Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YDR045C (RPC11)1101095901e-80
Scas_569.4*1101095518e-75
CAGL0H08415g100994987e-67
Kwal_27.109391101094927e-66
KLLA0F18568g1121114867e-65
AGR029W1121114867e-65
Sklu_2357.91021014292e-56
KLLA0F09361g292951229e-09
AGR011W304961149e-08
Scas_621.15307341131e-07
KLLA0D03234g1221101082e-07
CAGL0D06160g306341112e-07
YGL043W (DST1)309341112e-07
Sklu_2213.5287341113e-07
Kwal_26.7521301341103e-07
AFR417W1251231064e-07
Sklu_2119.41251271055e-07
Kwal_27.9972125431047e-07
Scas_673.30*1481251058e-07
YJR063W (RPA12)125431021e-06
Kwal_56.24054122110952e-05
KLLA0B13860g16041952e-05
CAGL0F00561g12843943e-05
Scas_720.22*122110924e-05
YGL070C (RPB9)122110915e-05
CAGL0H03509g122114907e-05
AFL088W122110872e-04
Sklu_1830.311055700.050
AFR518C43673611.5
Scas_544.7d17379582.7
ABL041W81850584.3
Kwal_23.462328739574.6
KLLA0E07348g27334575.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YDR045C
         (109 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YDR045C (RPC11) [898] chr4 complement(547974..548306) RNA polyme...   231   1e-80
Scas_569.4*                                                           216   8e-75
CAGL0H08415g 824631..824933 highly similar to sp|Q04307 Saccharo...   196   7e-67
Kwal_27.10939                                                         194   7e-66
KLLA0F18568g complement(1708319..1708657) highly similar to sp|Q...   191   7e-65
AGR029W [4339] [Homologous to ScYDR045C (RPC11) - SH] complement...   191   7e-65
Sklu_2357.9 YDR045C, Contig c2357 12849-13157 reverse complement      169   2e-56
KLLA0F09361g complement(864425..865303) similar to sp|P07273 Sac...    52   9e-09
AGR011W [4321] [Homologous to ScYGL043W (DST1) - SH] complement(...    49   9e-08
Scas_621.15                                                            48   1e-07
KLLA0D03234g 270311..270679 highly similar to sp|P27999 Saccharo...    46   2e-07
CAGL0D06160g complement(580707..581627) highly similar to sp|P07...    47   2e-07
YGL043W (DST1) [1934] chr7 (417485..418414) Transcription elonga...    47   2e-07
Sklu_2213.5 YGL043W, Contig c2213 7532-8395                            47   3e-07
Kwal_26.7521                                                           47   3e-07
AFR417W [3609] [Homologous to ScYJR063W (RPA12) - SH] complement...    45   4e-07
Sklu_2119.4 YJR063W, Contig c2119 5697-6074 reverse complement         45   5e-07
Kwal_27.9972                                                           45   7e-07
Scas_673.30*                                                           45   8e-07
YJR063W (RPA12) [2957] chr10 (555109..555486) RNA polymerase I s...    44   1e-06
Kwal_56.24054                                                          41   2e-05
KLLA0B13860g 1215461..1215943 some similarities with sp|P32529 S...    41   2e-05
CAGL0F00561g complement(58585..58971) highly similar to sp|P3252...    41   3e-05
Scas_720.22*                                                           40   4e-05
YGL070C (RPB9) [1910] chr7 complement(374460..374828) RNA polyme...    40   5e-05
CAGL0H03509g complement(326276..326644) highly similar to sp|P27...    39   7e-05
AFL088W [3105] [Homologous to ScYGL070C (RPB9) - SH] complement(...    38   2e-04
Sklu_1830.3 YGL070C, Contig c1830 5480-5812 reverse complement         32   0.050
AFR518C [3710] [Homologous to NOHBY] (1364371..1365681) [1311 bp...    28   1.5  
Scas_544.7d                                                            27   2.7  
ABL041W [551] [Homologous to ScYMR089C (YTA12) - SH] complement(...    27   4.3  
Kwal_23.4623                                                           27   4.6  
KLLA0E07348g join(complement(668822..668828),complement(667907.....    27   5.0  

>YDR045C (RPC11) [898] chr4 complement(547974..548306) RNA
           polymerase III subunit C11, required for RNA cleavage
           activity and transcription termination [333 bp, 110 aa]
          Length = 110

 Score =  231 bits (590), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 109/109 (100%), Positives = 109/109 (100%)

Query: 1   MLSFCPSCNNMLLITSGDSGVYTLACRSCPYEFPIEGIEIYDRKKLPRKEVDDVLGGGWD 60
           MLSFCPSCNNMLLITSGDSGVYTLACRSCPYEFPIEGIEIYDRKKLPRKEVDDVLGGGWD
Sbjct: 1   MLSFCPSCNNMLLITSGDSGVYTLACRSCPYEFPIEGIEIYDRKKLPRKEVDDVLGGGWD 60

Query: 61  NVDQTKTQCPNYDTCGGESAYFFQLQIRSADEPMTTFYKCVNCGHRWKE 109
           NVDQTKTQCPNYDTCGGESAYFFQLQIRSADEPMTTFYKCVNCGHRWKE
Sbjct: 61  NVDQTKTQCPNYDTCGGESAYFFQLQIRSADEPMTTFYKCVNCGHRWKE 109

>Scas_569.4*
          Length = 110

 Score =  216 bits (551), Expect = 8e-75,   Method: Compositional matrix adjust.
 Identities = 100/109 (91%), Positives = 102/109 (93%)

Query: 1   MLSFCPSCNNMLLITSGDSGVYTLACRSCPYEFPIEGIEIYDRKKLPRKEVDDVLGGGWD 60
           MLSFCP CNNMLLIT+ DSGVYTL CRSCPYEFPIEGIEIYDRK LPRKEVDDVLGGGWD
Sbjct: 1   MLSFCPLCNNMLLITTADSGVYTLTCRSCPYEFPIEGIEIYDRKTLPRKEVDDVLGGGWD 60

Query: 61  NVDQTKTQCPNYDTCGGESAYFFQLQIRSADEPMTTFYKCVNCGHRWKE 109
           NVDQTK QCPNY+ CGGESAYFFQLQIRSADEPMTTFYKCVNC HRWKE
Sbjct: 61  NVDQTKVQCPNYEKCGGESAYFFQLQIRSADEPMTTFYKCVNCAHRWKE 109

>CAGL0H08415g 824631..824933 highly similar to sp|Q04307
           Saccharomyces cerevisiae YDR045c RPC11, start by
           similarity
          Length = 100

 Score =  196 bits (498), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 89/99 (89%), Positives = 93/99 (93%)

Query: 11  MLLITSGDSGVYTLACRSCPYEFPIEGIEIYDRKKLPRKEVDDVLGGGWDNVDQTKTQCP 70
           MLL+ + D+GVY L+CRSCPYEFPIE IEIYDRKKLPRKEVDDVLGGGWDNVDQTK QCP
Sbjct: 1   MLLVATSDNGVYNLSCRSCPYEFPIESIEIYDRKKLPRKEVDDVLGGGWDNVDQTKVQCP 60

Query: 71  NYDTCGGESAYFFQLQIRSADEPMTTFYKCVNCGHRWKE 109
           NYDTCGGESAYFFQLQIRSADEPMTTFYKCVNC HRWKE
Sbjct: 61  NYDTCGGESAYFFQLQIRSADEPMTTFYKCVNCAHRWKE 99

>Kwal_27.10939
          Length = 110

 Score =  194 bits (492), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 85/109 (77%), Positives = 96/109 (88%)

Query: 1   MLSFCPSCNNMLLITSGDSGVYTLACRSCPYEFPIEGIEIYDRKKLPRKEVDDVLGGGWD 60
           MLSFCP+C+NML+++  +SG Y L C SCPY FPIEG+E+YDRK LPRKEVDDVLGGGWD
Sbjct: 1   MLSFCPTCHNMLVVSPAESGAYALKCGSCPYAFPIEGVEVYDRKTLPRKEVDDVLGGGWD 60

Query: 61  NVDQTKTQCPNYDTCGGESAYFFQLQIRSADEPMTTFYKCVNCGHRWKE 109
           NVDQT  QCPNYD C GE AYFFQLQIRSADEPMTTFYKCV+CG+RW+E
Sbjct: 61  NVDQTAVQCPNYDQCAGERAYFFQLQIRSADEPMTTFYKCVSCGNRWRE 109

>KLLA0F18568g complement(1708319..1708657) highly similar to
           sp|Q04307 Saccharomyces cerevisiae YDR045c RPC11 RNA
           polymerase III subunit C11, required for RNA cleavage
           activity and transcription termination singleton, start
           by similarity
          Length = 112

 Score =  191 bits (486), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 87/111 (78%), Positives = 96/111 (86%), Gaps = 2/111 (1%)

Query: 1   MLSFCPSCNNMLLITSGDSGVYTLACRSCPYEFPIEGIEIYDRKKLPRKEVDDVLGG--G 58
           MLSFCP CNNMLL++  DSG+Y LAC SCPY+F I+GIE+YDRK LPRKEVDDVLGG   
Sbjct: 1   MLSFCPLCNNMLLVSKADSGLYKLACGSCPYQFLIDGIEVYDRKNLPRKEVDDVLGGEGA 60

Query: 59  WDNVDQTKTQCPNYDTCGGESAYFFQLQIRSADEPMTTFYKCVNCGHRWKE 109
           WDNVDQT  QCPN+D C GE AYFFQLQIRSADEPMTTFYKCVNCGH+W+E
Sbjct: 61  WDNVDQTAAQCPNHDQCAGERAYFFQLQIRSADEPMTTFYKCVNCGHKWRE 111

>AGR029W [4339] [Homologous to ScYDR045C (RPC11) - SH]
           complement(768240..768578) [339 bp, 112 aa]
          Length = 112

 Score =  191 bits (486), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 88/111 (79%), Positives = 96/111 (86%), Gaps = 2/111 (1%)

Query: 1   MLSFCPSCNNMLLITSGDSGVYTLACRSCPYEFPIEGIEIYDRKKLPRKEVDDVLGG--G 58
           MLSFCP CNNML ++ GDSGVY L C SCPYEFPIEG+EIYDR+ LPRKEVDDVLGG   
Sbjct: 1   MLSFCPYCNNMLPVSKGDSGVYRLGCPSCPYEFPIEGVEIYDRRNLPRKEVDDVLGGEGA 60

Query: 59  WDNVDQTKTQCPNYDTCGGESAYFFQLQIRSADEPMTTFYKCVNCGHRWKE 109
           WDNVDQT  QCP ++TCGGE AYFFQLQIRSADEPMTTFYKCV CGH+W+E
Sbjct: 61  WDNVDQTAVQCPQHETCGGEKAYFFQLQIRSADEPMTTFYKCVTCGHKWRE 111

>Sklu_2357.9 YDR045C, Contig c2357 12849-13157 reverse complement
          Length = 102

 Score =  169 bits (429), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 78/101 (77%), Positives = 85/101 (84%), Gaps = 2/101 (1%)

Query: 11  MLLITSGDSGVYTLACRSCPYEFPIEGIEIYDRKKLPRKEVDDVLGG--GWDNVDQTKTQ 68
           MLLI + D+G+Y L C SCPYEFPIEGIE+YDRK L RKEVDDVLGG   WDNVDQT  Q
Sbjct: 1   MLLIATNDAGIYKLNCPSCPYEFPIEGIEVYDRKTLVRKEVDDVLGGEGAWDNVDQTGAQ 60

Query: 69  CPNYDTCGGESAYFFQLQIRSADEPMTTFYKCVNCGHRWKE 109
           CPN+D CGG  AYFFQLQIRSADEPMTTFYKCV CGH+W+E
Sbjct: 61  CPNHDNCGGNKAYFFQLQIRSADEPMTTFYKCVTCGHKWRE 101

>KLLA0F09361g complement(864425..865303) similar to sp|P07273
           Saccharomyces cerevisiae YGL043w DST1 TFIIS
           (transcription elongation factor) singleton, start by
           similarity
          Length = 292

 Score = 51.6 bits (122), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 47/95 (49%), Gaps = 5/95 (5%)

Query: 14  ITSGDSGVYTLACRSCPYEFPIEGIEIYDRKKLPRKEVDDVLGGGWDNVDQTKTQCPNYD 73
           IT+G+     L   + P +   E +    +KK+   E  ++       V+++ T      
Sbjct: 201 ITNGEVSAKHLVT-ADPKDLAPEHL----KKKIEEIEKQNLFNAQGATVERSVTDRFQCG 255

Query: 74  TCGGESAYFFQLQIRSADEPMTTFYKCVNCGHRWK 108
            C      ++QLQ RSADEP+TTF  C NCG+RWK
Sbjct: 256 KCKQRKVSYYQLQTRSADEPLTTFCTCENCGNRWK 290

>AGR011W [4321] [Homologous to ScYGL043W (DST1) - SH]
           complement(737606..738520) [915 bp, 304 aa]
          Length = 304

 Score = 48.5 bits (114), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 48/96 (50%), Gaps = 7/96 (7%)

Query: 14  ITSGD-SGVYTLACRSCPYEFPIEGIEIYDRKKLPRKEVDDVLGGGWDNVDQTKTQCPNY 72
           IT+GD +  Y + C   P E   E +    RKKL      ++       ++++ T     
Sbjct: 213 ITNGDITPEYLVNCD--PKELAPEHL----RKKLEEIAKQNLFNAQGATLERSVTDRFQC 266

Query: 73  DTCGGESAYFFQLQIRSADEPMTTFYKCVNCGHRWK 108
             C  +   ++QLQ RSADEP+TTF  C  CG+RWK
Sbjct: 267 GKCKEKKVSYYQLQTRSADEPLTTFCTCEACGNRWK 302

>Scas_621.15
          Length = 307

 Score = 48.1 bits (113), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 19/34 (55%), Positives = 24/34 (70%)

Query: 75  CGGESAYFFQLQIRSADEPMTTFYKCVNCGHRWK 108
           C  +   ++QLQ RSADEP+TTF  C  CG+RWK
Sbjct: 272 CKEKKVSYYQLQTRSADEPLTTFCTCEACGNRWK 305

>KLLA0D03234g 270311..270679 highly similar to sp|P27999
           Saccharomyces cerevisiae YGL070c RPB9 DNA-directed RNA
           polymerase II, 14. 2 KD subunit singleton, start by
           similarity
          Length = 122

 Score = 46.2 bits (108), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 46/110 (41%), Gaps = 11/110 (10%)

Query: 2   LSFCPSCNNMLLITS-GDSGVYTLACRSCPYEFPIEGIEIYDRKKLPRKEVDDVLG---- 56
             FC  CNNML      ++      CR+CPY     G  +  R +L +  + +  G    
Sbjct: 4   FRFCRDCNNMLYPREDKETHKLLFECRTCPY-VEEAGTPLVYRHEL-KTNIGETAGVVQD 61

Query: 57  -GGWDNVDQTKTQCPNYDTCGGESAYFFQLQIRSADEPMTTFYKCVNCGH 105
            G    + ++  +CP    C      FFQ Q R  D  M  FY C++C H
Sbjct: 62  IGSDPTLPRSDKECPK---CHSRENVFFQSQQRRKDTSMVLFYVCLHCSH 108

>CAGL0D06160g complement(580707..581627) highly similar to sp|P07273
           Saccharomyces cerevisiae YGL043w DST1 TFIIS, start by
           similarity
          Length = 306

 Score = 47.4 bits (111), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 19/34 (55%), Positives = 24/34 (70%)

Query: 75  CGGESAYFFQLQIRSADEPMTTFYKCVNCGHRWK 108
           C  +   ++QLQ RSADEP+TTF  C  CG+RWK
Sbjct: 271 CKEKKVSYYQLQTRSADEPLTTFCTCEACGNRWK 304

>YGL043W (DST1) [1934] chr7 (417485..418414) Transcription
           elongation factor S-II, a DNA strand transfer protein
           catalyzing homologous DNA strand exchange [930 bp, 309
           aa]
          Length = 309

 Score = 47.4 bits (111), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 19/34 (55%), Positives = 24/34 (70%)

Query: 75  CGGESAYFFQLQIRSADEPMTTFYKCVNCGHRWK 108
           C  +   ++QLQ RSADEP+TTF  C  CG+RWK
Sbjct: 274 CKEKKVSYYQLQTRSADEPLTTFCTCEACGNRWK 307

>Sklu_2213.5 YGL043W, Contig c2213 7532-8395
          Length = 287

 Score = 47.4 bits (111), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 19/34 (55%), Positives = 24/34 (70%)

Query: 75  CGGESAYFFQLQIRSADEPMTTFYKCVNCGHRWK 108
           C  +   ++QLQ RSADEP+TTF  C  CG+RWK
Sbjct: 252 CKEKKVSYYQLQTRSADEPLTTFCTCEVCGNRWK 285

>Kwal_26.7521
          Length = 301

 Score = 47.0 bits (110), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 19/34 (55%), Positives = 24/34 (70%)

Query: 75  CGGESAYFFQLQIRSADEPMTTFYKCVNCGHRWK 108
           C  +   ++QLQ RSADEP+TTF  C  CG+RWK
Sbjct: 266 CKEKKVSYYQLQTRSADEPLTTFCTCEVCGNRWK 299

>AFR417W [3609] [Homologous to ScYJR063W (RPA12) - SH]
           complement(1184595..1184972) [378 bp, 125 aa]
          Length = 125

 Score = 45.4 bits (106), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 52/123 (42%), Gaps = 23/123 (18%)

Query: 2   LSFCPSCNNMLLITSGDSGVYTLACRSCPYEFPIEGIEIYDRKKLPRKEVDDVL------ 55
           L FC  C N+L   S  +G + +AC  C  ++       +   K+     DD        
Sbjct: 7   LIFCVYCGNLLDNPSAVAGDH-VACALCDAQYDKA---TFSNLKVVTATADDAFPSALRA 62

Query: 56  ----------GGGWDNVDQTKTQCPNYDTCGGESAYFFQLQIRSADEPMTTFYKCVNCGH 105
                      G  ++    + +CP    CG +   +  LQ+RSADE  T FY C +CG+
Sbjct: 63  KRSVVKTTLRKGELEDGATIREKCPQ---CGHDEMQYHTLQLRSADEGATVFYTCTSCGY 119

Query: 106 RWK 108
           R++
Sbjct: 120 RFR 122

>Sklu_2119.4 YJR063W, Contig c2119 5697-6074 reverse complement
          Length = 125

 Score = 45.1 bits (105), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 52/127 (40%), Gaps = 31/127 (24%)

Query: 2   LSFCPSCNNML----LITSGDSGVYTLACRSCPYEFPIEGIEIYDRKKLPRKEVDDVLGG 57
           L FC  C N+L     ++S D     + C  C   +P      +   K+     DD    
Sbjct: 7   LIFCLDCGNLLDNPSTVSSPD-----IECSQCQATYPKSK---FSNLKVVTSTADDAFPS 58

Query: 58  GW-------------DNVDQ---TKTQCPNYDTCGGESAYFFQLQIRSADEPMTTFYKCV 101
                          D +D+    K +CP    CG +   +  LQ+RSADE  T FY C 
Sbjct: 59  TLRSKKSVVKTSLKKDELDEGATIKEKCPQ---CGNDEMRYHTLQLRSADEGATVFYTCT 115

Query: 102 NCGHRWK 108
           +CG+R++
Sbjct: 116 SCGYRFR 122

>Kwal_27.9972
          Length = 125

 Score = 44.7 bits (104), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 28/43 (65%), Gaps = 3/43 (6%)

Query: 66  KTQCPNYDTCGGESAYFFQLQIRSADEPMTTFYKCVNCGHRWK 108
           + +CP    CG +  ++  LQ+RSADE  T FY C +CG+R++
Sbjct: 83  REKCPQ---CGNDEMHYHTLQLRSADEGATVFYTCTSCGYRFR 122

>Scas_673.30*
          Length = 148

 Score = 45.1 bits (105), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 32/125 (25%), Positives = 52/125 (41%), Gaps = 24/125 (19%)

Query: 2   LSFCPSCNNMLLI--TSGDSGVYTLACRSCPYEFPIEGIEIYDRKKLPRKEVDDVLGGGW 59
           L FC  C N+L     +G S    + C  C  ++P      +   K+     +D      
Sbjct: 27  LIFCLDCGNLLDTPHQTGSSKHDDIECSQCQAKYPKSE---FSNLKVVTATAEDAFPSAL 83

Query: 60  -------------DNVDQ---TKTQCPNYDTCGGESAYFFQLQIRSADEPMTTFYKCVNC 103
                        D +++    K +CP    CG +  ++  LQ+RSADE  T FY C  C
Sbjct: 84  RSKKSVVKTTLKKDELEEGAVIKEKCPQ---CGNDEMHYHTLQLRSADEGATVFYTCTKC 140

Query: 104 GHRWK 108
           G++++
Sbjct: 141 GYKFR 145

>YJR063W (RPA12) [2957] chr10 (555109..555486) RNA polymerase I
           subunit A12.2 [378 bp, 125 aa]
          Length = 125

 Score = 43.9 bits (102), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 27/43 (62%), Gaps = 3/43 (6%)

Query: 66  KTQCPNYDTCGGESAYFFQLQIRSADEPMTTFYKCVNCGHRWK 108
           K +CP    CG E   +  LQ+RSADE  T FY C +CG++++
Sbjct: 83  KEKCPQ---CGNEEMNYHTLQLRSADEGATVFYTCTSCGYKFR 122

>Kwal_56.24054
          Length = 122

 Score = 41.2 bits (95), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 43/110 (39%), Gaps = 11/110 (10%)

Query: 2   LSFCPSCNNMLL-ITSGDSGVYTLACRSCPYEFPIEGIEIYDRKKLPRKEVDDVLG---- 56
             FC  CNNML      D+      CR+C Y        +Y  + +    + +  G    
Sbjct: 4   FRFCRDCNNMLYPREDKDNQRLLFECRTCTYAEEAGTPMVYRHELI--TNIGETAGVVQD 61

Query: 57  -GGWDNVDQTKTQCPNYDTCGGESAYFFQLQIRSADEPMTTFYKCVNCGH 105
            G    + ++  +CP    C      FFQ Q R +D  M  F+ C+ C H
Sbjct: 62  IGSDPTLPRSDRECPK---CHSHENVFFQSQQRRSDTSMVLFFVCLGCSH 108

>KLLA0B13860g 1215461..1215943 some similarities with sp|P32529
           Saccharomyces cerevisiae YJR063w RPA12 DNA-directed RNA
           polymerase I, 13. 7 KD subunit singleton, hypothetical
           start
          Length = 160

 Score = 41.2 bits (95), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 25/41 (60%), Gaps = 3/41 (7%)

Query: 68  QCPNYDTCGGESAYFFQLQIRSADEPMTTFYKCVNCGHRWK 108
           +CP    C  +  ++  LQ+RSADE  T FY C  CG+R++
Sbjct: 120 KCPK---CANDKMHYHTLQLRSADEGATVFYTCTACGYRFR 157

>CAGL0F00561g complement(58585..58971) highly similar to sp|P32529
           Saccharomyces cerevisiae YJR063w RPA12 DNA-directed RNA
           polymerase I, start by similarity
          Length = 128

 Score = 40.8 bits (94), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 26/43 (60%), Gaps = 3/43 (6%)

Query: 66  KTQCPNYDTCGGESAYFFQLQIRSADEPMTTFYKCVNCGHRWK 108
           K +CP    CG +   +  LQ+RSADE  T FY C+ C ++++
Sbjct: 86  KEKCPK---CGHDEMRYQTLQLRSADEGATVFYTCIKCNYKYR 125

>Scas_720.22*
          Length = 122

 Score = 40.0 bits (92), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 42/110 (38%), Gaps = 11/110 (10%)

Query: 2   LSFCPSCNNMLL-ITSGDSGVYTLACRSCPYEFPIEGIEIYDRKKLPRKEVDDVLG---- 56
             FC  CNNML      ++      CR+C Y        +Y  + +    + +  G    
Sbjct: 4   FRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGAPLVYRHELI--TNIGETAGVVQD 61

Query: 57  -GGWDNVDQTKTQCPNYDTCGGESAYFFQLQIRSADEPMTTFYKCVNCGH 105
            G    + ++  +CP    C      FFQ Q R  D  M  F+ C+ C H
Sbjct: 62  IGSDPTLPRSDRECPR---CHARDNVFFQSQQRRKDTSMVLFFVCLQCSH 108

>YGL070C (RPB9) [1910] chr7 complement(374460..374828) RNA
           polymerase II, non-essential subunit, involved in
           transcription start site selection [369 bp, 122 aa]
          Length = 122

 Score = 39.7 bits (91), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 43/110 (39%), Gaps = 11/110 (10%)

Query: 2   LSFCPSCNNMLL-ITSGDSGVYTLACRSCPYEFPIEGIEIYDRKKLPRKEVDDVLG---- 56
             FC  CNNML      ++      CR+C Y        +Y  + +    + +  G    
Sbjct: 4   FRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELI--TNIGETAGVVQD 61

Query: 57  -GGWDNVDQTKTQCPNYDTCGGESAYFFQLQIRSADEPMTTFYKCVNCGH 105
            G    + ++  +CP    C      FFQ Q R  D  M  F+ C++C H
Sbjct: 62  IGSDPTLPRSDRECPK---CHSRENVFFQSQQRRKDTSMVLFFVCLSCSH 108

>CAGL0H03509g complement(326276..326644) highly similar to sp|P27999
           Saccharomyces cerevisiae YGL070c RPB9, start by
           similarity
          Length = 122

 Score = 39.3 bits (90), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 43/114 (37%), Gaps = 19/114 (16%)

Query: 2   LSFCPSCNNMLL-ITSGDSGVYTLACRSCPYEFPIEGIEIYDRKKLPRKEVDDVLG---- 56
             FC  CNNML      ++      CR+C Y      IE      + R E+   +G    
Sbjct: 4   FRFCRDCNNMLYPREDKENNRLLFECRTCSY------IEEAGSPLVYRHELITNIGETAG 57

Query: 57  -----GGWDNVDQTKTQCPNYDTCGGESAYFFQLQIRSADEPMTTFYKCVNCGH 105
                G    + ++  +CP    C      FFQ Q R  D  M  F+ C+ C H
Sbjct: 58  VVQDIGSDPTLPRSDRECPK---CHSRENVFFQSQQRRKDTSMVLFFVCLACSH 108

>AFL088W [3105] [Homologous to ScYGL070C (RPB9) - SH]
           complement(276175..276543) [369 bp, 122 aa]
          Length = 122

 Score = 38.1 bits (87), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 41/110 (37%), Gaps = 11/110 (10%)

Query: 2   LSFCPSCNNMLLITSGDSGVYTL-ACRSCPYEFPIEGIEIYDRKKLPRKEVDDVLG---- 56
             FC  CNNML           L  CR+C Y        +Y  + +    + +  G    
Sbjct: 4   FRFCRDCNNMLYPREDKEEQRLLFECRTCTYAEEAGTPLVYRHELI--TNIGETAGVVQD 61

Query: 57  -GGWDNVDQTKTQCPNYDTCGGESAYFFQLQIRSADEPMTTFYKCVNCGH 105
            G    + ++  +CP    C      FFQ Q R  D  M  F+ C+ C H
Sbjct: 62  IGSDPTLPRSDRECPR---CHSHDNVFFQSQQRRRDTSMVLFFVCLGCSH 108

>Sklu_1830.3 YGL070C, Contig c1830 5480-5812 reverse complement
          Length = 110

 Score = 31.6 bits (70), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 24/55 (43%), Gaps = 5/55 (9%)

Query: 51  VDDVLGGGWDNVDQTKTQCPNYDTCGGESAYFFQLQIRSADEPMTTFYKCVNCGH 105
           V D+  G    + ++  +CP    C      FFQ Q R  D  M  F+ C+ C H
Sbjct: 47  VQDI--GSDPTLPRSDRECPK---CHSHENVFFQSQQRRKDTSMVLFFVCLACSH 96

>AFR518C [3710] [Homologous to NOHBY] (1364371..1365681) [1311 bp,
           436 aa]
          Length = 436

 Score = 28.1 bits (61), Expect = 1.5,   Method: Composition-based stats.
 Identities = 17/73 (23%), Positives = 32/73 (43%), Gaps = 3/73 (4%)

Query: 38  IEIYDRKKLPRKEVDDVLGGGWDNVDQTKTQCPNYDT---CGGESAYFFQLQIRSADEPM 94
           IEI  R++L  +E+++  G  W N D+  ++  N      C  E      L+++   E +
Sbjct: 345 IEIASRRRLTIRELENSYGSSWRNADKNFSRQINRRKKIWCAIEQGLLDGLELKECFEIL 404

Query: 95  TTFYKCVNCGHRW 107
             + +    G  W
Sbjct: 405 ENYVRDRGKGLSW 417

>Scas_544.7d
          Length = 173

 Score = 26.9 bits (58), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 31/79 (39%), Gaps = 21/79 (26%)

Query: 5   CPSCNN---MLLITSGDSGVYTLACRSCPYEFPIEGIEIYDRKKLPR-----KEVDDV-- 54
           CP+C     +LL  S     Y   C+ C Y++    + + D + + +      E  +V  
Sbjct: 61  CPNCETALTVLLAKSSRKKRYKFTCKHCDYDYVTPSMSVTDERSISQIVDHLNETLNVEY 120

Query: 55  -----------LGGGWDNV 62
                      LGGG DNV
Sbjct: 121 LRFQELKKNIELGGGIDNV 139

>ABL041W [551] [Homologous to ScYMR089C (YTA12) - SH]
           complement(318701..321157) [2457 bp, 818 aa]
          Length = 818

 Score = 26.9 bits (58), Expect = 4.3,   Method: Composition-based stats.
 Identities = 15/50 (30%), Positives = 27/50 (54%), Gaps = 3/50 (6%)

Query: 7   SCNNMLLITSGDSGVYTLACRSCPYEFPIEGIEIYDRKKLPRKEVDDVLG 56
           S +N++ +   ++G++ L  R   Y F I  +E ++RK    +E  D LG
Sbjct: 214 SRSNVVKVVLNENGMHQLQNRDTSYYFTIGSVENFERK---LREAQDELG 260

>Kwal_23.4623
          Length = 287

 Score = 26.6 bits (57), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 22/39 (56%), Gaps = 1/39 (2%)

Query: 57 GGWDNVDQTKTQCPNYDTCGGESAYFFQLQIRSADEPMT 95
          GG++N   T T+  NYD CG E+    +   RSA +P +
Sbjct: 47 GGFNNAPAT-TRWFNYDWCGVENGALQECSSRSAAKPFS 84

>KLLA0E07348g
          join(complement(668822..668828),
          complement(667907..668721)) similar to sp|P26754
          Saccharomyces cerevisiae YNL312w RFA2 DNA replication
          factor A, 36 kDa subunit singleton, start by similarity
          Length = 273

 Score = 26.6 bits (57), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 12/34 (35%), Positives = 20/34 (58%), Gaps = 3/34 (8%)

Query: 47 PRKEVDDVLGGGWDNVDQTKTQCPNYDTCGGESA 80
          P  E  ++  GG+DN D +++  PN    GG++A
Sbjct: 6  PYNEYSNINAGGFDNSDPSQSSRPN---SGGQNA 36

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.321    0.139    0.467 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 3,767,103
Number of extensions: 145913
Number of successful extensions: 305
Number of sequences better than 10.0: 34
Number of HSP's gapped: 296
Number of HSP's successfully gapped: 34
Length of query: 109
Length of database: 16,596,109
Length adjustment: 79
Effective length of query: 30
Effective length of database: 13,861,287
Effective search space: 415838610
Effective search space used: 415838610
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 54 (25.4 bits)