN1) - SH; ScYNL270C
           (ALP1) - SH] complement(1659469..1661139) [1671 bp, 556
           aa]
          Length = 556

 Score =  236 bits (601), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 142/491 (28%), Positives = 243/491 (49%), Gaps = 14/491 (2%)

Query: 63  ESQRLEEDNDLEDGTKSMKSNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLSLAGPG 122
           +++ L  +    +      + + +K+ +K RHV M+SLG  IGTGL +  A  +  AGP 
Sbjct: 26  KAEVLNHNTSEVESLCEKPNQSDVKRELKPRHVTMISLGGTIGTGLFIGIASPIRNAGPV 85

Query: 123 SLVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFISKSFGFATTWLFCIQWLT 182
             ++ Y+ V+ + Y + Q+ GEM  T+  +  +F  + S F+S + G A  +L+ + W  
Sbjct: 86  GSLLAYIFVATMAYCVTQSLGEMA-TFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCI 144

Query: 183 VLPLELITSSMTVKYWNDTINADXXXXXXXXXXXXXXXXGVKAYGETEFIFNSCKILMVA 242
              LE+      + YW+D +                    VK YGE EF   S K++ + 
Sbjct: 145 TFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAIL 204

Query: 243 GFIILSVVINCGGAGVDGYIGGKYWRDPGSFAEGSGA-----TRFKGICYILVSAYFSFG 297
            F+   +V+ CGG+ + G IG +YW+DPG +  G  +      +F G    L+ A F+F 
Sbjct: 205 CFLFYGLVVVCGGSKL-GRIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQ 263

Query: 298 GIELFVLSINEQSNPRKSTPVAAKRSVYRXXXXXXXXXXXXGFNVPHNNDQLMGSGGSA- 356
           G EL  ++  E  NPR++ P A     +R            G  V +++ QL+  G +  
Sbjct: 264 GTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTN 323

Query: 357 THASPYVLAASIHKVRVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPKFLNY 416
            +ASP+V+A +    +V+P I+N VI++++IS  NS +Y   R++  L + G AP F++ 
Sbjct: 324 ANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISR 383

Query: 417 IDREGRPLRAXXXXXXXXXXXXXACSPQEEQAFTWLAAIAGLSELFTWSGIMLSHIRFRK 476
               G P  A               S +    F WL +I  +S  FTW  I +SHIRF +
Sbjct: 384 TTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQ 443

Query: 477 AMKVQGRSLDEVGYKANTGIWGSYYGVFFNMLVFMAQFWVALSPIGNGGKCDAQAFFESY 536
            +K +G S D++ +KA    +G+YY  FF +++ + Q + A +P        A  F   Y
Sbjct: 444 CLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTPF------SAVDFVAYY 497

Query: 537 LAAPLWIFMYV 547
           ++A +++ +++
Sbjct: 498 ISAFIFVVIWL 508

>Scas_377.2
          Length = 490

 Score =  227 bits (578), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 147/494 (29%), Positives = 241/494 (48%), Gaps = 16/494 (3%)

Query: 105 GTGLLVANAKGLSLAGPGSLVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFI 164
           G GL +  +  L  AGP   +I Y+ ++ + Y + Q+ GEM  T+  +  +F  ++  F+
Sbjct: 4   GXGLFIGVSTPLMNAGPVGALIAYLFMATLAYSVTQSLGEMA-TFIPVTSSFTVFSQRFV 62

Query: 165 SKSFGFATTWLFCIQWLTVLPLELITSSMTVKYWNDTINADXXXXXXXXXXXXXXXXGVK 224
           S +FG A  +++   W     LEL      +++W   +                    VK
Sbjct: 63  SPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVK 122

Query: 225 AYGETEFIFNSCKILMVAGFIILSVVINCGGAGVDGYIGGKYWRDPGSFAEGSGA----- 279
            YGE EF     K++ + GF+I    + CG AGV G +G +YWR PG+F  G  A     
Sbjct: 123 YYGEFEFWVALVKVVAIMGFLIYCFCMVCG-AGVTGPVGFRYWRHPGAFGPGIIAKDKNQ 181

Query: 280 TRFKGICYILVSAYFSFGGIELFVLSINEQSNPRKSTPVAAKRSVYRXXXXXXXXXXXXG 339
            RF G    L++A F+F G EL  ++  E +NPRK+ P A K+ V+R            G
Sbjct: 182 ARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILFFYILSLFFIG 241

Query: 340 FNVPHNNDQLMGSGGSATHASPYVLAASIHKVRVIPHIINAVILISVISVANSALYAAPR 399
             VP+++ +L  S  S   ASP+++A       V+PHI NAVI+ ++IS  NS +Y   R
Sbjct: 242 LLVPYDDWKLT-STDSYVSASPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSR 300

Query: 400 LMCSLAQQGYAPKFLNYIDREGRPLRAXXXXXXXXXXXXXACSPQEEQAFTWLAAIAGLS 459
           +M  L+    AP  L+   + G P  A               S   ++AF WL  I G++
Sbjct: 301 IMYGLSTSRLAPGILSRTTQHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVA 360

Query: 460 ELFTWSGIMLSHIRFRKAMKVQGRSLDEVGYKANTGIWGSYYGVFFNMLVFMAQFWVALS 519
             FTW  I LSHIRF +A++++G S D++ +KA      +YYGVFF  L+ + Q + +  
Sbjct: 361 GFFTWLFISLSHIRFMQALEMRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFC 420

Query: 520 PIGNGGKCDAQAFFESYLAAPLWIFMYVGYMVYKRDFTFLNPLDKIDLDFHRRVYDPEI- 578
           P       +   F  +Y++  ++I +++ +  + R    +  ++ +D+D  RR  +  + 
Sbjct: 421 P------WNGIDFLTAYISVFMFIAIWIAFQAWFRC-RLIWRVEDVDIDTDRRAVEEAVW 473

Query: 579 MRQEDEENKERLKN 592
           + QE     ++  N
Sbjct: 474 IEQEPRGFWDKFWN 487

>Scas_84.1
          Length = 213

 Score =  211 bits (536), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 103/211 (48%), Positives = 136/211 (64%)

Query: 240 MVAGFIILSVVINCGGAGVDGYIGGKYWRDPGSFAEGSGATRFKGICYILVSAYFSFGGI 299
           M+ GF IL +V+ CGGAG DGYIG K W +PGSF       RFKG+   L +A F+FG  
Sbjct: 1   MLTGFFILGIVVICGGAGNDGYIGTKLWHNPGSFRGDKPVDRFKGVASTLANAAFAFGMT 60

Query: 300 ELFVLSINEQSNPRKSTPVAAKRSVYRXXXXXXXXXXXXGFNVPHNNDQLMGSGGSATHA 359
           E   ++ +EQSNPRK+ P AAK  +YR            G+ VP+++DQL+G+ G+AT A
Sbjct: 61  EFLGVTASEQSNPRKAIPSAAKNMLYRIICIYLGSVTIVGYLVPYDSDQLLGTSGAATKA 120

Query: 360 SPYVLAASIHKVRVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPKFLNYIDR 419
           SPYVLA S+H VRV+PH I+AVIL+SV+SV NSA Y+  R +  L+Q GYAP FLNY+DR
Sbjct: 121 SPYVLAISVHGVRVVPHFIHAVILMSVVSVGNSAFYSTSRQLLPLSQLGYAPSFLNYVDR 180

Query: 420 EGRPLRAXXXXXXXXXXXXXACSPQEEQAFT 450
            GRP++A             A SP+E ++  
Sbjct: 181 NGRPMKAYCVSPLAGVIAYCATSPEEAKSLC 211

>KLLA0F27093g 2501049..2502740 similar to sp|P43548 Saccharomyces
           cerevisiae YFL055w AGP3 amino acid permease, start by
           similarity
          Length = 563

 Score =  221 bits (563), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 151/556 (27%), Positives = 253/556 (45%), Gaps = 40/556 (7%)

Query: 19  VTDSALYNNFNTSTTASLTPEIKEHSEESRNGLVHRFVDSFRRAESQRLEEDNDLEDGTK 78
           V++  L + +N  T   + P+  E++EE                +S   E+  D + G  
Sbjct: 14  VSNRGLKDAYNEVTEMEVDPKNNEYAEE----------------QSLNREDTFDPDSG-- 55

Query: 79  SMKSNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLSLAGPGSLVIGYVMVSFVTYFM 138
                  +K+ +K RH+ +++LG  IG G L+     L++ GP +L++G+ ++  + + M
Sbjct: 56  -------VKRQLKDRHISLLALGGIIGPGCLIGAGNALAIGGPLALLLGFGIIGILAFIM 108

Query: 139 VQAAGEMGVTYPTLPGNFNAYNSIFISKSFGFATTWLFCIQWLTVLPLELITSSMTVKYW 198
           +++ GEM   YP+  G F      F S +      + + + +  VL  E  T S  +++W
Sbjct: 109 MESIGEMITLYPS-GGGFTTLTRRFHSDALSAVCGYAYAVVFFAVLANEYNTLSSIMQFW 167

Query: 199 NDTINADXXXXXXXXXXXXXXXXGVKAYGETEFIFNSCKILMVAGFIILSVVINCGGAGV 258
              +                   GV A+GETE+     KIL +  + I S+V   GG   
Sbjct: 168 GPQVPLYGYILIFWAAFQVFQLLGVGAFGETEYWLAWFKILGLLTYYIFSIVYISGGVKN 227

Query: 259 DGYIGGKYWRDPGSFAEGSGATRFKGICYILVSAYFSFGGIELFVLSINEQSNPRKSTPV 318
               G +YW DPG+ + G     FKGI  + V     + G E   L+  E  NPR++ P+
Sbjct: 228 RPAFGFQYWNDPGALSNG-----FKGIANVFVFCSTFYSGTESVALAATESKNPRRAVPI 282

Query: 319 AAKRSVYRXXXXXXXXXXXXGFNVPHNNDQLMGSGGSATHASPYVLAASIHKVRVIPHII 378
           A +++ +R            G  VP+N++ L  +  +    SP  +A S        H++
Sbjct: 283 AIRQTFWRILIVYLGISIFYGVTVPYNDENL--NFATKVLKSPIAIAISRAGWPAGVHLV 340

Query: 379 NAVILISVISVANSALYAAPRLMCSLAQQGYAPKFLNYIDREGRPLRAXXXXXXXXXXXX 438
           NA ILI+ IS  N +LY   R +  LA +G APK L + DR G P+ A            
Sbjct: 341 NAFILITCISAINGSLYIGSRTLTHLANEGLAPKLLAWTDRRGVPIPAITVFNALGLISL 400

Query: 439 XACSPQEEQAFTWLAAIAGLSELFTWSGIMLSHIRFRKAMKVQGRSLDEVGYKANTGIWG 498
              S     A+ ++  ++G+     W  I L+H+RFRKA K+QG + DE+ YKA      
Sbjct: 401 MNVSVTAVDAYNYIVNLSGVGVFIVWGIISLTHLRFRKAWKLQGHTRDELPYKAKLFPVF 460

Query: 499 SYYGVFFNMLVFMAQFWVALSPIGNGGKCDAQAFFESYLAAPLWIFMYVGYMVYK-RDFT 557
               +  N+ + + Q W    P       DA+ F ++Y+  P  I +Y+G   +K + F 
Sbjct: 461 PIVSIIANIFLGLVQGWSYFKPF------DAKNFVDAYILIPAGIILYLGVSYWKTKGFL 514

Query: 558 FLNPLDKIDLDFHRRV 573
               L +++L F +R+
Sbjct: 515 TAVDLSEVNLLFGQRL 530

>Kwal_33.15545
          Length = 576

 Score =  220 bits (560), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 161/565 (28%), Positives = 258/565 (45%), Gaps = 41/565 (7%)

Query: 58  SFRRAESQRLEEDNDLEDGTKSMKSNNH----------------LKKSMKSRHVVMMSLG 101
           S  +  +  L  +  LE+G  +++S                   LKK +++RHV M+++G
Sbjct: 6   SMEKKNAGVLYSNETLEEGIVTLESEGQVRSVSEGVDGKHEGIRLKKELEARHVSMIAIG 65

Query: 102 TGIGTGLLVANAKGLSLAGPGSLVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNS 161
             +GTGLL+     L+ AGP S++I Y  V  + Y ++   GEM    P L G F +Y S
Sbjct: 66  GSLGTGLLIGTGSSLASAGPVSILISYSFVGLLVYTVMSCLGEMAAFIP-LDG-FTSYAS 123

Query: 162 IFISKSFGFATTWLFCIQWLTVLPLELITSSMTVKYW--NDTINADXXXXXXXXXXXXXX 219
            ++  + GFA  + +  ++  V P +L   +M +++W   D +N                
Sbjct: 124 RYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLIN 183

Query: 220 XXGVKAYGETEFIFNSCKILMVAGFIILSVVINCGGAGVDGYIGGKYWRDPGSFAEGSGA 279
             GV+ +GE EF  +S K+L++ G I+L  +I  GG       G ++WRDPG+F   S A
Sbjct: 184 TVGVRFFGEFEFWLSSVKVLVMLGLILLLFIIMLGGGPNHDRTGFRFWRDPGAFKPYSEA 243

Query: 280 T-----RFKGICYILVSAYFSFGGIELFVLSINEQSNPRKSTPVAAKRSVYRXXXXXXXX 334
                 +F     +   A F++ G EL  +   E  NPR+S P A K ++YR        
Sbjct: 244 ISGSKGKFVSFASVFALALFAYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVIT 303

Query: 335 XXXXGFNVPHNNDQLMGSGGSATH--ASPYVLAASIHKVRVIPHIINAVILISVISVANS 392
               G  V +N+ +L+ +   AT   ASP+V+A     + V+PHI N  +L+ V S  NS
Sbjct: 304 ILLLGMTVAYNDPRLLKAKKMATSAAASPFVVAIENASIPVLPHIFNVCVLVFVFSACNS 363

Query: 393 ALYAAPRLMCSLAQQGYAPKFLNYIDREGRPLRAXXXXXXXXXXXXXACSPQEEQAFTWL 452
            LY A R +  LA  G AP+     ++ G P  +               S    Q F + 
Sbjct: 364 DLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYF 423

Query: 453 AAIAGLSELFTWSGIMLSHIRFRKAMKVQGRSLDEVGYKANTGIWGSYYGVFFNMLVFMA 512
             +  +  L +W  I++++IRF KA++VQ      + Y A    W +Y  +FF  L+ + 
Sbjct: 424 VNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLIGLI 483

Query: 513 QFWVALSPIGNGGKCDAQAFFESYLAAPLWIFMYVGYMVYKRDFTFLNPLDKIDLDFHRR 572
           + +        G K D + F   Y+  P+++  YVGY V  R    + P D +DL   + 
Sbjct: 484 KNYTVFL----GHKFDYKTFISGYIGIPVYLICYVGYKVVYRT-KLIKPED-VDLYTFKD 537

Query: 573 VYDP--------EIMRQEDEENKER 589
             D         E  R E+ EN  +
Sbjct: 538 AIDAEEEEYKLLEKERLENMENSPK 562

>Kwal_26.6940
          Length = 570

 Score =  219 bits (559), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 156/551 (28%), Positives = 265/551 (48%), Gaps = 42/551 (7%)

Query: 41  KEHSEESRNGLVHRFVDSFRRAESQRLEEDNDLEDGTKSMKSNNH-LKKSMKSRHVVMMS 99
           ++  +  +  +V +        +++ L   N    G++S K   H LK+ ++SRH+ +++
Sbjct: 5   RDLKDAGQTSIVDKQTGQVFELDTESLSALN--TGGSESQKREPHTLKQGLQSRHIQLIA 62

Query: 100 LGTGIGTGLLVANAKGLSLAGPGSLVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGN---- 155
           LG  IGTGL V  +  LS  GP  L+  Y+++S V Y ++ A GEM V Y  LPG+    
Sbjct: 63  LGGVIGTGLFVGTSSTLSTCGPAGLLTSYIIISLVIYPVMNALGEM-VCY--LPGSGTDS 119

Query: 156 ---FNAYNSIFISKSFGFATTWLFCIQWLTVLPLELITSSMTVKYWNDTINADXXXXXXX 212
               +   S +   S GFAT W +   ++ ++  E   +S  V YW   +          
Sbjct: 120 GGSISKLVSRYADPSLGFATGWNYYYCYVILIAAECTAASGVVTYWTTVVPKAAWITIFL 179

Query: 213 XXXXXXXXXGVKAYGETEFIFNSCKILMVAGFIILSVVINCGGAGVDGYIGGKYWRDPGS 272
                     VK YGE+EF F   KIL + G + +S ++  GG      +G +YW+ PG+
Sbjct: 180 GVVTMLNFGPVKFYGESEFWFAILKILCIVGLLFVSFILFWGGGPSHDRLGFRYWQKPGA 239

Query: 273 FAE--GSGAT-RFKGICYILVSAYFSF-GGIELFVLSINEQSNPRKSTPVAAKRSVYRXX 328
           FA    +G T RF  +   ++   F+F  G EL  ++ +E  + R++   A++R  YR  
Sbjct: 240 FAYHITTGNTGRFLDVWTGVIKGGFAFILGPELVAVTSSEAMDQRRNIEKASRRFAYRLI 299

Query: 329 XXXXXXXXXXGFNVPHNNDQL---MGSGGSATHASPYVLAASIHKVRVIPHIINAVILIS 385
                     G  V  N+  L   + SG +   +SP+V+A     ++++PHIINA IL S
Sbjct: 300 FFYVASALAIGVIVAQNDPVLRDALASGKAGAASSPFVIAIQNAHIKILPHIINACILSS 359

Query: 386 VISVANSALYAAPRLMCSLAQQGYAPKFLNYIDREGRPLRAXXXXXXXXXXXXXACSPQE 445
             S  NS ++AA R + S+A+ G APK    I+R G P  A               S   
Sbjct: 360 AWSSGNSFMFAASRSLLSMAEDGVAPKMFKKINRAGVPYNAVAVSAAFSCLAYLNVSSGS 419

Query: 446 EQAFTWLAAIAGLSELFTWSGIMLSHIRFRKAMKVQGRSLDEVGYKANTGIWGSYYGVFF 505
            +AFTW + I+ +S    W  I ++++RFRKA+  +G   D V +K+    +G+Y+ +  
Sbjct: 420 AKAFTWFSNISTISGFIGWICIGVAYLRFRKAIFFRGL-YDRVPFKSPFQPYGTYFFIIV 478

Query: 506 NMLV--------FMAQFWVALSPIGNGGKCDAQAFFESYLAAPLWIFMYVGYMVYKRDF- 556
             ++        F+ +FW                F  +Y+  P+++ ++VG+ +Y R   
Sbjct: 479 VSIICLTNGYATFIPRFW------------KGADFVAAYITLPVFVVLWVGHKIYTRTLS 526

Query: 557 TFLNPLDKIDL 567
           T++ P+ ++D+
Sbjct: 527 TWVIPVAEVDV 537

>Kwal_26.9612
          Length = 543

 Score =  217 bits (553), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 151/555 (27%), Positives = 260/555 (46%), Gaps = 32/555 (5%)

Query: 36  LTPEIKEHSEESRNGLVHRFVDSFRRAESQRLEEDNDLEDGTKSMKSNNHLKKSMKSRHV 95
           +TP       E  + L  +  +     E QRLE D+           ++ +K+++K+RH+
Sbjct: 1   MTPTNSIQQREDLDKLEPKIAE----VELQRLETDS-----LNEFDPHSGVKRALKNRHI 51

Query: 96  VMMSLGTGIGTGLLVANAKGLSLAGPGSLVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGN 155
            +++LG  IG G L+     L+  GP +L++G+ ++  V + ++++ GE+   YP+  G 
Sbjct: 52  SLLALGGIIGPGCLIGAGNALNKGGPLALLLGFGIIGLVCFSIMESIGELVTLYPS-GGG 110

Query: 156 FNAYNSIFISKSFGFATTWLFCIQWLTVLPLELITSSMTVKYWNDTINADXXXXXXXXXX 215
           F      F S+     + + + + +  VL  E  T S  +++W   +             
Sbjct: 111 FITLARRFHSEGLSAVSGYAYIVVFFAVLANEYNTISSILQFWGPQVPIYGYTLIFWFFF 170

Query: 216 XXXXXXGVKAYGETEFIFNSCKILMVAGFIILSVVINCGGAGVDGYIGGKYWRDPGSFAE 275
                 GV A+GE E+     KIL +  F I S+V   GG      IG +YW++PG+ + 
Sbjct: 171 LVFQLIGVGAFGECEYWLAWFKILGLVAFYIFSIVYMSGGIPGKPPIGFQYWKNPGALSH 230

Query: 276 GSGATRFKGICYILVSAYFSFGGIELFVLSINEQSNPRKSTPVAAKRSVYRXXXXXXXXX 335
           G     F+GI  + V     + G E   L+  E  NPRK+ P+A +++ +R         
Sbjct: 231 G-----FRGIAVVFVFCSTFYSGTESVALAATESRNPRKAVPLAVRQTFWRILIVYLGIS 285

Query: 336 XXXGFNVPHNNDQLMGSGGSATHASPYVLAASIHKVRVIPHIINAVILISVISVANSALY 395
              G  VP+N+  L     + +  SP  +A S        H++NA IL++ IS  NS+LY
Sbjct: 286 FFYGVTVPYNDPTL--GAQTKSLKSPISIALSRAGWAGGVHLVNAFILMTCISAINSSLY 343

Query: 396 AAPRLMCSLAQQGYAPKFLNYIDREGRPLRAXXXXXXXXXXXXXACSPQEEQAFTWLAAI 455
              R +  LA +G AP+ L + D+ G P+ A               S     A+ ++  +
Sbjct: 344 IGSRTLSHLAHEGLAPRILAWTDKRGVPVPALIVFNALGLISLMNVSVGASNAYNYIVNL 403

Query: 456 AGLSELFTWSGIMLSHIRFRKAMKVQGRSLDEVGYKANTGIWGSYYGVFFNMLVFMAQFW 515
           +G+     WS I ++H+RFRKA   QGRSL E+ Y+A    W + + +  N+ + + Q W
Sbjct: 404 SGVGVFIVWSAISITHLRFRKAWVAQGRSLSELPYRALFYPWTTIFSLAANIFLALIQGW 463

Query: 516 VALSPIGNGGKCDAQAFFESYLAAPLWIFMYVGYMVYK-RDFTFLNPLDKIDLDFHRRVY 574
            +L P        A+ F ++Y+  P    +YVG   +K R+F  +N +  I+L+  +R  
Sbjct: 464 TSLVPF------VAKDFVDAYILLPAAGLLYVGINFWKNRNFKTVN-IHGINLEEGQR-- 514

Query: 575 DPEIMRQEDEENKER 589
                R  DE++ + 
Sbjct: 515 -----RDLDEDSDDE 524

>Scas_486.2
          Length = 597

 Score =  217 bits (553), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 156/560 (27%), Positives = 268/560 (47%), Gaps = 36/560 (6%)

Query: 58  SFRRAESQRLEED--NDLEDGTKSMKSNN-----------HLKKSMKSRHVVMMSLGTGI 104
           +F   E + L +D  N++   T +   N+            LKK ++ R V M+++G  +
Sbjct: 30  TFPTQERELLHDDLENNISLSTSAEDQNDSYNVDGKTEGTRLKKVLEGRVVSMVAIGGSL 89

Query: 105 GTGLLVANAKGLSLAGPGSLVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFI 164
           GTGLL+     L+ AGP S++I Y  V  + +F + + GEM  +Y  L G F +Y + + 
Sbjct: 90  GTGLLIGTGNSLATAGPVSMLIAYAFVGLLVFFTMASLGEMA-SYIPLDG-FTSYATRYA 147

Query: 165 SKSFGFATTWLFCIQWLTVLPLELITSSMTVKYW--NDTINADXXXXXXXXXXXXXXXXG 222
             + GFA  + +  ++  + P +L  +++ ++YW   + +N                  G
Sbjct: 148 DPALGFAVGYCYLFKYFILPPNQLTAAALVIQYWIPREKVNPGVWITIFLVVIVAINTLG 207

Query: 223 VKAYGETEFIFNSCKILMVAGFIILSVVINCGGAGVDGYIGGKYWRDPGSFAEGSGAT-- 280
           V+ +GE EF  +S K+L++   IIL  ++  GG      +G ++W+ PG+F   S A   
Sbjct: 208 VQFFGEFEFWLSSFKVLVMFALIILLFILMLGGGPNHDRLGFRHWKHPGAFNNYSPAITG 267

Query: 281 ---RFKGICYILVSAYFSFGGIELFVLSINEQSNPRKSTPVAAKRSVYRXXXXXXXXXXX 337
              +F     + V A F++ G EL  + + E  NPRKS P A K ++YR           
Sbjct: 268 DTGKFVAFVSVFVYATFAYLGTELVGIVVGEARNPRKSVPKAIKLTMYRIIIFYLISILL 327

Query: 338 XGFNVPHNNDQLMGSGGSATHA--SPYVLAASIHKVRVIPHIINAVILISVISVANSALY 395
            G  V +++  L+ +   +T A  SP+V+A     ++V+PHI NA +L+ V S  NS LY
Sbjct: 328 LGMCVGYDDPLLLEAKTKSTSAAASPFVVAIVNSGIKVLPHIFNACVLVFVFSACNSDLY 387

Query: 396 AAPRLMCSLAQQGYAPKFLNYIDREGRPLRAXXXXXXXXXXXXXACSPQEEQAFTWLAAI 455
            A R + SLA    APK     +R G P  +             + S    + F +   +
Sbjct: 388 VASRSLYSLAIDNKAPKIFARTNRWGIPYYSLGLSVLFCLLAYMSVSSGSAKIFNYFVNV 447

Query: 456 AGLSELFTWSGIMLSHIRFRKAMKVQGRSLDEVGYKANTGIWGSYYGVFF-NMLVFMAQF 514
             +  L +W  I+++++ F +A++ QG       Y A    +G+Y+ +FF +++  +  F
Sbjct: 448 VSIFGLLSWICILVTYLAFDRAVRAQGIDKSTFSYVAPGQRYGAYFALFFCSLIALIKNF 507

Query: 515 WVALSPIGNGGKCDAQAFFESYLAAPLWIFMYVGY-MVYKRDFTFLNPLDKIDLDFHRRV 573
            V L     G + D + F   Y+  P++   Y GY ++YK     ++PL+ +DL   +  
Sbjct: 508 TVFL-----GHQFDYKTFITGYIGIPVFFISYFGYKLIYKTK--IIDPLE-VDLYTFKAA 559

Query: 574 YDPEIM--RQEDEENKERLK 591
            D E    + ED   KER+K
Sbjct: 560 IDQEEEDGKLEDIARKERIK 579

>KLLA0B14685g complement(1289025..1290740) similar to sp|P15380
           Saccharomyces cerevisiae YOR348c PUT4 proline and
           gamma-aminobutyrate permease P23. 1.f18.1, start by
           similarity
          Length = 571

 Score =  213 bits (543), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 161/593 (27%), Positives = 271/593 (45%), Gaps = 52/593 (8%)

Query: 8   SSKMEKSAEFEVTDSALYNNFNTSTTASLTPEIKEHSEESRNGLVHRFVDSFRRAESQRL 67
           S K+E S +  ++ S   +N            IKE +  S N ++               
Sbjct: 2   SKKLELSQQASISLSPYISN-----------RIKEQAFSSVNDVIG-------------- 36

Query: 68  EEDNDLEDGTKSMKSNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLSLAGPGSLVIG 127
           + D       ++ K    + + +K+RH+ +++LG+ IGTGL + +   LS+ GP  L+I 
Sbjct: 37  DSDQGSYSDIENFKPPQKIVRGLKTRHIQLIALGSAIGTGLFIGSGGALSVCGPAPLLIA 96

Query: 128 YVMVSFVTYFMVQAAGEMGVTYPTLPGNFNAYN--SIFISKSFGFATTWLFCIQWLTVLP 185
           Y+++SF  + ++    EM    P LPG  + Y+    +++    F   W        ++P
Sbjct: 97  YIIISFFVWSIMNQMTEMVCLIP-LPGEASLYSLAKTYLNSPISFMCGWNLFYAMAMIVP 155

Query: 186 LELITSSMTVKYWNDTINADXXXXXXXXXXXXXXXXGVKAYGETEFIFNSCKILMVAGFI 245
            E+   ++ V+YW D  N+                  VK +GE+EF  +S KIL + G I
Sbjct: 156 AEITACALLVQYWTDA-NSAIFISIFIVVSILLTMLPVKVFGESEFWVSSIKILTIVGLI 214

Query: 246 ILSVVINCGGA-GVDGYIGGKYWRDPGSF----AEGSGATRFKGICYILVSAYFSFGGIE 300
           I+ +VI  GG    D  +G  YW++PG+F    AEG+   RF  +   ++ + FSF  + 
Sbjct: 215 IVGIVIFFGGGPAQDHVLGFHYWKNPGAFNPHLAEGNTG-RFLAVWTAIIKSGFSFVLVP 273

Query: 301 LFVLSINEQS-NPRKSTPVAAKRSVYRXXXXXXXXXXXXGFNVPHNNDQLMG---SGGSA 356
             V S + +   PR++ P A +R +YR            G  V  NND+L+    SG S 
Sbjct: 274 ETVTSCSAECIAPRRNMPKACQRFIYRLAIFYIVGTLVVGVIVGFNNDRLINAIQSGKSD 333

Query: 357 THASPYVLAASIHKVRVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPKFLNY 416
             ASP+V+      ++++PHIINA IL S  S     LY + R + S+A +G APK    
Sbjct: 334 AAASPFVIGIQEAGIKILPHIINACILTSAYSCGTGLLYGSSRTLYSMALRGDAPKIFAK 393

Query: 417 IDREGRPLRAXXXXXXXXXXXXXACSPQEEQAFTWLAAIAGLSELFTWSGIMLSHIRFRK 476
           ++R G P  +              CS      F WL+ IA +S   +W  + +++IRFRK
Sbjct: 394 VNRFGTPYYSTGLASLFSFLAYLNCSKSASVVFNWLSNIATISGFVSWIFVSMTYIRFRK 453

Query: 477 AMKVQGRSLDEVGYKANTGIWGSYYGV-FFNMLVFMAQFWVALSPIGNGGKCDAQAFFES 535
            +     + D V ++    +  +Y    FF +L     + V +      G  +   FF S
Sbjct: 454 VINALDLN-DRVPFRRPFQVPLAYLTCGFFFILSLTNGYAVFVK-----GNWNVSDFFAS 507

Query: 536 YLAAPLWIFMYVGYMVYKRDFTFLNPLDKIDLDFHRRVYDPEIMRQEDEENKE 588
           Y+     IF+Y+    Y + +TF +   +I+++       P+I   ++EE  +
Sbjct: 508 YVTIGFVIFLYLVGSFYYKQWTFRD-FKEIEVEIL-----PKIDIADEEERND 554

>YOR348C (PUT4) [5125] chr15 complement(986894..988777) High
           affinity proline permease, also transports alanine and
           glycine [1884 bp, 627 aa]
          Length = 627

 Score =  214 bits (546), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 160/586 (27%), Positives = 266/586 (45%), Gaps = 59/586 (10%)

Query: 39  EIKEHSEESRNGLVHRFVDSFRRAESQRLEEDNDLEDG-TKSMKSNNH-LKKSMKSRHVV 96
           +I ++   S NG +            + L  D DLE   +    S  H LK+ ++SRHV 
Sbjct: 68  KISKNQSASSNGTIR-----------EDLIMDVDLEKSPSVDGDSEPHKLKQGLQSRHVQ 116

Query: 97  MMSLGTGIGTGLLVANAKGLSLAGPGSLVIGYVMVSFVTYFMVQAAGEMGVTYP----TL 152
           +++LG  IGTGLLV  +  L   GP  L I Y+++S V Y ++ A GEM    P      
Sbjct: 117 LIALGGAIGTGLLVGTSSTLHTCGPAGLFISYIIISAVIYPIMCALGEMVCFLPGDGSDS 176

Query: 153 PGNFNAYNSIFISKSFGFATTWLFCIQWLTVLPLELITSSMTVKYWNDTINADXXXXXXX 212
            G+     + ++  S GFAT W +   ++ ++  E   +S  V+YW   +          
Sbjct: 177 AGSTANLVTRYVDPSLGFATGWNYFYCYVILVAAECTAASGVVEYWTTAVPKGVWITIFL 236

Query: 213 XXXXXXXXXGVKAYGETEFIFNSCKILMVAGFIILSVVINCGGAGVDGYIGGKYWRDPGS 272
                     VK YGE+EF F S KIL + G IILS ++  GG      +G +YW+ PG+
Sbjct: 237 CVVVILNFSAVKVYGESEFWFASIKILCIVGLIILSFILFWGGGPNHDRLGFRYWQHPGA 296

Query: 273 FAE---GSGATRFKGICYILVSAYFSF-GGIELFVLSINEQSNPRKSTPVAAKRSVYRXX 328
           FA    G     F  I   ++   F+F  G EL  ++  E ++ R++   A++R V+R  
Sbjct: 297 FAHHLTGGSLGNFTDIYTGIIKGAFAFILGPELVCMTSAECADQRRNIAKASRRFVWRLI 356

Query: 329 XXXXXXXXXXGFNVPHNNDQL---MGSGGSATHASPYVLAASIHKVRVIPHIINAVILIS 385
                        VP+N+  L   +  G     +SP+V+      ++V+PHIIN  IL S
Sbjct: 357 FFYVLGTLAISVIVPYNDPTLVNALAQGKPGAGSSPFVIGIQNAGIKVLPHIINGCILTS 416

Query: 386 VISVANSALYAAPRLMCSLAQQGYAPKFLNYIDREGRPLRAXXXXXXXXXXXXXACSPQE 445
             S AN+ ++A+ R + ++AQ G APK L  I++ G P  A               S   
Sbjct: 417 AWSAANAFMFASTRSLLTMAQTGQAPKCLGRINKWGVPYVAVGVSFLCSCLAYLNVSSST 476

Query: 446 EQAFTWLAAIAGLSELFTWSGIMLSHIRFRKAMKVQGRSLDEVGYKANTGIWGSYYGVFF 505
              F W + I+ +S    W    ++++RFRKA+   G   D + +K     WG  Y V+F
Sbjct: 477 ADVFNWFSNISTISGFLGWMCGCIAYLRFRKAIFYNGL-YDRLPFKT----WGQPYTVWF 531

Query: 506 NMLV------------FMAQFWVALSPIGNGGKCDAQAFFESYLAAPLWIFMYVGYMVYK 553
           +++V            F+ ++W                F  +Y+  P+++ ++ G+ +Y 
Sbjct: 532 SLIVIGIITITNGYAIFIPKYW------------RVADFIAAYITLPIFLVLWFGHKLYT 579

Query: 554 RDF-TFLNPLDKID-----LDFHRRVYDPEIMRQEDEENKERLKNS 593
           R +  +  P+ +ID     ++   +  + E MR      K++  ++
Sbjct: 580 RTWRQWWLPVSEIDVTTGLVEIEEKSREIEEMRLPPTGFKDKFLDA 625

>Kwal_23.2817
          Length = 580

 Score =  213 bits (541), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 172/591 (29%), Positives = 273/591 (46%), Gaps = 48/591 (8%)

Query: 18  EVTDS---ALYNNFNTSTTASLTPEIKEHSEESRNGLVHRFVDSFRRAESQRLEEDNDLE 74
           E+T S    L +NF   T ASLT   ++HS   +        D+   A  Q +E    L 
Sbjct: 5   EITTSGIVTLMSNFEM-TDASLTS--RDHSTNQKK-------DAIITAVEQDIER-GSLS 53

Query: 75  DGTKSMKSNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLSLAGPGSLVIGYVMVSFV 134
           D   ++K +  + + +KSRHV  ++LG  IGTGL + +   LS  GP  L+I Y ++SF 
Sbjct: 54  D-IDTIKPSTEVSRGLKSRHVQFIALGGAIGTGLFIGSGTALSSCGPAPLLISYSVMSFF 112

Query: 135 TYFMVQAAGEMGVTYPTLPG--NFNAYNSIFISKSFGFATTWLFCIQWLTVLPLELITSS 192
            + ++    EM V  P L G  +  +    ++++   F   W        V+P E+   +
Sbjct: 113 VWAIMNQMTEMVVLIP-LSGESSMASLAGTYLNRPSSFMCGWNCFYAMSMVVPTEITACA 171

Query: 193 MTVKYWNDTINADXXXXXXXXXXXXXXXXGVKAYGETEFIFNSCKILMVAGFIILSVVIN 252
           + ++YW D  NA                  VK +GE+EF  +  KIL + G I++ VVI 
Sbjct: 172 LLIEYWTDA-NAAIFVTIFMILATLLSLLPVKIFGESEFCVSIIKILTILGLILVGVVIF 230

Query: 253 CGGAGVD-GYIGGKYWRDPGSF----AEGSGATRFKGICYILVSAYFSFGGIELFVLSIN 307
            GG       +G  YW  PG+F     +GS    F  +   ++ + F+F  I     S +
Sbjct: 231 FGGGPAQHKVLGFHYWNTPGAFNSYLVKGSTGA-FLAVWKAIIKSGFAFVMIPEITSSCS 289

Query: 308 -EQSNPRKSTPVAAKRSVYRXXXXXXXXXXXXGFNVPHNNDQL---MGSGGSATHASPYV 363
            E + PRK+ P A +R VYR            G  V ++N  L   + SG +   ASP+V
Sbjct: 290 AEAAFPRKNMPRACQRFVYRLAVFYVLGCLVIGVIVGYDNKTLNEAISSGKANAAASPFV 349

Query: 364 LAASIHKVRVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPKFLNYIDREGRP 423
           +      +R++PHIINA IL S  S + S LY A R++ SLA +G APKF + +++ G P
Sbjct: 350 IGIQEAGIRILPHIINACILTSAYSCSTSELYGASRVLHSLALRGDAPKFFSKVNKYGVP 409

Query: 424 LRAXXXXXXXXXXXXXACSPQEEQAFTWLAAIAGLSELFTWSGIMLSHIRFRKA---MKV 480
             +              CS      F WL+ IA +S    W  + ++++RFRK    +K+
Sbjct: 410 YYSVAATSLFGVLAYLNCSKSSLVVFNWLSNIATISGFVNWVFVSITYLRFRKITDYLKI 469

Query: 481 QGRSLDEVGYKANTGIWGSYY-GVFFNMLVFMAQFWVALSPIGNGGKCDAQAFFESYLAA 539
                D V Y+       +Y   +FF +L     F+V ++     G  +   FF  Y+  
Sbjct: 470 N----DRVPYRRRGQRALAYASAIFFALLAITNGFYVFIA-----GNWNVSDFFTCYVTI 520

Query: 540 PLWIFMYVGYMVYKRDFTFLNPLDKIDLDFHRRVYDPEIMRQEDEENKERL 590
                +++G  +Y +++TF       D+D   R   P+I + + EE +E L
Sbjct: 521 GFVGVLFIGSSIYYKEWTFR------DMDVVGREIMPKIDQADQEEKEEYL 565

>Sklu_2438.14 YOR348C, Contig c2438 29357-31033
          Length = 558

 Score =  211 bits (536), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 150/505 (29%), Positives = 248/505 (49%), Gaps = 15/505 (2%)

Query: 71  NDLEDGTKSMKSN-NHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLSLAGPGSLVIGYV 129
           N LE   +  K + N+L+K + SRH+ +++LG  IGTGL V  +  L   GP  L + +V
Sbjct: 30  NQLESQLEGTKCDENNLEKGLSSRHIQLIALGGCIGTGLFVGTSSTLHNCGPLPLFLSFV 89

Query: 130 MVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFISKSFGFATTWLFCIQWLTVLPLELI 189
           ++SF+ Y ++    EM + Y    G      S ++  S GFA  W +   +  ++  EL 
Sbjct: 90  IISFIVYPVMNTLAEM-ICYLPQQGTVPELTSRYVDPSLGFAAGWNYAYSYSILVATELS 148

Query: 190 TSSMTVKYWNDTINADXXXXXXXXXXXXXXXXGVKAYGETEFIFNSCKILMVAGFIILSV 249
            ++  V+YW D ++                   VK YGE+EF F S KI+ + G +I+S+
Sbjct: 149 AAAGVVQYWTDKVHVAVWITIFLVIVVGLNFAPVKFYGESEFWFASLKIICILGLLIVSI 208

Query: 250 VINCGGAGVDGYIGGKYWRDPGSFA---EGSGATRFKGICYILVSAYFSF-GGIELFVLS 305
           VI  GGA     +G +YW +PG FA    G    RF  I   ++ + F+F    EL  L+
Sbjct: 209 VIFFGGAPSHDRLGFRYWNNPGPFAYHITGGNTGRFLDIWTAIIKSGFAFILSPELIGLA 268

Query: 306 INEQSNPRKSTPVAAKRSVYRXXXXXXXXXXXXGFNVPHNNDQL---MGSGGSATHASPY 362
             E  + R++   A++R ++R            GF +  ++ +L   + S      +SP+
Sbjct: 269 CVEAKDTRRNIEKASRRFIWRIIFFYITSTLCIGFILSRDDPKLIQALTSDAPGAASSPF 328

Query: 363 VLAASIHKVRVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPKFLNYIDREGR 422
           V   S   + V+ HIINAVIL S  S ANS +YA+ R + +LA+QG APK    I+R G 
Sbjct: 329 VQGISNAGIPVLNHIINAVILSSAWSSANSFMYASSRSILALAKQGDAPKVFTRINRLGV 388

Query: 423 PLRAXXXXXXXXXXXXXACSPQEEQAFTWLAAIAGLSELFTWSGIMLSHIRFRKAMKVQG 482
           P  A               S    Q FTWL+ I  +S    W+ I ++++RFRKA+    
Sbjct: 389 PYNAVALSTAVSCLTYLNASSSSAQVFTWLSNICTISGFIGWALIGITYLRFRKAI-FYN 447

Query: 483 RSLDEVGYKANTGIWGSYYGVFFNMLVFMAQFWVALSPIGNGGKCDAQAFFESYLAAPLW 542
              + V +K+    + +Y+ V F +L+ +   +    P       +A  F  +Y+  P++
Sbjct: 448 NLYERVPFKSALQPYFTYFFVVFVVLLCLTNGYATFIP----KYWNASDFVAAYITLPIF 503

Query: 543 IFMYVGYMVYKRDFTFLNPLDKIDL 567
             +Y+G+ ++ +   ++ P  +ID+
Sbjct: 504 FLLYLGHKIWFKTRWYI-PFREIDV 527

>CAGL0E05632g complement(556619..558415) similar to sp|P15380
           Saccharomyces cerevisiae YOR348c PUT4 proline and
           gamma-aminobutyrate permease, hypothetical start
          Length = 598

 Score =  210 bits (535), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 151/539 (28%), Positives = 249/539 (46%), Gaps = 53/539 (9%)

Query: 82  SNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLSLAGPGSLVIGYVMVSFVTYFMVQA 141
           + + LK+ +KSRHV +++LG  IGTGL V  +  L   GP  L I Y ++S V Y ++Q 
Sbjct: 71  TGHELKQGLKSRHVQLIALGGAIGTGLFVGTSSTLHTCGPAGLFISYCIISSVIYPIMQG 130

Query: 142 AGEMGVTYP---TLPGNFNAY-NSIFISKSFGFATTWLFCIQWLTVLPLELITSSMTVKY 197
            GEM    P   + P  F AY    ++ +S GFA  W +   ++ ++  E   +S  V+Y
Sbjct: 131 IGEMVCYLPGSGSKPEGFAAYLVGKYVDESLGFADAWNYYYCYVILVAAECTAASGVVEY 190

Query: 198 WNDTINADXXXXXXXXXXXXXXXXGVKAYGETEFIFNSCKILMVAGFIILSVVINCGGAG 257
           W  ++                    VK YGE+EF F S KIL + G IILS ++  GG  
Sbjct: 191 WTTSVPKAAWITIFLAAVVILNFTAVKFYGESEFWFASIKILCIVGLIILSFILFWGGGP 250

Query: 258 VDGYIGGKYWRDPGSFAE---GSGATRFKGICYILVSAYFSF-GGIELFVLSINEQSNPR 313
               +G +YW++PG FA    G     F  I   ++   F+F  G E+  ++ +E  + R
Sbjct: 251 NHDRLGFRYWQNPGGFAHHIRGGSFGSFLDIYTGIIKGGFAFILGPEMIAMTSSEVEDQR 310

Query: 314 KSTPVAAKRSVYRXXXXXXXXXXXXGFNVPHNNDQL---MGSGGSATHASPYVLAASIHK 370
           ++   AA+R V+R               V +N+  L   +        +SP+V+      
Sbjct: 311 RNIAKAARRFVWRLMFFYILGALSISVIVAYNDPALENALAQNKPGAGSSPFVIGIQNAG 370

Query: 371 VRVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPKFLNYIDREGRPLRAXXXX 430
           ++V+PHIINA IL S  S  N+ ++ + R + ++AQ G AP+    ++R G P  A    
Sbjct: 371 IKVLPHIINACILSSAWSAGNAFMFTSSRSLLTMAQNGQAPRIFAKVNRWGVPYYAVGLS 430

Query: 431 XXXXXXXXXACSPQEEQAFTWLAAIAGLSELFTWSGIMLSHIRFRKAMKVQGRSLDEVGY 490
                     CS      F W + I+ +S    W  + +++IRF KA+   G     + Y
Sbjct: 431 SAISCLAYLNCSSSTADVFNWFSNISVISGFIGWICVCIAYIRFHKAILFHGMQ-SRLPY 489

Query: 491 KANTGIWGSYYGVFFNML------------VFMAQFWVALSPIGNGGKCDAQAFFESYLA 538
            A     G  Y +++ +L            VF+ +FW            DA+ F  +Y+ 
Sbjct: 490 TAR----GMPYLIYWPLLVISIITLTNGYEVFIPRFW------------DAKNFVAAYIT 533

Query: 539 APLWIFMYVGYMVYKRD-FT--FLNPLDKIDLDFHRRVYDPEIMRQEDEENKERLKNSS 594
            P++  +++G+ VY+R  FT  +   +++ID+          +   E+ E K R  ++S
Sbjct: 534 LPVFWVLWIGHRVYRRKIFTLKWWKSIEEIDV----------VTGVEEIEEKTRECDAS 582

>CAGL0M00154g 22039..23691 similar to sp|P32487 Saccharomyces
           cerevisiae YNL268w LYP1 or sp|P04817 Saccharomyces
           cerevisiae YEL063c CAN1, hypothetical start
          Length = 550

 Score =  206 bits (524), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 158/536 (29%), Positives = 237/536 (44%), Gaps = 32/536 (5%)

Query: 64  SQRLEEDNDLEDGTKSMKSNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLSLAGPGS 123
           S  L+ D    D          L +++  RH+ M+S+   IGTGL ++ AK L   GP S
Sbjct: 24  SSSLDIDELRSDFDPEQNIREDLTRALSPRHINMISIAGIIGTGLYLSTAKSLHNGGPAS 83

Query: 124 LVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFISKSFGFATTWLFCIQWLTV 183
           L + Y ++  V Y  +   GEM    P + G+F +Y   F S+SF  A  W +       
Sbjct: 84  LFMNYTIIGGVVYLTMLCLGEMSTFMP-ISGSFCSYARKFGSESFACALMWNYWFNDAVS 142

Query: 184 LPLELITSSMTVKYWNDTINADX------XXXXXXXXXXXXXXXGVKAYGETEFIFNSCK 237
           +  +L    + + YW+    AD                       V+ YGE E+     K
Sbjct: 143 VASDLTALQLVLDYWH---TADHHFPYWGASLIFWFFVLFLNVIHVRIYGEAEYWLAMLK 199

Query: 238 ILMVAGFIILSVVINCGGAGVDGYIGGKYWRDPGSFAEGSGATRFKGICYILVSAYFSFG 297
           ++ +  F I+S+++N G      YIG K W    +  E      FKG   + VSA F++G
Sbjct: 200 VIAIVIFFIMSIIVNVGKNPQHEYIGFKNW----THGEAPFVNGFKGFASLFVSACFAYG 255

Query: 298 GIELFVLSINEQSNPRKSTPVAAKRSVYRXXXXXXXXXXXXGFNVPHNNDQLMGSGGSAT 357
           G E   L+  E SNP ++TP   K   +R            G N+P++     G    + 
Sbjct: 256 GTESITLTGGEASNPVRNTPKIVKTVFWRILIFYVLSTFFIGMNIPYDYP---GLSTKSV 312

Query: 358 HASPYVLAASIHKVRVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAP-KFLNY 416
             SP+ L   +   R     +NAVIL SVIS  N AL+A  R+M ++A  GY P K +  
Sbjct: 313 MTSPFTLVFQMAGTRGAGSFMNAVILTSVISACNHALFAGSRIMYNMALDGYLPKKIVGR 372

Query: 417 IDREGRPLRAXXXXXXXXXXXXXACSPQEEQAFTWLAAIAGLSELFTWSGIMLSHIRFRK 476
            +R   P  A             A        +TWL  I G+S    W  I ++ IRFRK
Sbjct: 373 TNRYKAPYVAVLITWAVGGLCLGASFIGAGTLWTWLQNIVGVSNQIAWLCIGITSIRFRK 432

Query: 477 AMKVQGRSLDEVGYKANTGIWGSYYGVFFNMLVFMAQFWVALSPIGNGGKCDAQAFFESY 536
            ++VQG++ D + +K  T  +G Y+ V F + + + Q W A  P           FF  Y
Sbjct: 433 GLEVQGKT-DLLQFKNWTYPFGPYFLVIFTVFIILIQGWQAFDP------WSVTDFFSVY 485

Query: 537 LAAPLWIFMYVGYMVYKRDFTFLNPLDKIDLDFHRRVYDPEIMRQEDEENKERLKN 592
           L   ++ F+Y+ + ++KRD+     +   D+DF   V D  I  +E  E  ERL N
Sbjct: 486 LELFVFPFVYIIWWLWKRDWF----VKYEDMDF---VTDRYIPTKEIVELNERLDN 534

>YFL055W (AGP3) [1629] chr6 (17004..18680) Amino acid permease for
           serine, aspartate and glutamate, member of the amino
           acid permease family of membrane transporters [1677 bp,
           558 aa]
          Length = 558

 Score =  205 bits (521), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 139/510 (27%), Positives = 231/510 (45%), Gaps = 18/510 (3%)

Query: 63  ESQRLEEDNDLEDGTKSMKSNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLSLAGPG 122
           E+  ++ED D+            +K+++K+RH+ +++LG  IG G LV     L+  GP 
Sbjct: 30  EAVDIDEDPDVS----RYDPQTGVKRALKNRHISLLALGGVIGPGCLVGAGNALNKGGPL 85

Query: 123 SLVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFISKSFGFATTWLFCIQWLT 182
           +L++G+ ++  + + ++++ GEM   YP+  G F      F S +      + + + +  
Sbjct: 86  ALLLGFSIIGIIAFSVMESIGEMITLYPS-GGGFTTLARRFHSDALPAVCGYAYVVVFFA 144

Query: 183 VLPLELITSSMTVKYWNDTINADXXXXXXXXXXXXXXXXGVKAYGETEFIFNSCKILMVA 242
           VL  E  T S  +++W   +                   GV  +GETE+     KI+ + 
Sbjct: 145 VLANEYNTLSSILQFWGPQVPLYGYILIFWFAFEIFQLVGVGLFGETEYWLAWLKIVGLV 204

Query: 243 GFIILSVVINCGGAGVDGYIGGKYWRDPGSFAEGSGATRFKGICYILVSAYFSFGGIELF 302
            + I S+V   G        G  YW  PG+ + G     FKGI  + V     + G E  
Sbjct: 205 AYYIFSIVYISGDIRNRPAFGFHYWNSPGALSHG-----FKGIAIVFVFCSTFYSGTESV 259

Query: 303 VLSINEQSNPRKSTPVAAKRSVYRXXXXXXXXXXXXGFNVPHNNDQLMGSGGSATHASPY 362
            L+  E  NP K+ P+A +++++R            G  VP ++  L  S  +    SP 
Sbjct: 260 ALAATESKNPGKAVPLAVRQTLWRILVVYIGIAVFYGATVPFDDPNL--SASTKVLKSPI 317

Query: 363 VLAASIHKVRVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPKFLNYIDREGR 422
            +A S        H++NA ILI+ IS  N +LY   R +  LA +G APK L + DR G 
Sbjct: 318 AIAISRAGWAGGAHLVNAFILITCISAINGSLYIGSRTLTHLAHEGLAPKILAWTDRRGV 377

Query: 423 PLRAXXXXXXXXXXXXXACSPQEEQAFTWLAAIAGLSELFTWSGIMLSHIRFRKAMKVQG 482
           P+ A               S     A++++  ++G+     W  I  +H+R RKA   QG
Sbjct: 378 PIPAITVFNALGLISLMNVSVGAANAYSYIVNLSGVGVFIVWGVISYTHLRIRKAWVAQG 437

Query: 483 RSLDEVGYKANTGIWGSYYGVFFNMLVFMAQFWVALSPIGNGGKCDAQAFFESYLAAPLW 542
           RS++E+ Y+A    W     +  N+ + + Q W    P       DA  F ++Y+  P+ 
Sbjct: 438 RSIEELPYEALFYPWTPVLSLAANIFLALIQGWSYFVPF------DAGNFVDAYILLPVG 491

Query: 543 IFMYVGYMVYKRDFTFLNPLDKIDLDFHRR 572
           I +Y+G  V+K +      L  I+LD  RR
Sbjct: 492 ILLYIGICVFKSNHFRTVDLRSINLDEGRR 521

>ACL135W [914] [Homologous to ScYPL265W (DIP5) - NSH]
           complement(115359..117125) [1767 bp, 588 aa]
          Length = 588

 Score =  205 bits (521), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 157/580 (27%), Positives = 262/580 (45%), Gaps = 37/580 (6%)

Query: 26  NNFNTSTTASLTPEIK----EHSEESRNGLVHRFVDSFRRAESQRLEEDNDLEDGTKSMK 81
             F  ++ AS   E+K      + E R GL H    + + A+S     D   E       
Sbjct: 4   EKFAQASEASTLDELKGPKLAAAGEGR-GLRHTHSSTDQEAQSVDWNYDGKHE------- 55

Query: 82  SNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLSLAGPGSLVIGYVMVSFVTYFMVQA 141
               LKK +++RHV M+++G  +GTGLL+     L  AGPGS++I Y ++ +V + ++  
Sbjct: 56  -GIRLKKDLQARHVSMIAIGGSLGTGLLIGTGSSLMRAGPGSILIAYSIMGWVVFTVMSC 114

Query: 142 AGEMGVTYPTLPGNFNAYNSIFISKSFGFATTWLFCIQWLTVLPLELITSSMTVKYWNDT 201
            GEM    P     F +Y + +   + GFA  W +  ++L + P +L   ++ +++W   
Sbjct: 115 LGEMAAYIPL--DGFTSYATRYADPALGFAVGWAYLFKYLVLTPNQLTAGALVIQFWIPA 172

Query: 202 --INADXXXXXXXXXXXXXXXXGVKAYGETEFIFNSCKILMVAGFIILSVVINCGGAGVD 259
             ++                  GV+ +GE EF  +S K+L++   +IL +V+  GG    
Sbjct: 173 ARVSPGVWITVVLAVIVVINTVGVRFFGEFEFWLSSFKVLVMLCVMILLLVLALGGGPTH 232

Query: 260 GYIGGKYWRDPGSFAEGS--------GATRFKGICYILVSAYFSFGGIELFVLSINEQSN 311
             +G +YW DPG+F E S        G  +F     + V A F++ G EL  +   E  +
Sbjct: 233 DRLGFRYWSDPGAFKEYSKKDTHIKGGLGKFVAFLSVFVYALFAYLGTELCGIVAAECKD 292

Query: 312 PRKSTPVAAKRSVYRXXXXXXXXXXXXGFNVPHNNDQLM--GSGGSATHASPYVLAASIH 369
           PR++ P A K ++YR            G  V +N+  LM   S   +  ASPYV+A    
Sbjct: 293 PRRNVPRAIKLTLYRIVVFYLVTIFLLGMCVAYNDPLLMQASSAEVSAAASPYVVAIENA 352

Query: 370 KVRVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPKFLNYIDREGRPLRAXXX 429
            + V+P++ NA +L  V S  NS LY   R +  LA  G APK     ++ G P  A   
Sbjct: 353 VIPVLPNLFNACVLTFVFSACNSDLYVGSRSLYGLAIDGKAPKLFARTNKWGVPYNALAC 412

Query: 430 XXXXXXXXXXACSPQEEQAFTWLAAIAGLSELFTWSGIMLSHIRFRKAMKVQGRSLDEVG 489
                     + S     AF +   +  +  L +W  I++++I F +A + QG     + 
Sbjct: 413 CTLFCCLAYMSVSKSARTAFGYFVNVTSIFGLMSWVSILITYICFDRAFRAQGIPKSTLS 472

Query: 490 YKANTGIWGSYYGVFFNMLVFMAQFWVALSPIGNGGKCDAQAFFESYLAAPLWIFMYVGY 549
           Y A    +  +  + F + V + + + A      G + D   F   Y+  P++IF ++GY
Sbjct: 473 YVAPCQPYAGWVALIFCIFVALIKNFDAFI----GKEVDVPTFITGYIGLPIYIFCFIGY 528

Query: 550 MVYKRDFTFLNPLDKIDLDFHRRVYDPEIMRQEDEENKER 589
            +  +  T   P  ++DL   +   D E    E+E  +ER
Sbjct: 529 KIVHK--TKWIPSKEVDLFTFKEAIDLE----EEECIRER 562

>KLLA0F23419g complement(2187386..2189107) similar to sp|P15380
           Saccharomyces cerevisiae YOR348c PUT4 proline and
           gamma-aminobutyrate permease, start by similarity
          Length = 573

 Score =  204 bits (518), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 150/541 (27%), Positives = 253/541 (46%), Gaps = 35/541 (6%)

Query: 68  EEDNDLEDGTKSMKSNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLSLAGPGSLVIG 127
           E++  L +  K    +++LKK +KS H+ ++++G  IGTGL V  +  L   GP  L I 
Sbjct: 36  EKNGSLPN--KPQSGDHNLKKGLKSAHIQLIAIGGCIGTGLFVGTSSTLYKCGPAGLFIS 93

Query: 128 YVMVSFVTYFMVQAAGEMGVTYPTLP------GNFNAYNSIFISKSFGFATTWLFCIQWL 181
           Y ++S + Y ++ A  EM    P LP      G+ +   + ++  S GFA  W +   ++
Sbjct: 94  YCIMSTIIYPVMNALAEMVCFLPGLPDENETGGSISTLCTRYVDSSLGFAVGWNYVYCYV 153

Query: 182 TVLPLELITSSMTVKYWNDTINADXXXXXXXXXXXXXXXXGVKAYGETEFIFNSCKILMV 241
            ++  E   +S  V YW   +                    V+ YG +E IF S KI  +
Sbjct: 154 ILVAAECTAASGVVTYWTTAVPKAAWITIFLGIIVVLNCTAVEFYGTSEAIFCSLKIFCI 213

Query: 242 AGFIILSVVINCGGAGVDGYIGGKYWRDPGSFA---EGSGATRFKGICYILVSAYFSF-G 297
            G II+S+V+  GG      +G ++W+DPG++A      GA R   I   ++ A F+F  
Sbjct: 214 LGIIIVSIVLFFGGGPNHDRLGFRFWKDPGAWAYHLADGGAGRLSDIITGVIRAGFAFIL 273

Query: 298 GIELFVLSINEQSNPRKSTPVAAKRSVYRXXXXXXXXXXXXGFNVPHNNDQLMGS---GG 354
           G EL VL+  E  + R++   AA+R V+R            G  V  N+  L+ +   G 
Sbjct: 274 GPELVVLTSTEAQDSRRNIEKAARRFVWRLIFFYCVSSLCAGVIVSRNDPVLLNALSQGK 333

Query: 355 SATHASPYVLAASIHKVRVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPKFL 414
               +SP+V+      ++V+PHIIN  IL S  S  NS +YA  R + SL+Q+GYAPK  
Sbjct: 334 PGAGSSPFVIGIQNAGIKVLPHIINVCILSSAWSSGNSFMYATTRSLLSLSQEGYAPKIF 393

Query: 415 NYIDREGRPLRAXXXXXXXXXXXXXACSPQEEQAFTWLAAIAGLSELFTWSGIMLSHIRF 474
           N ++R G P                  S      F W + I+ +S    W    ++++RF
Sbjct: 394 NRVNRWGVPYTGVAFATAFSCLAYLNVSSSTADVFNWFSNISTISGFLGWICSGVAYLRF 453

Query: 475 RKAMKVQGRSLDEVGYKANTGIWGSYYGVFFNMLVFMAQFWVALSPIGNGGKC----DAQ 530
           RKA+       D + +K     +  Y+  F+ +L+ +         + NG +     + +
Sbjct: 454 RKAVFFNNL-YDRLPFKTP---FQPYFTWFYIILIAIIC-------LINGYESFVHWNYK 502

Query: 531 AFFESYLAAPLWIFMYVGYMVYKRDFT-FLNPLDKIDLDFHRRVYDPEIMRQEDEENKER 589
            F  +Y+  PL++ +++G+  Y R ++ ++  + +ID+    R    EI  +  E N  R
Sbjct: 503 DFIAAYITLPLFLILWLGHKAYTRTWSQWMISVSEIDVTTGLR----EIEEETKELNARR 558

Query: 590 L 590
           +
Sbjct: 559 I 559

>Scas_552.3
          Length = 558

 Score =  203 bits (516), Expect = 8e-58,   Method: Compositional matrix adjust.
 Identities = 156/534 (29%), Positives = 238/534 (44%), Gaps = 32/534 (5%)

Query: 64  SQRLEEDNDLEDGTKSMKSNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLSLAGPGS 123
           S   EED D E   +       L++++K RH+ M+S+   IGTGL ++ AK L   GP S
Sbjct: 37  SLTTEEDYDPEANIRE-----DLQRALKPRHINMISIAGVIGTGLYLSTAKSLYQGGPAS 91

Query: 124 LVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFISKSFGFATTWLFCIQWLTV 183
           L + Y ++  V Y  +   GEM  TY  + G+F +Y   F S+SF  A  W +       
Sbjct: 92  LFMNYTIMGGVVYLTLLCLGEMS-TYMPISGSFCSYAKKFGSESFACALMWNYWFNDAVS 150

Query: 184 LPLELITSSMTVKYWNDTINADXXXXXXXXXXXXXXXXG---VKAYGETEFIFNSCKILM 240
           +  ++    + + YW+   +                      V+ YGE E+     K++ 
Sbjct: 151 VASDMTALQLVMDYWDTEASGFPYWAASLLFWFLVVLLNVIHVRFYGEAEYWLAMLKVIA 210

Query: 241 VAGFIILSVVINCGGAGVDGYIGGKYWRD-PGSFAEGSGATRFKGICYILVSAYFSFGGI 299
           +  F ILS+V+N G      YIG K W      F +G     FKG   + VSA F++GG 
Sbjct: 211 IIIFFILSIVVNVGHNPQHEYIGFKNWNHGEAPFVDG-----FKGFASLFVSASFAYGGT 265

Query: 300 ELFVLSINEQSNPRKSTPVAAKRSVYRXXXXXXXXXXXXGFNVPHNNDQLMGSGGSATHA 359
           E   L+  E +NP ++TP   K   +R              N+P++     G    +   
Sbjct: 266 ESITLTNGEAANPLRNTPKIVKTVFWRILVFYVGSTFFIAMNIPYDYP---GLDTKSVVT 322

Query: 360 SPYVLAASIHKVRVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAP-KFLNYID 418
           SP+ L   +   +     +NAVI+ SVIS  N AL+A  R+M ++  +G+ P K ++  +
Sbjct: 323 SPFTLVFQMAGTKAAGSFMNAVIMTSVISACNHALFAGSRVMYNMGLEGFLPKKIVSRTN 382

Query: 419 REGRPLRAXXXXXXXXXXXXXACSPQEEQAFTWLAAIAGLSELFTWSGIMLSHIRFRKAM 478
           R   P  +             A        +TWL  I G+S    W  I ++ IRFRK +
Sbjct: 383 RYKVPYVSVLITSSIGLLCFGASFIGAGTVWTWLQNIVGVSNQIAWLCIGITSIRFRKGL 442

Query: 479 KVQGRSLDEVGYKANTGIWGSYYGVFFNMLVFMAQFWVALSPIGNGGKCDAQAFFESYLA 538
           + QG++  E+ YK  T  +G Y+ V F   + + Q W A  P       D   FF  YL 
Sbjct: 443 EKQGKT-HELRYKNWTYPYGPYFLVIFVTFIILVQGWSAFDP------WDVTNFFSYYLD 495

Query: 539 APLWIFMYVGYMVYKRD-FTFLNPLDKIDLDFHRRVYDPEIMRQEDEENKERLK 591
             ++ F ++ + +YKRD F  L      D+DF    Y P     E  EN + LK
Sbjct: 496 LFVFPFCFIIWWLYKRDRFVKLE-----DMDFVTDRYIPTKEIIELNENLDHLK 544

>AFR156W [3348] [Homologous to ScYOR348C (PUT4) - NSH]
           complement(717645..719321) [1677 bp, 558 aa]
          Length = 558

 Score =  200 bits (509), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 146/533 (27%), Positives = 256/533 (48%), Gaps = 26/533 (4%)

Query: 45  EESRNG-LVHRFVDSFRRAESQRLEEDNDLEDGTKSMKSN-NHLKKSMKSRHVVMMSLGT 102
           E++ NG  +H+      R   + LE        T+S  S  N L K ++SRH+ +++LG 
Sbjct: 11  EKADNGGYMHKVKTPHSRTSLEELE--------TQSAGSEYNTLHKGLQSRHIQLIALGG 62

Query: 103 GIGTGLLVANAKGLSLAGPGSLVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSI 162
            IGTGL V  +  L   G   L++ ++++S + Y ++ +  EM + Y    G+     S 
Sbjct: 63  CIGTGLFVGTSWTLHNCGAAPLLLSFILISTIVYPIMCSLAEM-ICYLPQQGSVPELVSR 121

Query: 163 FISKSFGFATTWLFCIQWLTVLPLELITSSMTVKYWNDTINADXXXXXXXXXXXXXXXXG 222
           ++  S GFAT W +   +  ++  EL  ++  V YW++ +                    
Sbjct: 122 YVDPSLGFATGWNYAYAYAILVAAELSAAASVVSYWDNPVPMAAWITIFLVVVVGLNFTA 181

Query: 223 VKAYGETEFIFNSCKILMVAGFIILSVVINCGGAGVDGYIGGKYWRDPGSFAE--GSGAT 280
           VK YGE EF F S K++ + G +++SVVI  GGA      G +YW++PG FA     G+T
Sbjct: 182 VKYYGEAEFWFASIKLICILGLLVVSVVIFFGGAPNHDRTGFRYWKNPGPFAMSLAPGST 241

Query: 281 -RFKGICYILVSAYFSF-GGIELFVLSINEQSNPRKSTPVAAKRSVYRXXXXXXXXXXXX 338
            RF  +   ++ + F+F    EL  ++  E  + R++T  A++R +YR            
Sbjct: 242 GRFLDVWRAVIKSAFAFILSPELIGIACVEAQDTRRNTEKASRRFIYRIIFFYVSCALMI 301

Query: 339 GFNVPHNNDQL---MGSGGSATHASPYVLAASIHKVRVIPHIINAVILISVISVANSALY 395
           G  +   + +L   + +G     +SP+V   +   + V+ H+IN  IL S  S  NS +Y
Sbjct: 302 GVILSRTDPKLIEALETGAPGAASSPFVQGIANAGIPVLDHVINVAILSSAWSAGNSFMY 361

Query: 396 AAPRLMCSLAQQGYAPKFLNYIDREGRPLRAXXXXXXXXXXXXXACSPQEEQAFTWLAAI 455
           A+ R++ +LA++G APKFL  I+R G P  A                      F WL+ I
Sbjct: 362 ASTRMVLALAREGNAPKFLTKINRYGVPYNAVIVCTLVACLAYLNVKTTSANVFQWLSNI 421

Query: 456 AGLSELFTWSGIMLSHIRFRKAMKVQGRSLDEVGYKANTGIWGSYYGVFFNMLVFMAQ-F 514
             +S    W  + ++ IRFR+ + V       + Y+     + +YY  F  ++V +   F
Sbjct: 422 CTISGFIGWFAMGIAFIRFRRGI-VFNNLQSRIPYQGPLQPYIAYYFTFMTVVVCLTNGF 480

Query: 515 WVALSPIGNGGKCDAQAFFESYLAAPLWIFMYVGYMVYKRDFTFLNPLDKIDL 567
            V L      G+ +   F  +Y+  P+++ +Y+G+ ++ R   ++ P+++ID+
Sbjct: 481 HVFLK-----GRWNVVDFVAAYVTLPIYLVLYLGHKLWFRTRWYI-PVEQIDV 527

>Kwal_8.590
          Length = 629

 Score =  192 bits (489), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 137/514 (26%), Positives = 223/514 (43%), Gaps = 27/514 (5%)

Query: 56  VDSFRRAESQRLEE---DNDLEDGTKSMKSNNHL-KKSMKSRHVVMMSLGTGIGTGLLVA 111
           V S    E+  +++    N     ++S+     + ++ +  R V M+ +G  IGT L V+
Sbjct: 83  VTSLEEGETATIDDFVLQNRDSPKSQSLSLEERIARRKLLPRQVSMIGIGGAIGTALFVS 142

Query: 112 NAKGLSLAGPGSLVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFISKSFGFA 171
               +   GPGSL+I + + S V   + +    M VTY  + G+F  +   F+ +S GFA
Sbjct: 143 IGTKIIQGGPGSLLIAFCLWSVVFIGLSKCMCVM-VTYLPVTGSFVHFTERFVDQSCGFA 201

Query: 172 TTWLFCIQWLTVLPLELITSSMTVKYWNDTINADXXXXXXXXXXXXXXXXGVKAYGETEF 231
             W + +     +  E+    + V+YW D I                    V  +GE EF
Sbjct: 202 VGWTYFVCQAANVCFEITAVCLVVEYWTDKIPKAALISMLIILFGSLNLYSVFFFGEGEF 261

Query: 232 IFNSCKILMVAGFIILSVVINCGGAGVDGYIGGKYWRDPGSFAE---GSGATRFKGICYI 288
             +  K+++  G II +VV+  GG      +G K W +PG+FAE        RF G    
Sbjct: 262 YLSIGKVVLAIGLIIFTVVVMAGGNPQHTVLGFKNWSNPGAFAEYISDGSVGRFHGFMSC 321

Query: 289 LVSAYFSFGGIELFVLSINEQSNPRKSTPVAAKRSVYRXXXXXXXXXXXXGFNVPHNNDQ 348
           LV A + F G++    + +E  NPRK  P + ++   R            G  +P+N+  
Sbjct: 322 LVFALYVFWGVDYLGNAASEAMNPRKVIPSSFRKVFGRLIIFYIGGAICVGILIPYNDPN 381

Query: 349 LMGS---GGSATHASPYVLAASIHKVRVIPHIINAVILISVISVANSALYAAPRLMCSLA 405
           ++ +   G     ASPYV A     +RV+PHI+N +IL S+IS  NS+LY+A R++  LA
Sbjct: 382 MIRAIKEGAVGAGASPYVSAMKTLGIRVLPHIVNILILTSIISAGNSSLYSASRVLHRLA 441

Query: 406 QQGYAPKFLNYIDREGRPLRAXXXXXXXXXXXXXACSPQEEQAFTWLAAIAGLSELFTWS 465
               AP+      ++G P+               + S       TW   +   +    + 
Sbjct: 442 LDNQAPRIFKVTTKKGVPVYCCIAVLVICGLAYLSVSNSTNNVLTWFLNVETAAMAIVYI 501

Query: 466 GIMLSHIRFRKAMKVQGRSLDEVGYKANTGIWGSYYGVFFNMLVFMAQFWVALSPIGNG- 524
            I +S+++FRK    Q   L  +           YY      L + + FW+ L  + NG 
Sbjct: 502 FICVSYLQFRKGCLAQNVDLKSL----------PYYSSSLPYLAWHSLFWLVLMLLVNGY 551

Query: 525 -----GKCDAQAFFESYLAAPLWIFMYVGYMVYK 553
                G  D Q+F  SY   P ++    G+ +YK
Sbjct: 552 TVFLKGSWDTQSFVFSYFMIPFFLVFLFGHKLYK 585

>Kwal_26.8097
          Length = 544

 Score =  176 bits (446), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 157/546 (28%), Positives = 237/546 (43%), Gaps = 49/546 (8%)

Query: 61  RAESQRLEEDNDLEDGTKSMKSNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLSLAG 120
           R  S  ++ D++   G ++     HL +S+  RH+ M+S+   IGTGL +   K L+  G
Sbjct: 18  RTSSSDVQYDSE---GQEADHVREHLNRSLTPRHINMISIAGVIGTGLYLGTGKALAKGG 74

Query: 121 PGSLVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFISKSFGFATTWLFCIQW 180
           P SLVI Y ++  V Y  +   GEM    P + G+F +Y   F S S  F    L C  W
Sbjct: 75  PASLVINYSIIGLVVYLTMLCLGEMSTFMP-ISGSFCSYAKKFGSGSLAFT---LMCNYW 130

Query: 181 ----------LTVLPLEL---ITSSMTVKYWNDTINADXXXXXXXXXXXXXXXXGVKAYG 227
                     LT L L L    TS     YW  ++                    V+ YG
Sbjct: 131 FNDAVSVASDLTALQLILDFWKTSDAHFPYWAASL-------IFWFVLLLLNVVHVRVYG 183

Query: 228 ETEFIFNSCKILMVAGFIILSVVINCGGAGVDGYIGGKYWRDPGSFAEGSGATRFKGICY 287
           E E+     K++ +  F I+S+V+N G      YIG K W    S  E      FKG   
Sbjct: 184 EAEYWLAMLKVIAIIIFFIISIVVNAGHNQDHSYIGFKNW----SVGEAPFVNGFKGFAS 239

Query: 288 ILVSAYFSFGGIELFVLSINEQSNPRKSTPVAAKRSVYRXXXXXXXXXXXXGFNVPHNND 347
           + VS+ F++GG E   L+  E  NP ++TP   K   +R            G NVP+N  
Sbjct: 240 LFVSSSFAYGGTESITLTAGEAKNPIRNTPKIIKTVFWRILIFYVFTTFFIGMNVPYNYP 299

Query: 348 QLMGSGGSATHASPYVLAASIHKVRVIPHIINAVILISVISVANSALYAAPRLMCSLAQQ 407
           +L      +   SP+ +   +   +     +NAVIL SVIS  N AL+A  R++ +L  +
Sbjct: 300 KL---SEKSVMTSPFTIVFQMVGTKAAASFMNAVILTSVISAGNHALFAGSRVLFNLGLE 356

Query: 408 GY-APKFLNYIDREGRPLRAXXXXXXXXXXXXXACSPQEEQAFTWLAAIAGLSELFTWSG 466
           GY  P  +   +R   P  A             +        +TWL  I G+S    W  
Sbjct: 357 GYFFPSIITKTNRYQIPYVAVLITWAAGGLCFGSSFVGAGTLWTWLQNIVGVSNQIAWLC 416

Query: 467 IMLSHIRFRKAMKVQGRSLDEVGYKANTGIWGSYYGVFFNMLVFMAQFWVALSPIGNGGK 526
           I +  IRFR+ +  QG++  E+ +   T  +G Y+ V F   + + Q W + +P      
Sbjct: 417 ISIVSIRFRRGLAKQGKT-HELQFSNWTYPYGPYFLVLFVSFIILVQGWSSFAP------ 469

Query: 527 CDAQAFFESYLAAPLWIFMYVGYMVYKRDFTFLNPLDKIDLDFHRRVYDPEIMRQEDEEN 586
            +   FF  Y+   +++ +YV + ++KRD  F+      D+DF   V D  I   E+   
Sbjct: 470 WNVTDFFSYYIELIVFVALYVFWWLWKRD-AFVR---SEDMDF---VTDKYISPHEEVLL 522

Query: 587 KERLKN 592
            E L N
Sbjct: 523 NEELDN 528

>Scas_377.1
          Length = 148

 Score =  159 bits (401), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 69/137 (50%), Positives = 101/137 (73%), Gaps = 1/137 (0%)

Query: 456 AGLSELFTWSGIMLSHIRFRKAMKVQGRSLDEVGYKANTGIWGSYYGVFFNMLVFMAQFW 515
           +GLS+LFTW  I LSH+RFR+AM+VQGRS+ EVG+K+  GI+GS Y     +L+ +AQFW
Sbjct: 1   SGLSQLFTWFSICLSHLRFRRAMRVQGRSMGEVGFKSQVGIYGSLYSCVMMVLILIAQFW 60

Query: 516 VALSPIGNGGKCDAQAFFESYLAAPLWIFMYVGYMVYKRDFTFLNPLDKIDLDFHRRVYD 575
            AL P+G  GK D QAFFE+YLA P++I +Y G+ ++K+D+      + IDL  HR ++D
Sbjct: 61  TALVPVGE-GKPDVQAFFENYLAMPIFIVLYFGFKIWKKDWRLFIRAEDIDLVSHREIFD 119

Query: 576 PEIMRQEDEENKERLKN 592
            E+++QEDEE + +L++
Sbjct: 120 EELLKQEDEEYRRKLRD 136

>Kwal_23.4026
          Length = 534

 Score =  162 bits (410), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 111/470 (23%), Positives = 208/470 (44%), Gaps = 6/470 (1%)

Query: 44  SEESRNGLVHRFVDSFR--RAESQRLEEDNDLEDGTKSMKSNNHLKKSMKSRHVVMMSLG 101
           S +   G V R VD+     +++Q+  E  +L+      +S+  L++  K RHV M+++ 
Sbjct: 3   SVKGATGFVKR-VDTLDTGNSDTQQNGEVYELDFQEAIGESSQTLQRGFKQRHVDMLAIA 61

Query: 102 TGIGTGLLVANAKGLSLAGPGSLVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNS 161
             IGTGL++     L   GPGSL+I ++    +   ++ +  EM  ++  +  +F+ Y +
Sbjct: 62  GAIGTGLVIGTGTALKRGGPGSLLIAFIFTGSLLIGVLMSLAEMA-SFAPMDKSFSGYAT 120

Query: 162 IFISKSFGFATTWLFCIQWLTVLPLELITSSMTVKYWNDTINADXXXXXXXXXXXXXXXX 221
            ++  + GFAT W + +++   L  EL    + V+YW + ++                  
Sbjct: 121 RYVDPALGFATGWNYFLKYAIALASELSAIGLLVQYWREDLSIAIFIVVFLVVLLSLNFM 180

Query: 222 GVKAYGETEFIFNSCKILMVAGFIILSVVINCGGAGVDGYIGGKYWRDPG--SFAEGSGA 279
            +K YGE EF     K L++    +  +V+ CGG      IG +YWR+     +      
Sbjct: 181 NIKFYGEVEFWSALLKFLVLIICFVTGLVLTCGGGPSKETIGFRYWREYAFVPYLVKGTT 240

Query: 280 TRFKGICYILVSAYFSFGGIELFVLSINEQSNPRKSTPVAAKRSVYRXXXXXXXXXXXXG 339
            RF G    ++ + +++ G E   +   E  NP+K+ P A +  ++R            G
Sbjct: 241 GRFLGWWACVIQSCYAYIGSETIGVVFGEAPNPKKTIPAATRNVIFRITGFYIVGVLILG 300

Query: 340 FNVPHNNDQLMGSGGSATHASPYVLAASIHKVRVIPHIINAVILISVISVANSALYAAPR 399
             +  ++  L  +  S    SP+V+A +   ++ +P  INA++++ + S AN+ALY   R
Sbjct: 301 LIISPHDKTLANAKTSDASGSPFVIAFTNAGIKGLPSFINAMLIMFIASAANTALYVCSR 360

Query: 400 LMCSLAQQGYAPKFLNYIDREGRPLRAXXXXXXXXXXXXXACSPQEEQAFTWLAAIAGLS 459
               LA+ G APK     +R G P                  S      F +L +   + 
Sbjct: 361 TAYGLAKDGMAPKIFLAQNRYGVPFNGCLLAGLISLLSFMNISNSSSVIFGYLTSSVTVF 420

Query: 460 ELFTWSGIMLSHIRFRKAMKVQGRSLDEVGYKANTGIWGSYYGVFFNMLV 509
               W  +++S+I + +A        D + ++     + +Y  +FF  L+
Sbjct: 421 GTLNWLSVLISYIGYERARVFHDVPRDRIPFRMWFQPYSAYVCLFFVSLI 470

>Sklu_2365.9 YDR160W, Contig c2365 13522-15939
          Length = 805

 Score =  163 bits (412), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 148/587 (25%), Positives = 240/587 (40%), Gaps = 85/587 (14%)

Query: 78  KSMKSNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLSLAGPGSLVIGYVMVSFVTYF 137
           K ++    +++ +K RH+ M+SLG  IG GL + + K  S+AGP    +GY+  +     
Sbjct: 221 KKLQGQVTIQRKLKVRHLQMISLGATIGVGLFLNSGKAFSIAGPLGTFLGYLFGALTILA 280

Query: 138 MVQAAGEMGVTYPTLPGNFNAYNSIFISKSFGFATTWLFCIQWLTVLPLELITSSMTVKY 197
            + +  E+    P + G  +   S FI  +FGF+  W     +    P ELI +++ + Y
Sbjct: 281 TLLSFAEIVALIPLITG-ISGLCSRFIGDAFGFSVGWCHWASYAFGFPSELIATAIMLSY 339

Query: 198 WND--TINADX-----XXXXXXXXXXXXXXXGVKAYGETEFIFNSCKILMVAGFIILSVV 250
           + +  +I+ +                      V+ YGE E+  ++ K+++VA  IIL +V
Sbjct: 340 YTNLQSISTNQGSMASAIVIMIAALTVLNLMDVRVYGELEYFASTIKLIVVALLIILMIV 399

Query: 251 INCGGAGVDGYIGGKYW---------------------RDPGSFAE----GSGATRFKGI 285
           +NCGG   +GYIG +YW                     +D G  A     G G      I
Sbjct: 400 VNCGGLN-NGYIGFRYWDKNKSKSEHITFGAFRPTFDLKDTGDGARNGIGGFGGVLLSCI 458

Query: 286 CYILVSAYFSFGGIELFVLSINEQSNPRKSTPVAAKRSVYRXXXXXXXXXXXXGFNV--- 342
              LV A FS+ G E+  ++  E  NPRK+ P   KR   R            G N    
Sbjct: 459 ASTLV-AVFSYVGSEIGFIAAGEAQNPRKAVPSVTKRIFTRVVVFYLLSIFVVGLNFYSG 517

Query: 343 ---------PHNNDQLMGS-----------GG--------------SATHASPYVLAASI 368
                    P +N  L+             GG               +++ SP+V+A   
Sbjct: 518 DPRLLRYYSPEDNQMLIEKFEGYKDLIDSLGGLNCNTVLTEQNFVNESSNQSPWVIALKS 577

Query: 369 HKVRVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPKFLNYIDREGRPLRAXX 428
            K   +  I+N V +    S A+S LYA+ R + S+A Q  AP    + +R G P  +  
Sbjct: 578 FKQCTLSSIVNGVFVAIGFSAASSQLYASSRTLYSMATQQKAPSVFTWCNRHGVPYMSVI 637

Query: 429 XXXXXXXXXXXACSPQEEQAFTWLAAIAGLSELFTWSGIMLSHIRFRKAMK----VQGRS 484
                        + +    F     I  +  +  W  + LS +RF  A+K    +  R 
Sbjct: 638 FCAFLGFLSLLCLNMKSTDVFIMFINIGAMGSVIMWFSMNLSFLRFYYALKRRPDIISRD 697

Query: 485 LDEVGYKANTGIWGSYYGVFFNMLVFMAQFWVALSPIGNGGKCDAQAFFESYLAAPLWIF 544
             E  YK+    + S +G+    ++      V  +   N    + + F  SY    L++ 
Sbjct: 698 SKEYPYKSPLQPYLSIFGMVSTAIL------VLFNGFQNFFYWNTKNFISSYCTVVLFVV 751

Query: 545 MYVGYMVYKRDFTFLNPLDKIDLDFHRRVYDPEIMRQEDEENKERLK 591
           +Y GY  +K   + +N L+ IDLD  RR  D  I+ +ED +    LK
Sbjct: 752 LYFGYNWFKH--SQINKLENIDLDSGRREMD-SIIWKEDVDYSLSLK 795

>YBR132C (AGP2) [319] chr2 complement(499608..501398) Plasma
           membrane carnitine transporter, required for the
           carnitine-dependent pathway for transport of acetyl-CoA
           from peroxisomes to mitochondria, member of the amino
           acid-polyamine-choline (APC) family of membrane
           transporters [1791 bp, 596 aa]
          Length = 596

 Score =  159 bits (403), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 142/602 (23%), Positives = 243/602 (40%), Gaps = 37/602 (6%)

Query: 12  EKSAEFEVTDSALYNNFNTSTTASLTPEIKEHSEESRNGLVHRFVDSFRRAESQRLEEDN 71
           E   +FE       N + T TT   + E  E   E    + H  +++   A    ++E  
Sbjct: 11  ENDGDFEYDK----NKYKTITTRIKSIEPSEGWLEPSGSVGH--INTIPEAGDVHVDEHE 64

Query: 72  D----LEDGTKS-MKSNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLSLAGPGSLVI 126
           D    ++D +++ +      ++ +++RHV ++++   IGT L VA  K L   GP SL++
Sbjct: 65  DRGSSIDDDSRTYLLYFTETRRKLENRHVQLIAISGVIGTALFVAIGKALYRGGPASLLL 124

Query: 127 GYVMVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFISKSFGFATTWLFCIQWLTVLPL 186
            + +       +  +  EM   +P +   F    +  +  S     +W F       +P 
Sbjct: 125 AFALWCVPILCITVSTAEMVCFFP-VSSPFLRLATKCVDDSLAVMASWNFWFLECVQIPF 183

Query: 187 ELITSSMTVKYWNDTINADXXXXXXXXXXXXXXXXGVKAYGETEFIFNSCKILMVAGFII 246
           E+++ +  + YW D  +A                  VK YGE EF   S KI++  G   
Sbjct: 184 EIVSVNTIIHYWRDDYSAGIPLAVQVVLYLLISICAVKYYGEMEFWLASFKIILALGLFT 243

Query: 247 LSVVINCGGAGVDGYIG---------GKYWRDPGSFAEGSGATRFKGICYILVSAYFSFG 297
            + +   GG       G          KY+ D     + SG   F+G    L+ A F+  
Sbjct: 244 FTFITMLGGNPEHDRYGFRNYGESPFKKYFPDGNDVGKSSG--YFQGFLACLIQASFTIA 301

Query: 298 GIELFVLSINEQSNPRKSTPVAAKRSVYRXXXXXXXXXXXXGFNVPHNNDQLMGSGGSA- 356
           G E   +   E   PRK  P A K+   R            G     N+  L  +   A 
Sbjct: 302 GGEYISMLAGEVKRPRKVLPKAFKQVFVRLTFLFLGSCLCVGIVCSPNDPDLTAAINEAR 361

Query: 357 --THASPYVLAASIHKVRVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPKFL 414
               +SPYV+A +  K+R++P I+N  ++ +  S  N+  Y + R    +A  GYAPK  
Sbjct: 362 PGAGSSPYVIAMNNLKIRILPDIVNIALITAAFSAGNAYTYCSSRTFYGMALDGYAPKIF 421

Query: 415 NYIDREGRPLRAXXXXXXXXXXXXXACSPQEEQAFTWLAAIAGLSELFTWSGIMLSHIRF 474
              +R G P+ +               +        WL  +   S+L  +  + + ++ F
Sbjct: 422 TRCNRHGVPIYSVAISLVWALVSLLQLNSNSAVVLNWLINLITASQLINFVVLCIVYLFF 481

Query: 475 RKAMKVQGRSLDEVGYKANTGIWGSYYGVFFNMLVFMAQFWVALSPIGNGGKCDAQAFFE 534
           R+A  VQ  SL ++ +++    WG  Y     ++   A   +    +      + Q F  
Sbjct: 482 RRAYHVQQDSLPKLPFRS----WGQPYTAIIGLVSCSAMILIQGYTVFFPKLWNTQDFLF 537

Query: 535 SYLAAPLWIFMYVGY-MVYKR-DFTFLNPLDKIDLDFHRRVYDPEIMRQEDEENKERLKN 592
           SYL   + I +YVGY  ++KR    F NP    ++DF + +   EI   E E + E+ + 
Sbjct: 538 SYLMVFINIGIYVGYKFIWKRGKDHFKNPH---EIDFSKEL--TEIENHEIESSFEKFQY 592

Query: 593 SS 594
            S
Sbjct: 593 YS 594

>Scas_460.3
          Length = 584

 Score =  159 bits (401), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 135/558 (24%), Positives = 231/558 (41%), Gaps = 47/558 (8%)

Query: 55  FVDSFRRAESQRLEEDNDLEDGTKSMKSNNHL-KKSMKSRHVVMMSLGTGIGTGLLVANA 113
           F+ +  R  +    +DND    +K+    +H  K+++ +RHV ++++   IGT + VA  
Sbjct: 45  FIPTTSRGTTSVSSQDND----SKTFLVASHTTKRNLVNRHVQLIAISGVIGTAIFVAIG 100

Query: 114 KGLSLAGPGSLVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFISKSFGFATT 173
           K L   GP  L++ + +       +  +  EM V +  +   F    +  +  S     +
Sbjct: 101 KPLYRGGPAFLLLAFAIWCIPILCITVSTAEM-VCFMPVSSPFLRLATKCVDDSLAVMAS 159

Query: 174 WLF----CIQWLTVLPLELITSSMTVKYWNDTINADXXXXXXXXXXXXXXXXGVKAYGET 229
           W F    C+Q    +P E++T +  + YW D  +A                  VK YGE 
Sbjct: 160 WNFWFLECVQ----IPYEIVTVNTIIHYWRDDYSAAIPLVIQSLLYLLISLAAVKWYGEM 215

Query: 230 EFIFNSCKILMVAGFIILSVVINCGGAGVDGYIGGKYWRD-------PGSFAEGSGATRF 282
           EF   S KI++  G    + +   GG       G +Y+ D       P     GS A  F
Sbjct: 216 EFWLASFKIVLAMGLFCFTFITMLGGNPKKDRFGFRYFHDTPFKKYFPDGIDRGSSAGYF 275

Query: 283 KGICYILVSAYFSFGGIELFVLSINEQSNPRKSTPVAAKRSVYRXXXXXXXXXXXXGFNV 342
           +G    L+ A F+  G E   +   E   PR+  P A K+   R            G   
Sbjct: 276 QGFFICLIQASFTIAGGEYISMLAGEIEIPRRVLPRAFKQVFMRLTILFLGSCLCVGILC 335

Query: 343 PHNNDQLMGSGGSA---THASPYVLAASIHKVRVIPHIINAVILISVISVANSALYAAPR 399
             N+  L  +   A     +SPYV+A +   +R++P I+N  ++ +  S  N+  Y + R
Sbjct: 336 SPNDSSLTAAINEARPGAGSSPYVIAMNNLGIRILPDIVNITLITAAFSSGNAYTYCSSR 395

Query: 400 LMCSLAQQGYAPKFLNYIDREGRPLRAXXXXXXXXXXXXXACSPQEEQAFTWLAAIAGLS 459
            +  +A  GYAPK     +++G P+ A               +        WL  I   S
Sbjct: 396 TLYGMALDGYAPKIFTRCNKQGVPIYAVGVSLLWAFISLLQLNSNSAIVLNWLINIITAS 455

Query: 460 ELFTWSGIMLSHIRFRKAMKVQGRSLDEVGYKANTGIWGSYYGVFFNMLVFMAQFWVALS 519
           +L  ++ + ++++ FR+A  +Q   L E+ +K+    + + +G+   M++ + Q +    
Sbjct: 456 QLINFAILCITYLFFRRAYLLQKDKLPELPFKSWWQPYTAIFGLVCAMVMMIVQGYTVFF 515

Query: 520 PIGNGGKCDAQAFFESYLAAPLWIFMYVG-YMVYKRDFTFLNPLDKIDLDFHRRVYDPEI 578
           P       + Q F   YL     IF+ +G Y+ YK    F+  L K       ++ DP  
Sbjct: 516 P----KNWNVQDFLFCYLM----IFINIGIYIFYK----FIWRLGK------DKIKDPAT 557

Query: 579 MRQEDE----ENKERLKN 592
           +  EDE    EN E   N
Sbjct: 558 ISFEDELREIENHELEHN 575

>KLLA0C15873g 1381699..1383405 similar to sp|P38090 Saccharomyces
           cerevisiae YBR132c AGP2 amino-acid permease, start by
           similarity
          Length = 568

 Score =  141 bits (356), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 119/489 (24%), Positives = 196/489 (40%), Gaps = 27/489 (5%)

Query: 83  NNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLSLAGPGSLVIGYVMVSFVTYFMVQAA 142
           NN   + +++RHV ++ +   IGT L V+  K L   GP SL++G+ +       +  + 
Sbjct: 50  NNSTSRKLQNRHVQLIGISGVIGTALFVSIGKALYRGGPVSLILGFSLWCIPILCITVST 109

Query: 143 GEMGVTYPTLPGNFNAYNSIFISKSFGFATTWLF----CIQWLTVLPLELITSSMTVKYW 198
            EM V Y  +   F        + S      W F    C+Q    +P E++  +  + YW
Sbjct: 110 AEM-VCYLPISSPFLRMAKRCCNDSLAVTAGWNFWFLECVQ----IPFEIVAVNTILHYW 164

Query: 199 NDTINADXXXXXXXXXXXXXXXXGVKAYGETEFIFNSCKILMVAGFIILSVVINCGGAGV 258
            D  +                   V+ YGETE    S KIL+  G  + + +   GG   
Sbjct: 165 RDDFSPAIPLCVQVLLYIGISLFAVRCYGETEAFLASFKILLAIGLFLFTFITMLGGNPK 224

Query: 259 DGYIGGKYWRDPG---SFAEGSGATR---FKGICYILVSAYFSFGGIELFVLSINEQSNP 312
               G +Y  D      F    G++    F+G    ++ A F+  G +   +   E   P
Sbjct: 225 HDRYGFRYITDTKFKQYFPNNEGSSSMGYFQGFLACVIQASFTIAGPDYVAMIAGECKLP 284

Query: 313 RKSTPVAAKRSVYRXXXXXXXXXXXXGFNVPHNNDQL---MGSGGSATHASPYVLAASIH 369
           RK  PVA K+   R            G     N+  L   + +      +SPYV+A +  
Sbjct: 285 RKVLPVAFKQVFIRLTVLFLGGCLCVGIVCSSNDPNLTAVINNPRPGAGSSPYVIAMNNL 344

Query: 370 KVRVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPKFLNYIDREGRPLRAXXX 429
            ++V+P ++NA ++ +  S  N+  Y + R +  L+  GYAPK   Y  + G P+ A   
Sbjct: 345 GIKVLPDVVNAALVTAAFSAGNAYTYCSSRTLYGLSLDGYAPKLFQYCTKSGVPINAVLV 404

Query: 430 XXXXXXXXXXACSPQEEQAFTWLAAIAGLSELFTWSGIMLSHIRFRKAMKVQGRS--LDE 487
                                WL  +   S+L  +S + + ++ FR+A   Q  S  L E
Sbjct: 405 SLAWAFISLLQLGSNSAVVLNWLINLITASQLINFSILCVIYLSFRRAYIKQHPSGELPE 464

Query: 488 VGYKANTGIWGSYYGVFFNMLVFMAQFWVALSPIGNGGKCDAQAFFESYLAA--PLWIFM 545
           + +K+    WG  Y  +  +        V    +   G  + Q+F   YL     L IF+
Sbjct: 465 LPFKS----WGQPYTAYCGLFAVTLMIGVQGYTVFLHGSWEVQSFLFCYLMVFIDLGIFL 520

Query: 546 YVGYMVYKR 554
            + + VYKR
Sbjct: 521 -LCFFVYKR 528

>CAGL0C00539g 57784..59502 highly similar to sp|P38090 Saccharomyces
           cerevisiae YBR132c AGP2 amino-acid permease,
           hypothetical start
          Length = 572

 Score =  141 bits (356), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 125/565 (22%), Positives = 221/565 (39%), Gaps = 38/565 (6%)

Query: 48  RNGLVHRFVDSFRRAESQRLEEDN-DLEDGTKSMKSNNHLKKSMKSRHVVMMSLGTGIGT 106
             G+  RF +S     S   +ED     D    +  +    + + +RHV  +++   IGT
Sbjct: 18  EEGIEERFFESDDVTRSISFDEDERSSNDSRTQLIESTSTHRKLLNRHVQFIAISGVIGT 77

Query: 107 GLLVANAKGLSLAGPGSLVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFISK 166
            L VA  K L   GP +L++ + +       +  +  EM V++  +   F       + +
Sbjct: 78  ALFVAIGKPLYRGGPANLLLAFALWCIPILCITVSTAEM-VSFMPVSSPFLRLAKKCVDE 136

Query: 167 SFGFATTWLFCIQWLTVLPLELITSSMTVKYWNDTINADXXXXXXXXXXXXXXXXGVKAY 226
           S G   +W F       +P E+++ +  + YW D  +                   VK Y
Sbjct: 137 SLGVTASWNFWFLECVQIPYEIVSVNTIIHYWRDDYSPAIPLVIQVVLYVLISVCAVKYY 196

Query: 227 GETEFIFNSCKILMVAGFIILSVVINCGGAGVDGYIGGKYWRDP--------GSFAEGSG 278
           GE EF   S KI++  G    + +   GG       G +Y+ +         G+   G  
Sbjct: 197 GEMEFWLASFKIILAVGLFCFTFITMLGGNPKHDRYGFRYYGESPFKKYFPDGNEGAGKS 256

Query: 279 ATRFKGICYILVSAYFSFGGIELFVLSINEQSNPRKSTPVAAKRSVYRXXXXXXXXXXXX 338
           A  F+G    L+ A F+  G E   +   E   PRK  P A K+   R            
Sbjct: 257 AGYFQGFLTCLIQAAFTIAGGEYISMLAGEVKLPRKVLPKAFKQVFVRLTVIFLGSCLCV 316

Query: 339 GFNVPHNNDQLMGSGGSA---THASPYVLAASIHKVRVIPHIINAVILISVISVANSALY 395
           G     N+  L  +   A     +SPYV+A +  ++RV+P I+N  ++ +  S  N+  Y
Sbjct: 317 GIVCSPNDSALTAAINEARPGAGSSPYVIAMNNLQIRVLPDIVNIALITAAFSAGNAYTY 376

Query: 396 AAPRLMCSLAQQGYAPKFLNYIDREGRPLRAXXXXXXXXXXXXXACSPQEEQAFTWLAAI 455
            + R +  +A  GYAPK     ++ G P+ A               +        WL  +
Sbjct: 377 CSSRTLYGMALDGYAPKIFTKCNKYGVPIYAVGVSLCWALLSLLQLNSNSAVVLNWLINL 436

Query: 456 AGLSELFTWSGIMLSHIRFRKAMKVQGRSLDEVGYKANTGIWGSYYGVFFNM-----LVF 510
              S+L  +  + + ++ FR+A   Q   L E+ +K+    W   Y V   +     ++ 
Sbjct: 437 ITASQLINFVFLCVIYLFFRRAYMTQKERLPELPFKS----WWQPYTVIVGLVSVLIMIL 492

Query: 511 MAQFWVALSPIGNGGKCDAQAFFESYLAAPLWIFMYVGYMVYKRDFTFLNPLDKI----D 566
           +  + V    + NG           ++   L +F+ +G  V+ + F +    D +     
Sbjct: 493 LQGYTVFFPKLWNG---------RDFIFCYLMVFLDIGIYVFTK-FIWYKGKDPVKSPNS 542

Query: 567 LDFHRRVYDPEIMRQEDEENKERLK 591
           +DF   +   EI + E E + ++ K
Sbjct: 543 IDFVPEL--KEIEQHELEHSFDKFK 565

>AAR038W [224] [Homologous to ScYBR132C (AGP2) - SH]
           complement(409071..410771) [1701 bp, 566 aa]
          Length = 566

 Score =  140 bits (354), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 120/496 (24%), Positives = 207/496 (41%), Gaps = 26/496 (5%)

Query: 88  KSMKSRHVVMMSLGTGIGTGLLVANAKGLSLAGPGSLVIGYVMVSFVTYFMVQAAGEMGV 147
           + +++RHV ++ +   IGT L V+  K L   G  SL++G+ +       +  +  EM V
Sbjct: 55  RKLENRHVQLIGISGVIGTALFVSIGKALYRGGSVSLLLGFALWCVPILCITVSTAEM-V 113

Query: 148 TYPTLPGNFNAYNSIFISKSFGFATTWLF----CIQWLTVLPLELITSSMTVKYWNDTIN 203
            Y  L   F    S  ++ S      W F    C+Q    +P E++  +  + YW D  +
Sbjct: 114 CYLPLNSPFLRLASRCVNDSLTVMAGWNFWFLECVQ----IPFEIVAVNSIIHYWRDDYS 169

Query: 204 ADXXXXXXXXXXXXXXXXGVKAYGETEFIFNSCKILMVAGFIILSVVINCGGAGVDGYIG 263
           A                  V+ YGE EF   S K+L+  G    + V   GG       G
Sbjct: 170 AAITLVVQVMLYLLISLFAVRYYGEIEFWLASFKVLLAVGLFCFTFVTMVGGNPKRDRYG 229

Query: 264 GKYWRD-------PGSFAEGSGATRFKGICYILVSAYFSFGGIELFVLSINEQSNPRKST 316
            +Y  +       P      S A  F+G    L+ A F+  G +   +   E   PRK  
Sbjct: 230 FRYIGEAPFKQYSPTMEPISSSAGYFQGFLACLIQASFTIAGPDYVSMIAGETKLPRKVL 289

Query: 317 PVAAKRSVYRXXXXXXXXXXXXGFNVPHNNDQLMGSGGSA---THASPYVLAASIHKVRV 373
           PVA K+   R            G     N+  L  +  ++     +SPYV+A +   +++
Sbjct: 290 PVAFKQVFIRLTVLFLGGCLCVGIVCSANDPDLTAAINASRPGAGSSPYVIAMNHLGIKI 349

Query: 374 IPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPKFLNYIDREGRPLRAXXXXXXX 433
           +P I+NA ++ +  S  N+  Y + R +  LA  GYAP      +R G P+ A       
Sbjct: 350 LPDIVNAALVTAAFSAGNAYTYCSSRSLYGLALDGYAPAIFKRCNRFGVPIYAVSVSVMW 409

Query: 434 XXXXXXACSPQEEQAFTWLAAIAGLSELFTWSGIMLSHIRFRKAMKVQGRSLDEVGYKAN 493
                   +        WL ++   S+L  +  + + ++ FR+A   Q  +L E+ +K+ 
Sbjct: 410 SVLSLLQLNSNSAVVLNWLISLITASQLINFGVLCVVYLYFRRAYLAQQDNLPELSFKSW 469

Query: 494 TGIWGSYYGVFFNMLVFMAQ-FWVALSPIGNGGKCDAQAFFESYLAAPLWIFMYVGY-MV 551
              + +Y G+   +L+ + Q + V  S + N      + F   YL   + I +Y+GY  +
Sbjct: 470 WQPYTAYVGLTCVLLIVVVQGYTVFYSALWN-----VKDFLFCYLMVFIDIAIYLGYRYI 524

Query: 552 YKRDFTFLNPLDKIDL 567
           ++R    + P  ++DL
Sbjct: 525 WRRGKDAVIPPTEVDL 540

>KLLA0B09922g complement(867748..870141) weakly similar to sp|Q03770
           Saccharomyces cerevisiae YDR160w SSY1 transcriptional
           regulator of several transporter genes P23.1.f18.1,
           hypothetical start
          Length = 797

 Score =  141 bits (355), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 146/578 (25%), Positives = 241/578 (41%), Gaps = 81/578 (14%)

Query: 78  KSMKSNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLSLAGPGSLVIGYVMVSFVTYF 137
           +  + N  L++ +K RH+ M+SLG  IG GL + + +  S+AGP    IG++  + V   
Sbjct: 214 RKSRHNTSLQRKLKIRHLQMISLGATIGVGLFLNSGRAFSIAGPMGAFIGFLYGALVILA 273

Query: 138 MVQAAGEMGVTYPTLPGNFNAYNSIFISKSFGFATTWLFCIQWLTVLPLELITSSMTVKY 197
            + +  EM    P + G  +   S F+  SFGF   W   + +    P ELI S++ + Y
Sbjct: 274 TLFSFAEMVAFIPLITG-ISGLCSRFVGDSFGFTVGWCHWLSYAVAFPSELIASAIMISY 332

Query: 198 WN--DTINADXXXXXXXXXXXXXXXXG-----VKAYGETEFIFNSCKILMVAGFIILSVV 250
           +   + +  D                G     V+ Y E E+I +  K+ +V   ++L ++
Sbjct: 333 YTPFEKVATDNLYLGLTVTILIIVLTGINLLDVRIYAELEYIMSVFKLAVVLFLLVLVLI 392

Query: 251 INCGGAGVDGYIGGKYW---RDP------GSFAE-------GSGATR----FKGI---CY 287
           +NCGG   +GY+G K+W   R P      G F         GSG+ +    F G+   C 
Sbjct: 393 LNCGGFR-NGYLGFKFWTKDRSPSPDVTFGPFRPTFDLNDYGSGSKQGIGGFGGVLLSCI 451

Query: 288 IL-VSAYFSFGGIELFVLSINEQSNPRKSTPVAAKRSVYRXXXXXXXXXXXXG------- 339
              VS+ FS+ G E+  ++  E  NPRK+ P   KR   R            G       
Sbjct: 452 TCSVSSIFSYIGSEIGFIAAPEAENPRKAVPSVTKRIFVRVVLFYLLSIFMVGTVIYAGD 511

Query: 340 ---FNVPHNN---------------DQLMGSGGS-----------ATHASPYVLAASIHK 370
                +  +N               DQL G   +           +++ SP+V+A    K
Sbjct: 512 PRLLRIISDNSKVTDQNLEKFMLIIDQLGGMNCNTRLQNDNIFQESSNQSPWVIAFKAVK 571

Query: 371 VRVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPKFLNYIDREGRPLRAXXXX 430
              + ++IN V +   IS A+S LYA+ R + S+A Q  AP    +    G P  +    
Sbjct: 572 QCDLANVINGVFVCIGISAASSQLYASSRTLYSMATQNKAPSVFTWCTNGGVPYVSILFC 631

Query: 431 XXXXXXXXXACSPQEEQAFTWLAAIAGLSELFTWSGIMLSHIRFRKAMK----VQGRSLD 486
                        +  +A     +I     +  W G+ LS +RF  A+K    +  R+  
Sbjct: 632 GSLGFLSLLCFDLRSTEALLLFISIGITGSVVMWFGMNLSFLRFYMALKRRPDIIDRNSK 691

Query: 487 EVGYKANTGIWGSYYGVFFNMLVFMAQFWVALSPIGNGGKCDAQAFFESYLAAPLWIFMY 546
           E  YK+    +   +G      +    F + ++ I N        F  SYL   ++I +Y
Sbjct: 692 EYPYKSPFQPYLCIFG------MASTTFLLLMNGIQNFFVWKTANFISSYLIIVIFIVLY 745

Query: 547 VGYMVYKRDFTFLNPLDKIDLDFHRRVYDPEIMRQEDE 584
            GY V +   + +N L++IDLD  RR  D  + ++  +
Sbjct: 746 SGYNVVRT--STINRLEQIDLDSGRREMDRVLWKENAD 781

>KLLA0D16830g 1426856..1429354 similar to sp|Q03770 Saccharomyces
           cerevisiae YDR160w SSY1 transcriptional regulator of
           several transporter genes, start by similarity
          Length = 832

 Score =  140 bits (352), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 140/607 (23%), Positives = 253/607 (41%), Gaps = 89/607 (14%)

Query: 57  DSFRRAESQRLEEDNDLEDGTKSMKSNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGL 116
           +S  R +S+ +++ N L+       S++ +++ +++RH+ M++ G+ +G GL + + K  
Sbjct: 234 NSGSRKQSKFIKKYNALKG------SHHSVQRKLEARHIQMIASGSSLGVGLFLTSGKAF 287

Query: 117 SLAGPGSLVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFISKSFGFATTWLF 176
           ++AGP   ++GYV+   +      +  E+    P   G F+   S F+  +FGFA  WL+
Sbjct: 288 TIAGPFGALLGYVLCGSIVMASTLSFTELCALIPLTSG-FSGLASRFVEDAFGFALGWLY 346

Query: 177 CIQWLTVLPLELITSSMTVKYWNDTINADX-----XXXXXXXXXXXXXXXGVKAYGETEF 231
              ++  +P +++ S+M + Y+  ++N                        V+ +G   +
Sbjct: 347 WFSFIIAVPSQVVASTMLLNYY-QSLNLSSGKIAGFVTLFLVFAIFINLCDVRIFGNFVY 405

Query: 232 IFNSCKILMVAGFIILSVVINCGGAGV-DGYIGGKYWRDPGSFAEG-------------- 276
                KI+     I + +V+N GGA +    +G ++W D G  A G              
Sbjct: 406 FVTIIKIIFTIVMIFVMIVLNSGGAALGHDRVGFRFW-DAGKSAPGLFYGLFRPTFNLKD 464

Query: 277 ---------SGAT-RFKGICYILVSAYFSFGGIELFVLSINEQSNPRKSTPVAAKRSVYR 326
                    SGA  R   I   ++ A F++ GIE+  ++  E  NP+K+ P A K+++Y 
Sbjct: 465 EGSEIISGISGAKGRLLAIFLSMLIAAFTYSGIEMTFVASCEVRNPKKALPSAMKKTLYI 524

Query: 327 XXXXXXXXXXXXGFNV---------------PHNNDQLMGSGGS----ATHA-------- 359
                       G N+                 +N  +M + G     +TH         
Sbjct: 525 MLLIYTISIFVVGLNIYSGDPRLPRFYTYSQDSSNYNIMHNIGMNWQVSTHCQSTLLSSG 584

Query: 360 --------SPYVLAASIHKVRVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAP 411
                   S +V+A           ++N +++    +   S+LY A   + S+A QG AP
Sbjct: 585 SLLSDGNRSAWVIALRSFGRCTFASVLNGILIFYGATSGCSSLYGASHTLYSMAIQGKAP 644

Query: 412 KFLNYIDREGRPLRAXXXXXXXXXXXXXACSPQEEQAFTWLAAIAGLSELFTWSGIMLSH 471
           +        G P  A             A        F  LA I+  +    W+G+ +S 
Sbjct: 645 RICKACTSYGVPWIAVLVSGIFGVISYMAVDQSSLNNFQILANISSATICIIWAGMNVSF 704

Query: 472 IRFRKAMKVQ----GRSLDEVGYKANTGIWGSYYGVFFNM-LVFMAQFWVALSPIGNGGK 526
           +RF  A+K++     R      Y++    + SYYG+F ++ ++F A F          G 
Sbjct: 705 LRFFYALKIRPDIMSRDDPMFPYRSPFQPYLSYYGLFGSLVMIFFAGFTSFFH-----GF 759

Query: 527 CDAQAFFESYLAAPLWIFMYVGYMVYKRDFTFLNPLDKIDLDFHRRVYDPEIMRQEDEEN 586
            + + FF  Y     +I +Y+GY ++    + L  LD+ID+D  R   D  I  Q+ E  
Sbjct: 760 WNIKIFFSCYGGLVFFIVLYIGYKLFGT--SKLQRLDQIDMDIGRIELDRTIWNQQTEYQ 817

Query: 587 ---KERL 590
              KERL
Sbjct: 818 GNWKERL 824

>Kwal_23.3847
          Length = 579

 Score =  132 bits (333), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 106/453 (23%), Positives = 181/453 (39%), Gaps = 20/453 (4%)

Query: 75  DGTKSMKSNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLSLAGPGSLVIGYVMVSFV 134
           +G +S+ ++   +K +  RHV+++ +   IGT L V+  K L   G   L++G  +    
Sbjct: 53  EGKQSLDTDATHRK-LHERHVMLIGISGVIGTALFVSIGKALYHGGSAFLLLGMAVWCIP 111

Query: 135 TYFMVQAAGEMGVTYPTLPGNFNAYNSIFISKSFGFATTWLFCIQWLTVLPLELITSSMT 194
              +  +  EM V Y  L   F    +  +  S   A  W F       +P E++  +  
Sbjct: 112 MLCITVSTAEM-VCYLPLDSPFLRLTARCVDDSVAVAAGWNFWFLECVQIPFEIVAVNTI 170

Query: 195 VKYWNDTINADXXXXXXXXXXXXXXXXGVKAYGETEFIFNSCKILMVAGFIILSVVINCG 254
           + YW D  +A                  V+ YGE EF   S KI++  G    ++V   G
Sbjct: 171 IHYWRDDYSAAIPLVVQVVLYFGISVFAVRYYGEMEFWLASFKIILALGLFTFTLVAMLG 230

Query: 255 GAGVDGYIGGKYWRD-------PGSFAEGSGATRFKGICYILVSAYFSFGGIELFVLSIN 307
           G       G + + D       P        A  F+G    L+ A F+  G +   +   
Sbjct: 231 GNPHKDRFGFRNFGDAPFKQYFPSGVVGTPSAGYFQGFLACLIQASFTIAGPDYVSMIAG 290

Query: 308 EQSNPRKSTPVAAKRSVYRXXXXXXXXXXXXGFNVPHNNDQLMGSGGSA---THASPYVL 364
           E   PRK  PVA K    R            G     N+  L  +   A     +SPYV+
Sbjct: 291 ETHLPRKVLPVAFKHVFNRLTVLFLGSSLCVGILCSANDPDLTAAINEARPGAGSSPYVI 350

Query: 365 AASIHKVRVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPKFLNYIDREGRPL 424
           A     +R +P ++NA ++ +  S  N+  + + R +  +A  G AP+     +R G P+
Sbjct: 351 AMKNLGIRALPDVVNAALITAAFSAGNAYTFCSSRTLHGMALDGNAPRIFRRCNRHGVPI 410

Query: 425 RAXXXXXXXXXXXXXACSPQEEQAFTWLAAIAGLSELFTWSGIMLSHIRFRKAMKVQGRS 484
            A               +        WL  +   S+L  ++ + L+++ FR+A   Q  +
Sbjct: 411 YAVAVSLTWALLSLLQLNKNSAVVLNWLINLITASQLINFACLCLTYLYFRRAYLSQQHN 470

Query: 485 LDEVGYKANTGIWGSYY----GVFFNMLVFMAQ 513
           L  + +K+    WG  Y    G+F ++L+ + Q
Sbjct: 471 LPSLPFKS----WGQPYTALLGLFASLLMALVQ 499

>Scas_682.30
          Length = 845

 Score =  132 bits (332), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 140/637 (21%), Positives = 249/637 (39%), Gaps = 84/637 (13%)

Query: 18  EVTDSALYNNFNTSTTASLTPEIKEHSEESRNGLVHRFVDSFRRAESQRLEEDNDLEDGT 77
           E+ D+A Y N        ++   K H  E   G +  F D  RR      + +    D  
Sbjct: 206 EIIDNASYGNIEIDEEREISS--KSHIIEESPGSMTSFTDRERRKSILPFDLEKMFND-- 261

Query: 78  KSMKSNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLSLAGPGSLVIGYVMVSFVTYF 137
               +  ++++ ++ RH+ M+S+GT    G  + + +  S+AGP   ++G+ +   +   
Sbjct: 262 -PGNTKYYVQRKLRVRHIQMLSIGTCFSVGFFLTSGRAFSIAGPFGTLLGFALAGSIVLA 320

Query: 138 MVQAAGEMGVTYPTLPGNFNAYNSIFISKSFGFATTWLFCIQWLTVLPLELITSSMTVKY 197
            + +  E+    P   G F+   S F+  +FGF   W +    +   P E+ +S+  + Y
Sbjct: 321 TLLSFTELSTLIPVSSG-FSGLASRFVEDAFGFGLGWTYWFSCMIAFPSEVASSTFYLSY 379

Query: 198 W---NDTINA-DXXXXXXXXXXXXXXXXGVKAYGETEFIFNSCKILMVAGFIILSVVINC 253
           +   N T  A                   V+  GE  +I    KIL+    I + V+IN 
Sbjct: 380 YQHLNLTRGAIAGFVTLFSSYSIIINLLDVRILGEATYIIGLSKILITIVIIFVMVIINA 439

Query: 254 G-GAGVDGYIGGKYWR-----------------DPGSFAEGS-----GAT-RFKGICYIL 289
           G G  +   +G ++W                  D G    GS     GAT RF  +  ++
Sbjct: 440 GHGYKIHNQVGFRFWDSSKSVGDLTYGLFRPTFDLGDVGRGSTNGIPGATGRFLAVILVM 499

Query: 290 VSAYFSFGGIELFVLSINEQSNPRKSTPVAAKRSVYRXXXXXXXXXXXXGFNVPHNNDQL 349
           + + F+F G+E+  ++  E  NPRK+ P + KR+               G N+   + +L
Sbjct: 500 LISTFAFSGVEMTFMASGEAINPRKTIPSSIKRTFSIVLTVYMLAIFAVGINIYSGDPRL 559

Query: 350 MG------------------------------------SGGSATHASPYVLAASIHKVRV 373
           +                                     S   A + SP+VLA     +  
Sbjct: 560 LSYFAKYSSERYTSTINGIGTDWQLSDRCKGVYTEREHSTSHAIYTSPWVLALQSFGLCT 619

Query: 374 IPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPKFLNYIDREGRPLRAXXXXXXX 433
               +N +++    +   S+LY + R + +++ Q  AP      ++ G P  A       
Sbjct: 620 FASALNGILIFFTSTAGVSSLYNSSRTIYAMSVQRKAPLIFQRCNKRGVPYVAVIFSGVF 679

Query: 434 XXXXXXACSPQEEQAFTWLAAIAGLSELFTWSGIMLSHIRFRKAMKVQ----GRSLDEVG 489
                 A +    + F  L  I+  S    WSG+ +S IRF  A+K +     R+     
Sbjct: 680 YIIAYLAVNVGSSRNFDVLVNISSASTSIIWSGLNISFIRFYFALKQRKDLISRNDKTYP 739

Query: 490 YKANTGIWGSYYGVF--FNMLVFMAQFWVALSPIGNGGKCDAQAFFESYLAAPLWIFMYV 547
           YK+    + S+YG+F     ++FM        P    G+   ++FF +Y    L+  +Y 
Sbjct: 740 YKSPFQPYLSFYGLFGCLIFVIFMG------FPNFIKGQWSTRSFFSAYGGLFLFAILYA 793

Query: 548 GYMVYKRDFTFLNPLDKIDLDFHRRVYDPEIMRQEDE 584
           G+ +     + +  LD+ID+D  RR  D  +  +  E
Sbjct: 794 GFKIIGT--SKIQRLDQIDMDTGRREMDRIVWTEHSE 828

>Kwal_27.11900
          Length = 726

 Score =  130 bits (328), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 122/513 (23%), Positives = 201/513 (39%), Gaps = 76/513 (14%)

Query: 70  DNDLEDGTKSMKSNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLSLAGPGSLVIGYV 129
           D +     KS+   + +++ ++ RH+ M+SLG  IG GL + + K  S+AGP   +IG+ 
Sbjct: 216 DENSPPSNKSVPQQSTIQRKLRVRHLQMISLGATIGVGLFLNSGKAFSIAGPMGALIGFT 275

Query: 130 MVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFISKSFGFATTWLFCIQWLTVLPLELI 189
           +   +    + +  EM    P + G  +   S F+  +FGF+  W   + +    P E+I
Sbjct: 276 IGGTLILATLFSFAEMVALIPLITG-ISGLCSRFVGDAFGFSVGWCHWLSYAVGFPSEVI 334

Query: 190 TSSMTVKYWNDTIN-------ADXXXXXXXXXXXXXXXXGVKAYGETEFIFNSCKILMVA 242
            S++ + Y+ +                             V+ YGE E+  +  K+ +V 
Sbjct: 335 ASTIMLSYYKNLEQIATNRYYTALTITGIVVGLTLINLMDVRIYGELEYCSSVFKLAIVV 394

Query: 243 GFIILSVVINCGGAGVDGYIGGKYWRDPGSFAE-------------------------GS 277
             IIL +V+N GG   D YIG +YW    S  E                         G 
Sbjct: 395 FLIILMIVMNVGGLHND-YIGFRYWNRHKSPLEETTFGLFRPTFDMEDGGHGSRGGVPGF 453

Query: 278 GATRFKGICYILVSAYFSFGGIELFVLSINEQSNPRKSTPVAAKRSVYRXXXXXXXXXXX 337
           G      I   LVS  F++ G E+  ++  E  NPRK+ P   KR   R           
Sbjct: 454 GGVLLSCIASTLVSV-FAYVGSEIGFIAAGEAKNPRKAVPSVTKRIFTRVIMFYLLSIFV 512

Query: 338 XGFNVPHNNDQLM----GS-------------------GGSATH--------------AS 360
            G N+   + +L+    GS                   GGS                  S
Sbjct: 513 VGLNIYSGDPRLLRYDAGSNIAVTDNDETGVQAIINALGGSNCQQSRTENIFLVDNPNQS 572

Query: 361 PYVLAASIHKVRVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPKFLNYIDRE 420
           P+V+A        +  +IN V +   IS A+S LYA+ R + S+A Q  AP    +  + 
Sbjct: 573 PWVIAMQSLNQCTLSSVINGVFVSIGISAASSQLYASSRTLYSMATQQKAPALFTWCTKG 632

Query: 421 GRPLRAXXXXXXXXXXXXXACSPQEEQAFTWLAAIAGLSELFTWSGIMLSHIRFRKAMKV 480
           G P                  +    + F    +I  +  +  W G+ LS++RF  A+KV
Sbjct: 633 GVPYMCVLFCGLLGFLSLLCLNMDSAEVFFIFVSIGAMGSVIVWFGMNLSYLRFYYALKV 692

Query: 481 Q----GRSLDEVGYKANTGIWGSYYGVFFNMLV 509
           +     R+  E  Y++    + + YG+   +L+
Sbjct: 693 RPDILSRNAKEFPYRSPCQPYLAIYGMVLAVLL 725

>CAGL0E01089g complement(96582..99143) similar to sp|Q03770
           Saccharomyces cerevisiae YDR160w SSY1 transcriptional
           regulator of several transporter genes, start by
           similarity
          Length = 853

 Score =  128 bits (321), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 138/627 (22%), Positives = 245/627 (39%), Gaps = 97/627 (15%)

Query: 47  SRNGLVH-RFVDSFRRAESQRLEEDNDLEDGTKSMKSNNHLKKSMKSRHVVMMSLGTGIG 105
           S +G VH  F DS +  + +R   +   +    S +  N L++++K RH+ M+++   + 
Sbjct: 235 SIDGNVHSNFYDSDQEKKGKRYIHEKINKYLHDSTRRRNQLQRNLKVRHIQMLAISACLS 294

Query: 106 TGLLVANAKGLSLAGPGSLVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFIS 165
            G+ + + K  S+AGP   ++G+++   V    + +  E+    P   G F+   S F+ 
Sbjct: 295 AGIFMTSGKAFSIAGPFGCLLGFIITGTVVIATMMSFAELATLIPVSSG-FSGLASRFVE 353

Query: 166 KSFGFATTWLFCIQWLTVLPLELITSSMTVKYWNDTI----NADXXXXXXXXXXXXXXXX 221
            +FGFA  W +    +  LP ++++S+    +++                          
Sbjct: 354 DAFGFALGWTYWFSSMVALPAQVVSSTFYFSHYDHLKLTRGGTAGFVTLFSLFPLVLNLF 413

Query: 222 GVKAYGETEFIFNSCKILMVAGFIILSVVINCG-GAGVDGYIGGKYW------------- 267
            V+  GE  +I    K+L+    +I+ +V+N G G  V G +  +YW             
Sbjct: 414 DVRFLGEFVYIVGLSKVLITIMIVIVMLVLNAGHGFDVHGRVSFRYWDAEKSRNLKDITY 473

Query: 268 ---RDPGSFAE---------GSGATRFKGICYILVSAYFSFGGIELFVLSINEQSNPRKS 315
              R     ++         G    RF  +  +++ + F+F G+E+  ++  E  NPRK+
Sbjct: 474 GLFRPTFDLSDAGLGSINGIGGNRGRFIAVVSVMLVSTFAFSGVEMTFVASGEAKNPRKT 533

Query: 316 TPVAAKRSVYRXXXXXXXXXXXXGFNVPHNNDQLM----GSGGSATH------------- 358
            P A KR+                 N+   + +L+    G+  S  H             
Sbjct: 534 IPSAMKRTFIFIFTIYFFLIFSVSINIYTGDPRLLSYYTGALESRYHNIENKVSNEWQVS 593

Query: 359 -------------------ASPYVLAASIHKVRVIPHIINAVILISVISVANSALYAAPR 399
                              +SP+VLA             NAV++    S   S+LYA+ R
Sbjct: 594 YRCEEVLHGVNPGDVQAGFSSPWVLALENFGFCSFAAGFNAVLIFFTSSATASSLYASSR 653

Query: 400 LMCSLAQQGYAPKFLNYIDREGRPLRAXXXXXXXXXXXXXACSPQEEQAFTWLAAIAGLS 459
            + +++ Q  AP      DR G P  A             A        F  L  I+  +
Sbjct: 654 TLYAMSIQRKAPAVFRLCDRRGVPYVAIGFSSLFAIVAYLAVDDAAISNFDVLMNISSAA 713

Query: 460 ELFTWSGIMLSHIRFRKAMKVQGR--SLDEVGYKANT---------GIWG-SYYGVFFNM 507
               W G+ ++ +RF  A+K +    S D+V Y   +         G+ G S + +F   
Sbjct: 714 TSIIWLGLNVAFLRFYYALKKRRDIISRDDVFYPYRSPFQPYLSMFGLLGCSIFVLFMGF 773

Query: 508 LVFMAQFWVALSPIGNGGKCDAQAFFESYLAAPLWIFMYVGYMVYKRDFTFLNPLDKIDL 567
           + F+  +W            + ++FF SY    L+   Y+GY +     + +  LD++DL
Sbjct: 774 INFIHGYW------------NTKSFFSSYGGLILFGVCYLGYKLIST--SKIQRLDQLDL 819

Query: 568 DFHRRVYDPEI---MRQEDEENKERLK 591
           D  RR  D  +    RQ      ERLK
Sbjct: 820 DTGRREIDRILWTEHRQYRGPYSERLK 846

>Kwal_53.19461
          Length = 565

 Score =  123 bits (309), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 129/574 (22%), Positives = 224/574 (39%), Gaps = 93/574 (16%)

Query: 97  MMSLGTGIGTGLLVANAKGLSLAGPGSLVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGNF 156
           M++ G  +G GL + + K LS+ GP   ++G+ +   +    + +  E+    P L    
Sbjct: 1   MIATGAAMGVGLFLNSGKALSIGGPFGFLLGFSICGSIVLATMLSFTEIATLIP-LSSGI 59

Query: 157 NAYNSIFISKSFGFATTWLFCIQWLTVLPLELITSSMTVKYWNDTINADXXXXXXXXXXX 216
           +   S F+  +FGFA  W + + +   L  +++ S+  + Y+                  
Sbjct: 60  SGLASRFVEDAFGFALGWSYWLTYAITLANQIVASNFMLSYYGTMPARTGSTVGFVTFFL 119

Query: 217 XXXXXG----VKAYGETEFIFNSCKILMVAGFIILSVVINCG-GAGVDGYIGGKYW---R 268
                G    V    E  + F   KI++ A  I   V++N G G      +G ++W   +
Sbjct: 120 VFAIAGNLLDVNILAELAYGFTFFKIVITATMIFAMVILNAGAGRHKHPRVGFRFWDASK 179

Query: 269 DP-----GSFAE-------GSGAT--------RFKGICYILVSAYFSFGGIELFVLSINE 308
            P     G F         G GA         RF  +  +++ + FSF G+E+  ++  E
Sbjct: 180 SPENLTYGLFRPTFDLQDVGDGAKNGIPGAKGRFLSVLVVIIVSSFSFSGVEVGFVACGE 239

Query: 309 QSNPRKSTPVAAKRSVYRXXXXXXXXXXXXGFNVPHNNDQLMGSGGSATH---------- 358
            +NPR+S P A KR++                NV   + +L+    +AT           
Sbjct: 240 AANPRRSLPSATKRTIMTVIILYVVSIFVISLNVYSGDSRLLRYYTAATQEPTQSSVRAF 299

Query: 359 -------------------------ASPYVLAASIHKVRVIPHIINAVILISVISVANSA 393
                                     SP+VLA     +     + NA+++I  ++   S+
Sbjct: 300 NNNWQTDQVCTAHEIVSTTDFTNGSQSPWVLALESFGLCTFSSVFNAMLVIFGVTSELSS 359

Query: 394 LYAAPRLMCSLAQQGYAPKFLNYIDREGRPLRAXXXXXXXXXXXXXACSPQEEQAFTWLA 453
           LYA+ R + S++ QG AP       R+G P  A               + +  + F  LA
Sbjct: 360 LYASSRTLYSMSIQGKAPPIFKICSRKGVPYVAVIFSGLFGALAYLTVNAKALEIFQALA 419

Query: 454 AIAGLSELFTWSGIMLSHIRFRKAMK----VQGRSLDEVGYKANTGIWGSYYGVFFNMLV 509
            I+G +    W G  LS +RF  A+K    +  R      Y++    + + YG+F + L+
Sbjct: 420 NISGATISIIWFGFNLSFLRFYYALKRRPDIISREDPSFPYRSPLQPFLACYGLFGSFLI 479

Query: 510 --------FMAQFWVALSPIGNGGKCDAQAFFESYLAAPLWIFMYVGYMVYKRDFTFLNP 561
                   F+  FW            + + FF SY    ++I  Y GY +     + +  
Sbjct: 480 VVLMGFSNFLDGFW------------NTKMFFSSYGGLIVFILCYAGYRLLGT--SKIQR 525

Query: 562 LDKIDLDFHRRVYDPEIMRQEDEEN---KERLKN 592
           LD++DLD  RR  D  I  +  E     +ER++ 
Sbjct: 526 LDQLDLDSGRREMDRMIWTEHREYTNSVRERIRK 559

>YDR160W (SSY1) [1002] chr4 (776157..778715) Component of an
           extracellular amino acid sensor comprised of Ptr3p,
           Ssy1p, and Ssy5p, member of the amino
           acid-polyamine-choline (APC) family of membrane
           transporters [2559 bp, 852 aa]
          Length = 852

 Score =  124 bits (310), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 136/651 (20%), Positives = 245/651 (37%), Gaps = 122/651 (18%)

Query: 14  SAEFEVTDSALYNNFNTSTTASLTPE---IKEHSEESRNG---------LVHRFVDSFRR 61
           S+  +V D+A Y N        +T +   I E +E+  +G         L+H     F R
Sbjct: 209 SSTTDVIDNASYRNIAIDENVDITHKEHAIDEINEQGASGSESVVEGGSLLHDIEKVFNR 268

Query: 62  AESQRLEEDNDLEDGTKSMKSNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLSLAGP 121
           + + R                  H+++ +K RH+ M+S+G     GL + + K  S+AGP
Sbjct: 269 SRATR----------------KYHIQRKLKVRHIQMLSIGACFSVGLFLTSGKAFSIAGP 312

Query: 122 GSLVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFISKSFGFATTWLFCIQWL 181
              ++G+ +   +    + +  E+    P   G F+   S F+  +FGFA  W + I  +
Sbjct: 313 FGTLLGFGLTGSIILATMLSFTELSTLIPVSSG-FSGLASRFVEDAFGFALGWTYWISCM 371

Query: 182 TVLPLELITSSMTVKYWNDTINADXXXXX-----XXXXXXXXXXXGVKAYGETEFIFNSC 236
             LP ++ +S+  + Y+N+ +N                        V   GE  ++    
Sbjct: 372 LALPAQVSSSTFYLSYYNN-VNISKGVTAGFITLFSAFSIVVNLLDVSIMGEIVYVAGIS 430

Query: 237 KILMVAGFIILSVVINCG-GAGVDGYIGGKYWR-----------------DPGSFAEGSG 278
           K+++    +   +++N G G  +   +G +YW                  D     EGS 
Sbjct: 431 KVIIAILMVFTMIILNAGHGNDIHEGVGFRYWDSSKSVRNLTYGLYRPTFDLADAGEGSK 490

Query: 279 ------ATRFKGICYILVSAYFSFGGIELFVLSINEQSNPRKSTPVAAKRSVYRXXXXXX 332
                   RF     +++ + F+F G+E+  L+  E  NPRK+ P A KR+         
Sbjct: 491 KGISGPKGRFLATASVMLISTFAFSGVEMTFLASGEAINPRKTIPSATKRTFSIVLISYV 550

Query: 333 XXXXXXGFNVPHNNDQLM----------------GSGGS-------------------AT 357
                 G N+   + +L+                G+G                       
Sbjct: 551 FLIFSVGINIYSGDPRLLSYFPGISEKRYEAIIKGTGMDWRLRTNCRGGIDYRQISVGTG 610

Query: 358 HASPYVLAASIHKVRVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPKFLNYI 417
           ++SP+V+A     +       NA+++    +   S+L++  R + +++ Q  AP      
Sbjct: 611 YSSPWVVALQNFGLCTFASAFNAILIFFTATAGISSLFSCSRTLYAMSVQRKAPPVFEIC 670

Query: 418 DREGRPLRAXXXXXXXXXXXXXACSPQEEQAFTWLAAIAGLSELFTWSGIMLSHIRFRKA 477
            + G P  +             A      + F  LA ++  S    W G+ LS +RF  A
Sbjct: 671 SKRGVPYVSVIFSSLFSVIAYIAVDQTAIENFDVLANVSSASTSIIWMGLNLSFLRFYYA 730

Query: 478 MK----VQGRSLDEVGYKANTGIWGSYYG--------VFFNMLVFMAQFWVALSPIGNGG 525
           +K    +  R+     YK+    + + YG        +F     F+  FW          
Sbjct: 731 LKQRKDIISRNDSSYPYKSPFQPYLAIYGLVGCSLFVIFMGYPNFIHHFW---------- 780

Query: 526 KCDAQAFFESYLAAPLWIFMYVGYMVYKRDFTF-LNPLDKIDLDFHRRVYD 575
               +AFF +Y      +F ++ Y  YK   T  +  LD++D+D  RR  D
Sbjct: 781 --STKAFFSAYGG---LMFFFISYTAYKVLGTSKIQRLDQLDMDSGRREMD 826

>Scas_619.2*
          Length = 471

 Score =  121 bits (303), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 118/455 (25%), Positives = 208/455 (45%), Gaps = 43/455 (9%)

Query: 139 VQAAGEMGVTYPTLPGN------FNAY-NSIFISKSFGFATTWLFCIQWLTVLPLELITS 191
           + A GEM V Y  LPGN       +AY    ++ +S GFA++W +   ++ ++  E   +
Sbjct: 1   MNAFGEM-VCY--LPGNGSDSAGSSAYLVEKYVDRSLGFASSWNYYYCFVILVATECTAA 57

Query: 192 SMTVKYWNDTINAD--XXXXXXXXXXXXXXXXGVKAYGETEFIFNSCKILMVAGFIILSV 249
           +  V+YW   +                      V  YGE+EF F S KIL + G IILS 
Sbjct: 58  AGVVEYWAWALKVPKGAWITIFLFCVVALNMLPVNFYGESEFWFASIKILCILGLIILSF 117

Query: 250 VINCGGAGVDGYIGGKYWRDPGSFAE----GSGATRFKGICYILVSAYFSFG-GIELFVL 304
           ++  GG      +G +YW+ PG+FA+    G+G   F  +   ++   F+F  G EL  L
Sbjct: 118 ILFWGGGPSHDRLGFRYWQRPGAFADHITDGTGGN-FLDVYTGVIKGGFAFVLGPELVSL 176

Query: 305 SINEQSNPRKSTPVAAKRSVYRXXXXXXXXXXXXGFNVPHNNDQL---MGSGGSATHASP 361
           + +E  + R++   A++R V+R               V +N+  L   +        +SP
Sbjct: 177 TSSECHDQRRNIAKASRRFVWRLMIFYVLGSLSISVIVAYNDPNLQNALAQSKPGAGSSP 236

Query: 362 YVLAASIHKVRVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPKFLNYIDREG 421
           +V+      ++V+PHIIN  I+ S  S  N+ ++A+ R + ++A  G+APKF + I+R  
Sbjct: 237 FVIGIQNAGIKVLPHIINVCIMTSAWSAGNAYMFASSRSLLTMASHGHAPKFFSKINRLR 296

Query: 422 RPLRAXXXXXXXXXXXXXACSPQEEQAFTWLAAIAGLSELFTWSGIMLSHIRFRKAMKVQ 481
             +R                   + + F  +   + +S    W    +++IRFRKA+ + 
Sbjct: 297 CSIRGSWLFLLILLFSLLKRLLIDSKRFQLVFKHSTISGFIGWICACVAYIRFRKAI-IF 355

Query: 482 GRSLDEVGYKANTGIWGSYYGVFFNML--------VFMAQFWVALSPIGNGGKCDAQAFF 533
               D + YK     +  +Y +F   L        +F+ +FW            D + F 
Sbjct: 356 NDLYDRLPYKGFAQKYLIWYSLFMVSLITLTNGYQIFIPRFW------------DYKDFI 403

Query: 534 ESYLAAPLWIFMYVGYMVYKRDF-TFLNPLDKIDL 567
            +Y+  P++I +++G+ +  R +  +  P+DKID+
Sbjct: 404 AAYITLPVFIVLWIGHKLVTRSWRQWYIPVDKIDV 438

>AGL171W [4141] [Homologous to ScYDR160W (SSY1) - SH]
           complement(377256..379811) [2556 bp, 851 aa]
          Length = 851

 Score =  120 bits (300), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 142/659 (21%), Positives = 249/659 (37%), Gaps = 108/659 (16%)

Query: 11  MEKSAEFEVTDSALYNNFNTSTTASLTPEIKEHSEES---RNGLVHRFVDSFRRAESQRL 67
           +EK+ +  + +S+  +N   S    L P    H       RN L++   +     ES R 
Sbjct: 216 LEKNGQRAIDESSNKSNIYESHRKELLPNGIHHPTSRGCLRNALIYLINNPL--CESLRK 273

Query: 68  EEDNDLEDGTKSMKSNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLSLAGPGSLVIG 127
            +               H+++ +K RH+ M+++G  IG GL + +    ++AGP   ++G
Sbjct: 274 PD-------------RYHIQRKLKVRHLQMIAIGASIGVGLFLTSGNAFAVAGPFGTLLG 320

Query: 128 YVMVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFISKSFGFATTWLFCIQWLTVLPLE 187
           + +   V    + +  E+    P   G F+   S F+  +FGFA  W + + +    P +
Sbjct: 321 FSICGTVCLATMLSFTELSTLIPISSG-FSGLASRFVEDAFGFALGWSYWLSFTVTFPSQ 379

Query: 188 LITSSMTVKYWNDT----INADXXXXXXXXXXXXXXXXGVKAYGETEFIFNSCKILMVAG 243
           +I S   + Y+       I+                   V+ + E  +I    K+L+   
Sbjct: 380 IIASVFMLSYYEKVVATRISTAGLVTVFWLYATAANLLDVRLFAEVNYISAFVKVLITIL 439

Query: 244 FIILSVVINCGGA-GVDGYIGGKYWRDPGSFAE-----------------------GSGA 279
            +IL + +N  G  G  G IG ++W    S  E                       G   
Sbjct: 440 AMILMLFLNVRGVDGKSGAIGFRFWNSSSSETELTYGLFRPTFDLHDTGQGSLNGIGGAR 499

Query: 280 TRFKGICYILVSAYFSFGGIELFVLSINEQSNPRKSTPVAAKRSVYRXXXXXXXXXXXXG 339
            RF  I  +++ + +SF G+E+  ++  E  NPRK+ P A KR+  +            G
Sbjct: 500 GRFLAIILVVLISTYSFNGVEMAFVASGEAINPRKTLPSATKRAFTKIVTLYILSITFVG 559

Query: 340 FNVPHNNDQLMGSGGSAT--------------------------------HASPYVLAAS 367
            N+   + +L+  G                                    + SP++LA  
Sbjct: 560 LNMYSGDPRLLRYGVDVPTVVYRNTPGLQWQRDYSCMEQDIMQLHNMENGNRSPWILALQ 619

Query: 368 IHKVRVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPKFLNYIDREGRPLRAX 427
              +  +    N V++   IS A+S+L+A+ R + S+A Q  APK        G P  A 
Sbjct: 620 SFGLCSLASAFNGVLVFFGISAASSSLFASSRTLYSMATQQKAPKLFQTCTSYGVPWIAI 679

Query: 428 XXXXXXXXXXXXACSPQEEQAFTWLAAIAGLSELFTWSGIMLSHIRFRKAMK----VQGR 483
                       + +      F  L++IA  +    W G+ +S +RF  A+K    +  R
Sbjct: 680 LFSGSFGIIAYISVAESSMANFQTLSSIASGTNAIIWLGLNVSFLRFYYALKRRPDIISR 739

Query: 484 SLDEVGYKANTGIWGSYYG--------VFFNMLVFMAQFWVALSPIGNGGKCDAQAFFES 535
                 Y++    + S+YG        +F     F+  FW              ++F  S
Sbjct: 740 DDPTYPYRSPMQPFLSFYGLIGSGLVVIFMGFTNFLHGFW------------STRSFLSS 787

Query: 536 YLAAPLWIFMYVGYMVYKRDFTFLNPLDKIDLDFHRRVYDPEI---MRQEDEENKERLK 591
           Y     +I  Y  Y ++    + +  L+++D+D  RR  D  I    RQ      ER K
Sbjct: 788 YGGLIFFITSYFAYKLFGA--SKIQSLEQLDMDTGRREMDRMIWDEHRQYSGSLWERFK 844

>Scas_485.4*
          Length = 237

 Score =  107 bits (266), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 59/191 (30%), Positives = 97/191 (50%), Gaps = 2/191 (1%)

Query: 86  LKKSMKSRHVVMMSLGTGIGTGLLVANAKGLSLAGPGSLVIGYVMVSFVTYFMVQAAGEM 145
           +++ +K RH+ M++LG  IGTGL +  +  L  AGP   +I Y+ ++ + Y + Q+ GEM
Sbjct: 17  VRRELKQRHMGMIALGGTIGTGLFIGVSTPLMNAGPVGALIAYLFMATLAYSVTQSLGEM 76

Query: 146 GVTYPTLPGNFNAYNSIFISKSFGFATTWLFCIQWLTVLPLELITSSMTVKYWNDTINAD 205
             T+  +  +F  ++  F+S +FG A  +++   W     LEL      +++W   +   
Sbjct: 77  A-TFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTFAVPLA 135

Query: 206 XXXXXXXXXXXXXXXXGVKAYGETEFIFNSCKILMVAGFIILSVVINCGGAGVDGYIGGK 265
                            VK YGE EF     K++ + GF+I    + C GAGV G +G +
Sbjct: 136 AWISIFWMLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVC-GAGVTGPVGFR 194

Query: 266 YWRDPGSFAEG 276
           YWR PG+F  G
Sbjct: 195 YWRHPGAFGPG 205

>Scas_476.4
          Length = 237

 Score =  106 bits (265), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 59/191 (30%), Positives = 97/191 (50%), Gaps = 2/191 (1%)

Query: 86  LKKSMKSRHVVMMSLGTGIGTGLLVANAKGLSLAGPGSLVIGYVMVSFVTYFMVQAAGEM 145
           +++ +K RH+ M++LG  IGTGL +  +  L  AGP   +I Y+ ++ + Y + Q+ GEM
Sbjct: 17  VRRELKQRHMGMIALGGTIGTGLFIGVSTPLMNAGPVGALIAYLFMATLAYSVTQSLGEM 76

Query: 146 GVTYPTLPGNFNAYNSIFISKSFGFATTWLFCIQWLTVLPLELITSSMTVKYWNDTINAD 205
             T+  +  +F  ++  F+S +FG A  +++   W     LEL      +++W   +   
Sbjct: 77  A-TFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTFAVPLA 135

Query: 206 XXXXXXXXXXXXXXXXGVKAYGETEFIFNSCKILMVAGFIILSVVINCGGAGVDGYIGGK 265
                            VK YGE EF     K++ + GF+I    + C GAGV G +G +
Sbjct: 136 AWISIFWMLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVC-GAGVTGPVGFR 194

Query: 266 YWRDPGSFAEG 276
           YWR PG+F  G
Sbjct: 195 YWRHPGAFGPG 205

>Scas_642.22
          Length = 237

 Score =  103 bits (257), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 58/191 (30%), Positives = 96/191 (50%), Gaps = 2/191 (1%)

Query: 86  LKKSMKSRHVVMMSLGTGIGTGLLVANAKGLSLAGPGSLVIGYVMVSFVTYFMVQAAGEM 145
           +++ +K RH+ M++LG  IGTGL +  +  L  AGP   +I Y+ ++ + Y + Q+ GEM
Sbjct: 17  VRRELKQRHMGMIALGGTIGTGLFIGVSTPLMNAGPVGALIAYLFMATLAYSVTQSLGEM 76

Query: 146 GVTYPTLPGNFNAYNSIFISKSFGFATTWLFCIQWLTVLPLELITSSMTVKYWNDTINAD 205
             T+  +  +F  ++  F+S +FG A  +++   W     LEL      +++W   +   
Sbjct: 77  A-TFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTFAVPLA 135

Query: 206 XXXXXXXXXXXXXXXXGVKAYGETEFIFNSCKILMVAGFIILSVVINCGGAGVDGYIGGK 265
                            VK YGE EF     K++ + GF+I    + C GAGV G +  +
Sbjct: 136 AWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVC-GAGVTGPMSFR 194

Query: 266 YWRDPGSFAEG 276
           YWR PG+F  G
Sbjct: 195 YWRHPGAFGPG 205

>YGL077C (HNM1) [1905] chr7 complement(362226..363917) Choline
           permease, member of the amino acid permease family of
           membrane transporters [1692 bp, 563 aa]
          Length = 563

 Score = 39.3 bits (90), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 30/117 (25%), Positives = 51/117 (43%), Gaps = 12/117 (10%)

Query: 45  EESRNGLVHRFVDSFRRAESQRLEEDNDLEDGTKSMKSNNHLKKSMKSRHVVMMSLGTGI 104
           ++S N  +H+     R  E  +  +D D   G  +     HL+KS     +    LG G 
Sbjct: 16  DQSSNASMHK--RDLRVEEEIKPLDDMD-SKGAVAADGEVHLRKSFSLWSI----LGVGF 68

Query: 105 GT-----GLLVANAKGLSLAGPGSLVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGNF 156
           G      G+  +   G+S  GP  +V G ++V+ ++  +  + GE+   YP   G F
Sbjct: 69  GLTNSWFGISTSMVAGISSGGPMMIVYGIIIVALISICIGTSLGELSSAYPHAGGQF 125

>Sklu_2147.4 YKL174C, Contig c2147 6541-8247 reverse complement
          Length = 568

 Score = 39.3 bits (90), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 33/119 (27%), Positives = 56/119 (47%), Gaps = 8/119 (6%)

Query: 38  PEIKEHSEESRNGLVHRFVDSFRRAESQRLEEDNDLEDG---TKSMKSNNHLKKSMKSRH 94
           PE     E  R GL     +S  +     + ++ND +DG    +  +    L KS+ SR 
Sbjct: 2   PEYVRLPESLRGGLPSLVPESLLQ-NWHTIMQENDEDDGPEVVEQFQYEQKLDKSLLSRG 60

Query: 95  VVMMSLGTGIGT---GLLVANAKGLSLAGPGSLVIGYVMVSFVTYFMVQAAGEMGVTYP 150
            V+  LG G+ +   G+    + GL   GP ++V G+++V F T+    + GE+   +P
Sbjct: 61  SVI-GLGFGLMSPVLGMSTTMSIGLLNGGPLTIVAGFMVVGFATWLCSLSLGEIVSKFP 118

>Sklu_2305.6 YGL077C, Contig c2305 10656-12281
          Length = 541

 Score = 38.9 bits (89), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 29/115 (25%), Positives = 50/115 (43%), Gaps = 15/115 (13%)

Query: 47  SRNGLVHRFVDSFRRAESQRLEEDNDLEDGTKSMKSNNHLKKSMKSRHVVMMSLGTGIGT 106
           S+NG+ H         E  +L+  N ++  T   +    L+KS     +    LG G G 
Sbjct: 14  SQNGIQHLL------KEEDQLQHTNTVKSCTLEGERGAELRKSFSLWSI----LGVGFGL 63

Query: 107 -----GLLVANAKGLSLAGPGSLVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGNF 156
                G+  +   G+S  GP  +V G ++++ V+  +  + GE+   YP   G F
Sbjct: 64  TNSWFGISASMVTGISSGGPMMIVYGIIIIALVSVCIGISLGELSSAYPHAGGQF 118

>Scas_233.1
          Length = 141

 Score = 36.6 bits (83), Expect = 0.016,   Method: Composition-based stats.
 Identities = 20/84 (23%), Positives = 40/84 (47%)

Query: 27  NFNTSTTASLTPEIKEHSEESRNGLVHRFVDSFRRAESQRLEEDNDLEDGTKSMKSNNHL 86
           N  +S T +++      + +       +F DSF++AE   L+ +    +      +   L
Sbjct: 58  NIQSSITHTISNPSFTSTTQPSTTRWQKFKDSFKKAEDVELDPNLTEAERIAQATAKAPL 117

Query: 87  KKSMKSRHVVMMSLGTGIGTGLLV 110
           + ++K R   M+++G  IG+GL V
Sbjct: 118 QHTLKGRQQTMIAIGGAIGSGLFV 141

>Scas_689.19
          Length = 612

 Score = 38.5 bits (88), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 43/86 (50%), Gaps = 4/86 (4%)

Query: 68  EEDNDLEDGTKSMKSNNHLKKSMKSRHVVMMSLGTGIGT---GLLVANAKGLSLAGPGSL 124
           E D D  +  +  K N  L KS+ SR  V+  LG G+ +   G+  + A GL   GP ++
Sbjct: 34  ESDTDEVESVEHFKYNQELDKSLLSRSSVV-GLGFGLMSPVLGMSTSMAIGLINGGPATI 92

Query: 125 VIGYVMVSFVTYFMVQAAGEMGVTYP 150
           + G+++     +F   + GE+   +P
Sbjct: 93  LWGFIISGICIWFCSLSLGEVVSKFP 118

>KLLA0A06666g complement(603169..604851) similar to sp|P36029
           Saccharomyces cerevisiae YKL174c, start by similarity
          Length = 560

 Score = 35.8 bits (81), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 41/86 (47%), Gaps = 4/86 (4%)

Query: 68  EEDNDLEDGTKSMKSNNHLKKSMKSRHVVMMSLGTGIGT---GLLVANAKGLSLAGPGSL 124
           EED D+ D  K       L K++ SR  V+  LG G+ +   G+    + GL   G  S+
Sbjct: 63  EEDQDIPDEVKEFTYVQQLDKNLLSRTSVI-GLGFGLMSPVLGMSTTMSIGLLNGGSPSI 121

Query: 125 VIGYVMVSFVTYFMVQAAGEMGVTYP 150
           + GY++   +T+    +  E+   YP
Sbjct: 122 IFGYLICGIMTWISSLSLSEIVSKYP 147

>Scas_720.18
          Length = 569

 Score = 33.9 bits (76), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 25/109 (22%), Positives = 47/109 (43%), Gaps = 8/109 (7%)

Query: 56  VDSFRRAESQRLEEDNDLEDGTKSMK---SNNHLKKSMKSRHVVMMSLGTGIGT-----G 107
           +DS      +   + N L   T+ +    +NN+ +  ++    V   LG G G      G
Sbjct: 18  IDSNTSLHQRDTFDKNKLSTKTQELDGDANNNNGEVHLRKSFSVWSILGVGFGLTNSWFG 77

Query: 108 LLVANAKGLSLAGPGSLVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGNF 156
           +  +   G+S  GP  +V G ++++ V+  +  +  E+   YP   G F
Sbjct: 78  ISASMVTGISSGGPMMVVYGIIIIALVSICIGTSLSELSSAYPHAGGQF 126

>YKL174C (YKL174C) [3097] chr11 complement(120385..122241) Member of
           the amino acid permease family of membrane transporters
           [1857 bp, 618 aa]
          Length = 618

 Score = 32.7 bits (73), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 27/117 (23%), Positives = 55/117 (47%), Gaps = 5/117 (4%)

Query: 38  PEIKEHSEESRNGLVHRFVDS-FRRAESQRLEEDNDLEDGTKSMKSNNHLKKSMKSRHVV 96
           PE    ++  R  +VH   +  F    +   E+D+   +  +    +  L KS+ SR  +
Sbjct: 2   PEYTLLADNIRENIVHFDPNGLFDNLHTIVHEDDSQENEEAEHFNYDQVLDKSLLSRGSI 61

Query: 97  MMSLGTGIGT---GLLVANAKGLSLAGPGSLVIGYVMVSFVTYFMVQAAGEMGVTYP 150
           +  LG G+ +   G+  + A GL   GP ++++G+++     +F   + GE+   +P
Sbjct: 62  V-GLGLGLMSPVLGMCTSMAIGLINGGPLTIMLGFLISGVCIWFSSLSLGEIVSKFP 117

>CAGL0D00924g 108341..114283 similar to sp|P25386 Saccharomyces
           cerevisiae YDL058w USO1 intracellular protein transport
           protein, start by similarity
          Length = 1980

 Score = 32.7 bits (73), Expect = 1.1,   Method: Composition-based stats.
 Identities = 22/67 (32%), Positives = 37/67 (55%), Gaps = 9/67 (13%)

Query: 39  EIKEHSEESRNGL--VHRFVDSFRRAESQRLEEDN-----DLEDGTKSM-KSNNHLKKSM 90
           E+ EH E++  G+  ++R + S +R E Q+LEEDN     DLE       K    LK  +
Sbjct: 817 ELSEHKEKNEQGINKMNRDLFSLQR-EKQKLEEDNKQSKKDLEKTKNDFTKQETKLKDQI 875

Query: 91  KSRHVVM 97
           K++ +++
Sbjct: 876 KAKEILI 882

>CAGL0H03399g complement(316110..317780) highly similar to sp|P19807
           Saccharomyces cerevisiae YGL077c HNM1 choline permease,
           hypothetical start
          Length = 556

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 21/84 (25%), Positives = 39/84 (46%), Gaps = 9/84 (10%)

Query: 78  KSMKSNNHLKKSMKSRHVVMMSLGTGIGT-----GLLVANAKGLSLAGPGSLVIGYVMVS 132
           +S+    HL+KS     +    LG G G      G+  +   G++  GP  +V G ++++
Sbjct: 36  QSIDGEVHLRKSFSLWSI----LGVGFGLTNSWFGISASMVTGINSGGPMMIVYGIIIIA 91

Query: 133 FVTYFMVQAAGEMGVTYPTLPGNF 156
            ++  +  + GE+   YP   G F
Sbjct: 92  LISVCIGVSLGELSSAYPHAGGQF 115

>CAGL0M08272g complement(823019..824884) highly similar to sp|P36029
           Saccharomyces cerevisiae YKL174c, start by similarity
          Length = 621

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 29/121 (23%), Positives = 57/121 (47%), Gaps = 8/121 (6%)

Query: 35  SLTPE-IKEHSEESRNGL-VHRFVDSFRRAESQRLEEDNDLEDGTKSMKSNNHLKKSMKS 92
           +L PE I+E+  E+   L  H   ++      +  +E  D  +  +       L KS+ S
Sbjct: 6   TLIPENIRENIRENMPNLDPHEIFENLHHYVQE--DEVTDEPEEVEHFNYKQELDKSLLS 63

Query: 93  RHVVMMSLGTGIGT---GLLVANAKGLSLAGPGSLVIGYVMVSFVTYFMVQAAGEMGVTY 149
           R+ V+  LG G+ +   G+  +   G+   GP S+++G+ +   + +F   + GE+   +
Sbjct: 64  RNSVI-GLGFGLMSPVLGMCTSMGIGMLNGGPLSIMLGFFISGILIWFSSLSLGEIVSKF 122

Query: 150 P 150
           P
Sbjct: 123 P 123

>AFL081W [3112] [Homologous to ScYGL077C (HNM1) - SH]
           complement(286339..287967) [1629 bp, 542 aa]
          Length = 542

 Score = 32.0 bits (71), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 28/109 (25%), Positives = 46/109 (42%), Gaps = 12/109 (11%)

Query: 56  VDSFRRAESQRLEEDNDLED---GTKSMKSNNHLKKSMKSRHVVMMSLGTGIGT-----G 107
           +D  +R  S +  ED +  +    T  +     L+KS     V    LG G G      G
Sbjct: 9   MDLVKRHPSGQCCEDGEKSNVGMTTCQVDEGQLLRKSFSLWSV----LGVGFGLTNSWFG 64

Query: 108 LLVANAKGLSLAGPGSLVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGNF 156
           + V+   G+   GP  +V G V+++ V+  +  +  E+   YP   G F
Sbjct: 65  ISVSMITGIGSGGPMMIVYGIVIIALVSVCVGVSLAELSSAYPHAGGQF 113

>YJL122W (YJL122W) [2797] chr10 (189636..190163) Protein of unknown
           function [528 bp, 175 aa]
          Length = 175

 Score = 30.4 bits (67), Expect = 2.3,   Method: Composition-based stats.
 Identities = 16/59 (27%), Positives = 29/59 (49%), Gaps = 1/59 (1%)

Query: 64  SQRLEEDNDLE-DGTKSMKSNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLSLAGP 121
           S +LE++ D++ DG K +K N         +  +   +      GL++ N +G +L GP
Sbjct: 114 SAKLEDEMDIDLDGGKKVKENEKKSSLTLVKEALWSVIDDTASQGLIIENGQGTTLGGP 172

>Kwal_26.6861
          Length = 401

 Score = 30.0 bits (66), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 20/36 (55%)

Query: 463 TWSGIMLSHIRFRKAMKVQGRSLDEVGYKANTGIWG 498
           +WSG +L+ I     +   G  LD++ YKA   IWG
Sbjct: 362 SWSGFLLNCITSIGGILAVGTVLDKITYKAQRSIWG 397

>Kwal_26.7070
          Length = 1315

 Score = 30.0 bits (66), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 41/100 (41%), Gaps = 19/100 (19%)

Query: 104  IGTGLLVAN--AKGLSLAGPGSLVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNS 161
            IG   LV N   K  + A PGSLV  + +V F  Y  +     +   Y  +         
Sbjct: 1146 IGKAALVTNQWTKFTAFAIPGSLV--FWLVFFPIYASILPHANVSKEYYGV--------- 1194

Query: 162  IFISKSFGFATTWLFCIQWLTVLPLELITSSMTVKYWNDT 201
              +S  +G AT WL CI    VLP   +   +  KY+  T
Sbjct: 1195 --VSHVYGSATFWLMCI----VLPTFALMRDLVWKYYKRT 1228

>Scas_492.3
          Length = 293

 Score = 29.3 bits (64), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 29/51 (56%), Gaps = 1/51 (1%)

Query: 9   SKMEKSAEFEVTDSALYNNFNTSTTASLTPEIKEHSEESR-NGLVHRFVDS 58
           S+  ++  F VTD+   NN  T+T+   T EIKE  ++S  N  +H  ++S
Sbjct: 118 SETNENRNFLVTDTMFLNNETTTTSPVFTNEIKEEPKDSHLNVFLHPHMES 168

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.321    0.135    0.407 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 17,626,882
Number of extensions: 700394
Number of successful extensions: 2704
Number of sequences better than 10.0: 141
Number of HSP's gapped: 2235
Number of HSP's successfully gapped: 152
Length of query: 594
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 487
Effective length of database: 12,891,983
Effective search space: 6278395721
Effective search space used: 6278395721
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 64 (29.3 bits)