Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YDR044W (HEM13)32832317490.0
CAGL0K12100g32732314820.0
Scas_569.333332314820.0
Sklu_2357.834132314790.0
Kwal_27.1093534432314770.0
KLLA0F18546g37531414150.0
AGR030C32431212521e-174
KLLA0E11275g38572840.015
CAGL0K12628g132663653.8
KLLA0F05819g67657637.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YDR044W
         (323 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YDR044W (HEM13) [897] chr4 (546638..547624) Coproporphyrinogen I...   678   0.0  
CAGL0K12100g 1183383..1184366 highly similar to sp|P11353 Saccha...   575   0.0  
Scas_569.3                                                            575   0.0  
Sklu_2357.8 YDR044W, Contig c2357 11533-12558                         574   0.0  
Kwal_27.10935                                                         573   0.0  
KLLA0F18546g 1706744..1707871 gi|26185795|emb|CAD58624.1 Kluyver...   549   0.0  
AGR030C [4340] [Homologous to ScYDR044W (HEM13) - SH] (768609..7...   486   e-174
KLLA0E11275g complement(993416..994573) similar to ca|CA5508|IPF...    37   0.015
CAGL0K12628g complement(1246048..1250028) similar to sp|P13433 S...    30   3.8  
KLLA0F05819g 562259..564289 weakly similar to sgd|S0002335 Sacch...    29   7.0  

>YDR044W (HEM13) [897] chr4 (546638..547624) Coproporphyrinogen III
           oxidase, catalyzes the oxidative decarboxylation of
           coproporphyrinogen III to proto-porhyrinogen IX, the
           sixth step in heme biosynthetic pathway, repressed by
           oxygen [987 bp, 328 aa]
          Length = 328

 Score =  678 bits (1749), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/323 (100%), Positives = 323/323 (100%)

Query: 1   MPAPQDPRNLPIRQQMEALIRRKQAEITQGLESIDTVKFHADTWTRGNDGGGGTSMVIQD 60
           MPAPQDPRNLPIRQQMEALIRRKQAEITQGLESIDTVKFHADTWTRGNDGGGGTSMVIQD
Sbjct: 1   MPAPQDPRNLPIRQQMEALIRRKQAEITQGLESIDTVKFHADTWTRGNDGGGGTSMVIQD 60

Query: 61  GTTFEKGGVNVSVVYGQLSPAAVSAMKADHKNLRLPEDPKTGLPVTDGVKFFACGLSMVI 120
           GTTFEKGGVNVSVVYGQLSPAAVSAMKADHKNLRLPEDPKTGLPVTDGVKFFACGLSMVI
Sbjct: 61  GTTFEKGGVNVSVVYGQLSPAAVSAMKADHKNLRLPEDPKTGLPVTDGVKFFACGLSMVI 120

Query: 121 HPVNPHAPTTHLNYRYFETWNQDGTPQTWWFGGGADLTPSYLYEEDGQLFHQLHKDALDK 180
           HPVNPHAPTTHLNYRYFETWNQDGTPQTWWFGGGADLTPSYLYEEDGQLFHQLHKDALDK
Sbjct: 121 HPVNPHAPTTHLNYRYFETWNQDGTPQTWWFGGGADLTPSYLYEEDGQLFHQLHKDALDK 180

Query: 181 HDTALYPRFKKWCDEYFYITHRKETRGIGGIFFDDYDERDPQEILKMVEDCFDAFLPSYL 240
           HDTALYPRFKKWCDEYFYITHRKETRGIGGIFFDDYDERDPQEILKMVEDCFDAFLPSYL
Sbjct: 181 HDTALYPRFKKWCDEYFYITHRKETRGIGGIFFDDYDERDPQEILKMVEDCFDAFLPSYL 240

Query: 241 TIVKRRKDMPYTKEEQQWQAIRRGRYVEFNLIYDRGTQFGLRTPGSRVESILMSLPEHAS 300
           TIVKRRKDMPYTKEEQQWQAIRRGRYVEFNLIYDRGTQFGLRTPGSRVESILMSLPEHAS
Sbjct: 241 TIVKRRKDMPYTKEEQQWQAIRRGRYVEFNLIYDRGTQFGLRTPGSRVESILMSLPEHAS 300

Query: 301 WLYNHHPAPGSREAKLLEVTTKP 323
           WLYNHHPAPGSREAKLLEVTTKP
Sbjct: 301 WLYNHHPAPGSREAKLLEVTTKP 323

>CAGL0K12100g 1183383..1184366 highly similar to sp|P11353
           Saccharomyces cerevisiae YDR044w HEM13
           coproporphyrinogen III oxidase, start by similarity
          Length = 327

 Score =  575 bits (1482), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/323 (83%), Positives = 295/323 (91%), Gaps = 1/323 (0%)

Query: 1   MPAPQDPRNLPIRQQMEALIRRKQAEITQGLESIDTVKFHADTWTRGNDGGGGTSMVIQD 60
           M APQDP++LPIRQQMEALIRRKQ EIT+GLESIDTVKF ADTW RGNDGGGGTSMVIQ+
Sbjct: 1   MTAPQDPKHLPIRQQMEALIRRKQKEITEGLESIDTVKFTADTWERGNDGGGGTSMVIQN 60

Query: 61  GTTFEKGGVNVSVVYGQLSPAAVSAMKADHKNLRLPEDPKTGLPVTDGVKFFACGLSMVI 120
           G+TFEKGGVNVSVVYG+L+P AV AMK +HK+L+LPE    GLP ++GVKFFACGLSMVI
Sbjct: 61  GSTFEKGGVNVSVVYGELTPGAVLAMKQEHKDLKLPES-ANGLPNSEGVKFFACGLSMVI 119

Query: 121 HPVNPHAPTTHLNYRYFETWNQDGTPQTWWFGGGADLTPSYLYEEDGQLFHQLHKDALDK 180
           HPVNP APTTHLNYRYFETWN DGTPQTWWFGGGADLTP YL+EED + FH+LHK ALDK
Sbjct: 120 HPVNPLAPTTHLNYRYFETWNPDGTPQTWWFGGGADLTPFYLFEEDAEHFHKLHKAALDK 179

Query: 181 HDTALYPRFKKWCDEYFYITHRKETRGIGGIFFDDYDERDPQEILKMVEDCFDAFLPSYL 240
           HDTALYPRFKKWCDEYFYI HR ETRGIGGIFFDDY+E+DPQEILK+ EDCFDAFLPSYL
Sbjct: 180 HDTALYPRFKKWCDEYFYIAHRGETRGIGGIFFDDYNEKDPQEILKICEDCFDAFLPSYL 239

Query: 241 TIVKRRKDMPYTKEEQQWQAIRRGRYVEFNLIYDRGTQFGLRTPGSRVESILMSLPEHAS 300
           TI+KRRKD+PY ++++ WQ IRRGRY EFNLIYDRGTQFGLRTPGSRVESILMSLP HAS
Sbjct: 240 TIMKRRKDLPYNEKQKNWQLIRRGRYAEFNLIYDRGTQFGLRTPGSRVESILMSLPLHAS 299

Query: 301 WLYNHHPAPGSREAKLLEVTTKP 323
           W+YNHHP PGS EAKLLEVTTKP
Sbjct: 300 WVYNHHPEPGSEEAKLLEVTTKP 322

>Scas_569.3
          Length = 333

 Score =  575 bits (1482), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/323 (86%), Positives = 302/323 (93%)

Query: 1   MPAPQDPRNLPIRQQMEALIRRKQAEITQGLESIDTVKFHADTWTRGNDGGGGTSMVIQD 60
           MPAPQD  +LPIRQQMEALIRRKQAEIT+GLES+DTVKFHAD+WTRGNDGGGGTSMVI +
Sbjct: 7   MPAPQDKTHLPIRQQMEALIRRKQAEITKGLESLDTVKFHADSWTRGNDGGGGTSMVIAN 66

Query: 61  GTTFEKGGVNVSVVYGQLSPAAVSAMKADHKNLRLPEDPKTGLPVTDGVKFFACGLSMVI 120
           G+TFEKGGVNVSVVYG L+P AV AMK DHKNL+LP+DPKTGLPV DGVKFFACGLSMVI
Sbjct: 67  GSTFEKGGVNVSVVYGNLTPTAVLAMKDDHKNLKLPKDPKTGLPVPDGVKFFACGLSMVI 126

Query: 121 HPVNPHAPTTHLNYRYFETWNQDGTPQTWWFGGGADLTPSYLYEEDGQLFHQLHKDALDK 180
           HP NPHAPTTHLNYRYFETWN DGTPQ+WWFGGGADLTP YLYEED + FH+LHK ALDK
Sbjct: 127 HPKNPHAPTTHLNYRYFETWNPDGTPQSWWFGGGADLTPFYLYEEDAKHFHELHKKALDK 186

Query: 181 HDTALYPRFKKWCDEYFYITHRKETRGIGGIFFDDYDERDPQEILKMVEDCFDAFLPSYL 240
           HD  LYP++KKWCDEYFYI HRKETRGIGGIFFDD+D+RDPQEILK+ EDCFDAFLPSYL
Sbjct: 187 HDKTLYPKYKKWCDEYFYIAHRKETRGIGGIFFDDFDDRDPQEILKICEDCFDAFLPSYL 246

Query: 241 TIVKRRKDMPYTKEEQQWQAIRRGRYVEFNLIYDRGTQFGLRTPGSRVESILMSLPEHAS 300
            I+++RKDMPYT+EE+QWQ IRRGRYVEFNLIYDRGTQFGLRTPGSRVESILMSLPEHAS
Sbjct: 247 PIIEKRKDMPYTEEEKQWQLIRRGRYVEFNLIYDRGTQFGLRTPGSRVESILMSLPEHAS 306

Query: 301 WLYNHHPAPGSREAKLLEVTTKP 323
           WLYNHHPAPGSREAKLLEVTT P
Sbjct: 307 WLYNHHPAPGSREAKLLEVTTNP 329

>Sklu_2357.8 YDR044W, Contig c2357 11533-12558
          Length = 341

 Score =  574 bits (1479), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/323 (82%), Positives = 291/323 (90%)

Query: 1   MPAPQDPRNLPIRQQMEALIRRKQAEITQGLESIDTVKFHADTWTRGNDGGGGTSMVIQD 60
           MPAPQDP++LPIRQQME LI RKQ EIT+GLE++DTVKF AD+WTRGNDGGGGTSMV+Q+
Sbjct: 15  MPAPQDPKHLPIRQQMEQLILRKQKEITKGLETLDTVKFRADSWTRGNDGGGGTSMVLQN 74

Query: 61  GTTFEKGGVNVSVVYGQLSPAAVSAMKADHKNLRLPEDPKTGLPVTDGVKFFACGLSMVI 120
           GTTFEKGGVN SVVYGQLSP A+SAM+ DHKNL LP DP+TG P  DGV FFACGLSMVI
Sbjct: 75  GTTFEKGGVNTSVVYGQLSPKAISAMRQDHKNLHLPVDPQTGEPNADGVNFFACGLSMVI 134

Query: 121 HPVNPHAPTTHLNYRYFETWNQDGTPQTWWFGGGADLTPSYLYEEDGQLFHQLHKDALDK 180
           HP NPHAPTTHLNYRYFETWN DG+PQ WWFGGGADLTPSYLYEED  LFH+LHK+ALDK
Sbjct: 135 HPHNPHAPTTHLNYRYFETWNPDGSPQAWWFGGGADLTPSYLYEEDAILFHKLHKEALDK 194

Query: 181 HDTALYPRFKKWCDEYFYITHRKETRGIGGIFFDDYDERDPQEILKMVEDCFDAFLPSYL 240
           HDT LYPRFKKWCDEYF+I HR ETRGIGGIFFDD D+RDPQEILK+VEDCFDAFLPSYL
Sbjct: 195 HDTDLYPRFKKWCDEYFFINHRGETRGIGGIFFDDLDDRDPQEILKLVEDCFDAFLPSYL 254

Query: 241 TIVKRRKDMPYTKEEQQWQAIRRGRYVEFNLIYDRGTQFGLRTPGSRVESILMSLPEHAS 300
           TIV RRKDMPYT+EE+QWQ++RRGRYVEFNL+ DRGTQFGLRTPGSRVESILMSLP  AS
Sbjct: 255 TIVARRKDMPYTEEEKQWQSLRRGRYVEFNLVLDRGTQFGLRTPGSRVESILMSLPVTAS 314

Query: 301 WLYNHHPAPGSREAKLLEVTTKP 323
           WLY+HHP  GSRE +LLEV   P
Sbjct: 315 WLYDHHPDAGSREDQLLEVLKHP 337

>Kwal_27.10935
          Length = 344

 Score =  573 bits (1477), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/323 (82%), Positives = 289/323 (89%)

Query: 1   MPAPQDPRNLPIRQQMEALIRRKQAEITQGLESIDTVKFHADTWTRGNDGGGGTSMVIQD 60
           MPAP DP  +PIRQQME LIRRKQ EITQGLE++DTVKF  D+WTRGNDGGGGTSMV+Q+
Sbjct: 18  MPAPVDPTRMPIRQQMEELIRRKQREITQGLETLDTVKFRPDSWTRGNDGGGGTSMVLQN 77

Query: 61  GTTFEKGGVNVSVVYGQLSPAAVSAMKADHKNLRLPEDPKTGLPVTDGVKFFACGLSMVI 120
           GTTFEKGGVNVSVVYGQLSPAA+SAMK DHKNL+LP DP+TGLP  DGVKFFACGLSMVI
Sbjct: 78  GTTFEKGGVNVSVVYGQLSPAAISAMKHDHKNLKLPTDPETGLPNADGVKFFACGLSMVI 137

Query: 121 HPVNPHAPTTHLNYRYFETWNQDGTPQTWWFGGGADLTPSYLYEEDGQLFHQLHKDALDK 180
           HP NPHAPTTHLNYRYFETWN DGTPQTWWFGGGADLTPSYLYEED +LFHQ HK ALDK
Sbjct: 138 HPSNPHAPTTHLNYRYFETWNPDGTPQTWWFGGGADLTPSYLYEEDARLFHQEHKKALDK 197

Query: 181 HDTALYPRFKKWCDEYFYITHRKETRGIGGIFFDDYDERDPQEILKMVEDCFDAFLPSYL 240
           HDT+LYPR+KKWCDEYF+I HR ETRGIGGIFFDD D+RDPQEIL ++EDCFDAFLPSYL
Sbjct: 198 HDTSLYPRYKKWCDEYFFIKHRNETRGIGGIFFDDKDDRDPQEILSLIEDCFDAFLPSYL 257

Query: 241 TIVKRRKDMPYTKEEQQWQAIRRGRYVEFNLIYDRGTQFGLRTPGSRVESILMSLPEHAS 300
            I+ RRKDMP+T+EE+QWQ IRRGRYVEFNL+ DRGTQFGLRTPGSR ESILMSLP  A 
Sbjct: 258 PIIARRKDMPFTEEEKQWQLIRRGRYVEFNLVLDRGTQFGLRTPGSRTESILMSLPVTAC 317

Query: 301 WLYNHHPAPGSREAKLLEVTTKP 323
           W Y+HHP PGSRE KLL+V   P
Sbjct: 318 WFYDHHPEPGSREEKLLKVLESP 340

>KLLA0F18546g 1706744..1707871 gi|26185795|emb|CAD58624.1
           Kluyveromyces lactis putative coproporphyrinogen
           oxidase, start by similarity
          Length = 375

 Score =  549 bits (1415), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 253/314 (80%), Positives = 280/314 (89%)

Query: 10  LPIRQQMEALIRRKQAEITQGLESIDTVKFHADTWTRGNDGGGGTSMVIQDGTTFEKGGV 69
           +PIR++MEAL+RRKQ EIT+GLE++DTVKF AD+W RGN+GGGG SMV+Q+GTTFEKGGV
Sbjct: 58  VPIRERMEALVRRKQQEITKGLETLDTVKFQADSWDRGNNGGGGVSMVLQNGTTFEKGGV 117

Query: 70  NVSVVYGQLSPAAVSAMKADHKNLRLPEDPKTGLPVTDGVKFFACGLSMVIHPVNPHAPT 129
           NVSVV+G LSP A+ AMKADHKNL LP DP TG P   GVKFFACGLSMVIHP+NPHAPT
Sbjct: 118 NVSVVHGNLSPPAIKAMKADHKNLHLPIDPATGEPDATGVKFFACGLSMVIHPINPHAPT 177

Query: 130 THLNYRYFETWNQDGTPQTWWFGGGADLTPSYLYEEDGQLFHQLHKDALDKHDTALYPRF 189
           THLNYRYFETWN DGTPQ WWFGGGADLTPSYLYEED +LFHQLHKDALDK D ALYP++
Sbjct: 178 THLNYRYFETWNADGTPQAWWFGGGADLTPSYLYEEDAKLFHQLHKDALDKTDVALYPKY 237

Query: 190 KKWCDEYFYITHRKETRGIGGIFFDDYDERDPQEILKMVEDCFDAFLPSYLTIVKRRKDM 249
           KKWCDEYFYI HR+ETRGIGGIFFDD D+RDP EIL+MVE+CFDAFLPSYL I+KRRKDM
Sbjct: 238 KKWCDEYFYIKHREETRGIGGIFFDDVDDRDPNEILQMVENCFDAFLPSYLEIIKRRKDM 297

Query: 250 PYTKEEQQWQAIRRGRYVEFNLIYDRGTQFGLRTPGSRVESILMSLPEHASWLYNHHPAP 309
           PYT+EE+QWQ IRRGRYVEFNL+ DRGTQFGLRTPGSRVESILMSLP  ASWLY+HHP  
Sbjct: 298 PYTEEERQWQQIRRGRYVEFNLVLDRGTQFGLRTPGSRVESILMSLPVTASWLYDHHPEV 357

Query: 310 GSREAKLLEVTTKP 323
            SRE KLL+V   P
Sbjct: 358 DSREDKLLQVLKNP 371

>AGR030C [4340] [Homologous to ScYDR044W (HEM13) - SH]
           (768609..769583) [975 bp, 324 aa]
          Length = 324

 Score =  486 bits (1252), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 226/312 (72%), Positives = 261/312 (83%), Gaps = 2/312 (0%)

Query: 12  IRQQMEALIRRKQAEITQGLESIDTVKFHADTWTRGNDGGGGTSMVIQDGTTFEKGGVNV 71
           +R++ME L+RRKQ EIT   E+IDTVKF AD+W R  +GGGGTS V+Q GTTFEK GVNV
Sbjct: 9   MRERMEELVRRKQREITAAFEAIDTVKFKADSWER-KEGGGGTSCVLQHGTTFEKAGVNV 67

Query: 72  SVVYGQLSPAAVSAMKADHKNLRLPEDPKTGLPVTDGVKFFACGLSMVIHPVNPHAPTTH 131
           SVV+G+LSPAAVSAM+A+HKNL LP DP TG P   GV+FFACG+S+V+HPVNPHAPT H
Sbjct: 68  SVVHGELSPAAVSAMRAEHKNLHLPTDPVTGQPAA-GVRFFACGISLVMHPVNPHAPTVH 126

Query: 132 LNYRYFETWNQDGTPQTWWFGGGADLTPSYLYEEDGQLFHQLHKDALDKHDTALYPRFKK 191
           LNYRYFETW+  G PQTWWFGGG+DLTPSYLYEED +LFH  HK ALD+ D ALYPRFKK
Sbjct: 127 LNYRYFETWDAAGKPQTWWFGGGSDLTPSYLYEEDARLFHAAHKAALDRTDPALYPRFKK 186

Query: 192 WCDEYFYITHRKETRGIGGIFFDDYDERDPQEILKMVEDCFDAFLPSYLTIVKRRKDMPY 251
           WCDEYF+I HR E+RGIGGIF+DD D+R+P+ +L+M EDC DAF+P+Y TI+ RRKDMPY
Sbjct: 187 WCDEYFWIKHRGESRGIGGIFYDDADDREPETLLRMAEDCLDAFVPAYKTIMLRRKDMPY 246

Query: 252 TKEEQQWQAIRRGRYVEFNLIYDRGTQFGLRTPGSRVESILMSLPEHASWLYNHHPAPGS 311
           T  E +WQ IRRGRYVEFNL+ DRGTQFGLRTPGSRVESILMSLP  A W Y+HHPA G+
Sbjct: 247 TAAEHEWQQIRRGRYVEFNLVLDRGTQFGLRTPGSRVESILMSLPVTARWEYDHHPAEGT 306

Query: 312 REAKLLEVTTKP 323
           REA LLEV   P
Sbjct: 307 REAALLEVLRHP 318

>KLLA0E11275g complement(993416..994573) similar to ca|CA5508|IPF745
           Candida albicans unknown function, start by similarity
          Length = 385

 Score = 37.0 bits (84), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 36/72 (50%), Gaps = 7/72 (9%)

Query: 177 ALDKHDTALYPRFKKWCDEYFYITHRKETRGIGGIFFDDYDERDPQEILKMVEDCFDAFL 236
           ALD+ DT++        +  +Y+T    T     I F ++++ DP++ L +V      FL
Sbjct: 256 ALDQFDTSI-------VNPLYYVTFTTATLTASFILFKNFEDSDPKDSLSLVCGFVIIFL 308

Query: 237 PSYLTIVKRRKD 248
             YL  + R+K+
Sbjct: 309 GVYLLNLSRKKN 320

>CAGL0K12628g complement(1246048..1250028) similar to sp|P13433
            Saccharomyces cerevisiae YFL036w RPO41 DNA-directed RNA
            polymerase, start by similarity
          Length = 1326

 Score = 29.6 bits (65), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 15/63 (23%), Positives = 33/63 (52%)

Query: 198  YITHRKETRGIGGIFFDDYDERDPQEILKMVEDCFDAFLPSYLTIVKRRKDMPYTKEEQQ 257
            Y TH  +   +  +  D + E    ++++ +++ FD    +YL I+K +K+ P  K+   
Sbjct: 1167 YWTHASDVDKMNVVIRDKFIELHEVDLIQRLKEEFDERYKNYLRILKIKKNTPLAKQILA 1226

Query: 258  WQA 260
            ++A
Sbjct: 1227 FKA 1229

>KLLA0F05819g 562259..564289 weakly similar to sgd|S0002335
           Saccharomyces cerevisiae YDL176w hypothetical protein,
           start by similarity
          Length = 676

 Score = 28.9 bits (63), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 26/57 (45%), Gaps = 9/57 (15%)

Query: 173 LHKDALDKHDTALYPRFKKWCDEYFYITHRK---------ETRGIGGIFFDDYDERD 220
           +HK  L +  T  +  F K  DEYF   HR+          +R + G  F +Y +RD
Sbjct: 273 IHKILLPEVYTTFFSEFVKLKDEYFSKKHRRVSEPSSFDFMSRAVHGTAFQEYLKRD 329

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.137    0.435 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 11,830,925
Number of extensions: 548135
Number of successful extensions: 1115
Number of sequences better than 10.0: 12
Number of HSP's gapped: 1112
Number of HSP's successfully gapped: 12
Length of query: 323
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 221
Effective length of database: 13,065,073
Effective search space: 2887381133
Effective search space used: 2887381133
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 61 (28.1 bits)