Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YDR043C (NRG1)23122811741e-166
YBR066C (NRG2)2201893481e-40
Scas_718.442662503223e-36
Sklu_2357.7157613134e-36
CAGL0K12078g463763193e-34
Kwal_27.10925264613083e-34
Scas_569.2293643017e-33
AGR031W140612802e-31
KLLA0F18524g357612882e-30
CAGL0L07480g314652852e-30
Sklu_2351.6548851805e-15
Kwal_14.2278463581778e-15
KLLA0E10989g474631725e-14
AFR471C389551662e-13
YGL035C (MIG1)504581653e-13
CAGL0A01628g424551645e-13
Kwal_47.19045266561572e-12
YER028C394581592e-12
CAGL0M01870g315561563e-12
Scas_575.3455691565e-12
Scas_712.42*290551511e-11
CAGL0C02519g318571503e-11
KLLA0B00605g239571465e-11
CAGL0K09372g396571485e-11
AGR117C799951487e-11
YGL209W (MIG2)382551461e-10
Scas_687.33288571441e-10
YER169W (RPH1)796751452e-10
Kwal_26.83516981661442e-10
KLLA0C17710g821681425e-10
Kwal_27.10467302611395e-10
CAGL0L11880g980501382e-09
Scas_718.36d330611362e-09
AGL207W277571343e-09
Scas_681.19864551363e-09
YDR096W (GIS1)894521354e-09
Scas_709.32822611335e-09
Kwal_56.23453828551337e-09
KLLA0A04609g4231131301e-08
Sklu_2398.2288951272e-08
KLLA0B07909g922581292e-08
KLLA0F11682g374561282e-08
YKL062W (MSN4)630861282e-08
CAGL0E04884g1489511283e-08
Scas_683.25879551283e-08
YOR113W (AZF1)914571273e-08
Scas_710.95051141264e-08
Kwal_47.166211178511266e-08
CAGL0H04213g1321591257e-08
YML081W1251541257e-08
ABR089C5711001249e-08
KLLA0F13046g1379511231e-07
AFR580C838581231e-07
KLLA0B04477g1332511231e-07
Scas_721.921152511221e-07
Sklu_2181.1410601212e-07
Sklu_2443.22213511182e-07
Scas_602.9547591212e-07
AER159C1191541212e-07
Scas_697.35839571212e-07
Scas_717.18354731193e-07
Scas_649.28730611203e-07
Scas_717.17525671203e-07
Kwal_47.17241403601193e-07
YMR037C (MSN2)704601194e-07
Scas_703.231341541185e-07
YNL027W (CRZ1)678611186e-07
ACL057W520781176e-07
AGR172W1057511177e-07
Kwal_26.8011190541129e-07
Kwal_47.17888786551161e-06
KLLA0F23782g782551151e-06
CAGL0K02145g317561131e-06
KLLA0F26961g694611132e-06
YPL230W391441122e-06
CAGL0L06072g300601112e-06
ACR264W769551133e-06
CAGL0M00594g1020561133e-06
CAGL0F05995g597581113e-06
CAGL0M13189g541561114e-06
YJR127C (ZMS1)1380541114e-06
KLLA0E08679g596821114e-06
Scas_707.46338701104e-06
Sklu_2436.9517841105e-06
CAGL0M06831g645621106e-06
KLLA0F01463g781561106e-06
YDR216W (ADR1)13231011097e-06
KLLA0C17072g474601088e-06
Kwal_27.11460531621089e-06
Scas_717.17d350651061e-05
Scas_695.2571601071e-05
CAGL0L03916g642551062e-05
CAGL0L05786g348661052e-05
Scas_711.56832751062e-05
YGR067C794551062e-05
ADR308C278551023e-05
ADL198W547801033e-05
Kwal_14.2543711731043e-05
ADL042W281521024e-05
YER130C443561024e-05
Kwal_14.2206254531014e-05
CAGL0G08107g625541025e-05
Scas_720.33316601016e-05
Scas_707.31289561007e-05
YPR013C317511008e-05
ADL051W17379961e-04
KLLA0F20636g28552971e-04
AEL077W33651981e-04
YMR182C (RGM1)21162961e-04
Scas_656.1*10266922e-04
YPR015C247100972e-04
YJL056C (ZAP1)88074972e-04
Kwal_47.1657788150973e-04
CAGL0H07557g47657963e-04
KLLA0F10109g62374963e-04
AFR461C544121963e-04
Sklu_2389.276748963e-04
Sklu_2244.327153944e-04
CAGL0E06116g61347955e-04
Scas_719.68135059946e-04
Scas_378.120851926e-04
CAGL0K04631g101354946e-04
CAGL0E04312g68878937e-04
AFL136W40956928e-04
CAGL0J01595g34453910.001
YMR070W (MOT3)49054910.001
KLLA0B03454g47245910.001
Scas_641.2453285900.002
Scas_602.4d25651890.002
Scas_693.3163553900.002
AGL246W227104880.002
Kwal_23.540042958890.002
CAGL0J05060g71374890.002
CAGL0K03003g64749880.003
Kwal_47.1833753686880.003
ADL040W33051870.004
CAGL0G10021g39445870.004
YPR186C (PZF1)42945870.004
CAGL0L00583g38841860.004
AEL278W47645860.005
KLLA0A10373g20664840.005
Sklu_1527.120566840.006
KLLA0C16005g33147850.006
Scas_660.1236766850.007
YPL038W (MET31)177104830.007
Sklu_2154.319073830.008
Scas_627.6120769850.009
CAGL0I02816g29151830.009
YHR006W (STP2)541129840.010
Kwal_26.802150752840.010
Scas_602.426652820.012
KLLA0E18645g43156830.012
YDR463W (STP1)51966830.013
AEL174W66155830.013
Scas_712.232761820.016
AFR531W27461810.019
CAGL0M04323g70350810.023
CAGL0E01331g68978810.024
Scas_604.458540790.045
Kwal_34.1594627961780.046
AGL197W84490780.053
CAGL0K06413g35949770.057
YDR253C (MET32)19154760.059
ADL050W14651750.060
AGL071C39663770.063
Scas_631.743343770.066
YLR131C (ACE2)77055770.079
YDR146C (SWI5)70978760.11
Sklu_2289.129157740.13
Scas_713.5262048750.13
KLLA0D16456g85471750.15
KLLA0F07073g55827740.16
Kwal_27.1182419960710.25
Kwal_56.2392574548730.26
Scas_717.60d16758700.30
Kwal_26.930030467700.51
AGR186C28752690.55
Sklu_2359.572264700.62
CAGL0E03762g58449690.75
Scas_568.519954670.77
CAGL0H04873g45129680.80
YPR022C113395681.0
Scas_670.243561661.5
AFR588W31927651.9
Sklu_2206.235827652.0
CAGL0I02838g65537652.0
Kwal_55.2063441950652.0
CAGL0L12562g22374642.1
Kwal_27.1016728575642.2
YDL048C (STP4)49072652.2
Scas_646.7*54365652.3
Sklu_2169.3101965652.6
Sklu_2126.544840642.9
CAGL0K04697g515119643.0
CAGL0K04257g54745633.8
Sklu_1682.242658633.9
Scas_683.3047827625.5
Scas_636.14d27546616.3
Scas_627.17d27546607.9
YHL027W (RIM101)62541609.8
AFR190C43250609.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YDR043C
         (228 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YDR043C (NRG1) [896] chr4 complement(542670..543365) Transcripti...   456   e-166
YBR066C (NRG2) [256] chr2 complement(369998..370660) Suppressor ...   138   1e-40
Scas_718.44                                                           128   3e-36
Sklu_2357.7 YDR043C, Contig c2357 9816-10289 reverse complement       125   4e-36
CAGL0K12078g complement(1168989..1170380) weakly similar to sp|Q...   127   3e-34
Kwal_27.10925                                                         123   3e-34
Scas_569.2                                                            120   7e-33
AGR031W [4341] [Homologous to ScYDR043C (NRG1) - SH; ScYBR066C (...   112   2e-31
KLLA0F18524g complement(1701498..1702571) some similarities with...   115   2e-30
CAGL0L07480g complement(822240..823184) some similarities with s...   114   2e-30
Sklu_2351.6 YGL035C, Contig c2351 12964-14610 reverse complement       74   5e-15
Kwal_14.2278                                                           73   8e-15
KLLA0E10989g 966805..968229 gi|1709030|sp|P50898|MIG1_KLULA Kluy...    71   5e-14
AFR471C [3663] [Homologous to ScYGL035C (MIG1) - SH; ScYGL209W (...    69   2e-13
YGL035C (MIG1) [1940] chr7 complement(431551..433065) Zinc-finge...    68   3e-13
CAGL0A01628g 156635..157909 similar to sp|P27705 Saccharomyces c...    68   5e-13
Kwal_47.19045                                                          65   2e-12
YER028C (MIG3) [1453] chr5 complement(210691..211875) Protein th...    66   2e-12
CAGL0M01870g complement(219813..220760) some similarities with t...    65   3e-12
Scas_575.3                                                             65   5e-12
Scas_712.42*                                                           63   1e-11
CAGL0C02519g 253051..254007 weakly similar to sp|P39943 Saccharo...    62   3e-11
KLLA0B00605g complement(46736..47455) some similarities with sp|...    61   5e-11
CAGL0K09372g complement(924818..926008) similar to sp|P53035 Sac...    62   5e-11
AGR117C [4428] [Homologous to ScYER169W (RPH1) - SH; ScYDR096W (...    62   7e-11
YGL209W (MIG2) [1787] chr7 (95860..97008) Zinc-finger protein in...    61   1e-10
Scas_687.33                                                            60   1e-10
YER169W (RPH1) [1597] chr5 (523364..525754) DNA damage-responsiv...    60   2e-10
Kwal_26.8351                                                           60   2e-10
KLLA0C17710g 1569331..1571796 similar to sp|P39956 Saccharomyces...    59   5e-10
Kwal_27.10467                                                          58   5e-10
CAGL0L11880g 1272624..1275566 some similarities with sp|P39956 S...    58   2e-09
Scas_718.36d                                                           57   2e-09
AGL207W [4105] [Homologous to NOHBY] complement(310750..311583) ...    56   3e-09
Scas_681.19                                                            57   3e-09
YDR096W (GIS1) [946] chr4 (637133..639817) DNA damage-responsive...    57   4e-09
Scas_709.32                                                            56   5e-09
Kwal_56.23453                                                          56   7e-09
KLLA0A04609g complement(411494..412765) some similarities with s...    55   1e-08
Sklu_2398.2 , Contig c2398 2210-3076 reverse complement                54   2e-08
KLLA0B07909g 697885..700653 some similarities with sp|P53243 Sac...    54   2e-08
KLLA0F11682g complement(1068992..1070116) some similarities with...    54   2e-08
YKL062W (MSN4) [3197] chr11 (322873..324765) Zinc-finger transcr...    54   2e-08
CAGL0E04884g complement(469295..473764) weakly similar to sp|P07...    54   3e-08
Scas_683.25                                                            54   3e-08
YOR113W (AZF1) [4916] chr15 (534075..536819) Glucose-dependent t...    54   3e-08
Scas_710.9                                                             53   4e-08
Kwal_47.16621                                                          53   6e-08
CAGL0H04213g 398544..402509 similar to sp|Q04545 Saccharomyces c...    53   7e-08
YML081W (YML081W) [3888] chr13 (104777..108532) Protein with sim...    53   7e-08
ABR089C [680] [Homologous to ScYKL062W (MSN4) - SH; ScYMR037C (M...    52   9e-08
KLLA0F13046g 1201353..1205492 some similarities with sp|P07248 S...    52   1e-07
AFR580C [3772] [Homologous to ScYGR067C - SH] (1478059..1480575)...    52   1e-07
KLLA0B04477g 400019..404017 similar to sp|Q04545 Saccharomyces c...    52   1e-07
Scas_721.92                                                            52   1e-07
Sklu_2181.1 YER130C, Contig c2181 4015-5247                            51   2e-07
Sklu_2443.22 , Contig c2443 45390-46027                                50   2e-07
Scas_602.9                                                             51   2e-07
AER159C [2662] [Homologous to ScYML081W - SH; ScYJR127C (ZMS1) -...    51   2e-07
Scas_697.35                                                            51   2e-07
Scas_717.18                                                            50   3e-07
Scas_649.28                                                            51   3e-07
Scas_717.17                                                            51   3e-07
Kwal_47.17241                                                          50   3e-07
YMR037C (MSN2) [4001] chr13 complement(344402..346516) Zinc-fing...    50   4e-07
Scas_703.23                                                            50   5e-07
YNL027W (CRZ1) [4559] chr14 (579578..581614) Calcineurin-depende...    50   6e-07
ACL057W [992] [Homologous to ScYER130C - SH] complement(264934.....    50   6e-07
AGR172W [4483] [Homologous to ScYDR216W (ADR1) - SH] complement(...    50   7e-07
Kwal_26.8011                                                           48   9e-07
Kwal_47.17888                                                          49   1e-06
KLLA0F23782g 2219920..2222268 some similarities with sp|P41696 S...    49   1e-06
CAGL0K02145g 190055..191008 some similarities with sp|P39959 Sac...    48   1e-06
KLLA0F26961g 2486804..2488888 some similarities with sp|P33748 S...    48   2e-06
YPL230W (YPL230W) [5219] chr16 (115312..116487) Putative transcr...    48   2e-06
CAGL0L06072g complement(679924..680826) some similarities with s...    47   2e-06
ACR264W [1311] [Homologous to ScYOR113W (AZF1) - SH] complement(...    48   3e-06
CAGL0M00594g 70659..73721 similar to sp|P46974 Saccharomyces cer...    48   3e-06
CAGL0F05995g complement(598819..600612) some similarities with s...    47   3e-06
CAGL0M13189g complement(1294293..1295918) weakly similar to sp|P...    47   4e-06
YJR127C (ZMS1) [3019] chr10 complement(658832..662974) Protein w...    47   4e-06
KLLA0E08679g 777005..778795 some similarities with sp|P53968 Sac...    47   4e-06
Scas_707.46                                                            47   4e-06
Sklu_2436.9 YDR463W, Contig c2436 18516-20069                          47   5e-06
CAGL0M06831g 695162..697099 weakly similar to sp|P53968 Saccharo...    47   6e-06
KLLA0F01463g 140343..142688 some similarities with sp|P47043 Sac...    47   6e-06
YDR216W (ADR1) [1053] chr4 (895027..898998) Zinc-finger transcri...    47   7e-06
KLLA0C17072g 1494101..1495525 weakly similar to sp|P39959 Saccha...    46   8e-06
Kwal_27.11460                                                          46   9e-06
Scas_717.17d                                                           45   1e-05
Scas_695.2                                                             46   1e-05
CAGL0L03916g complement(448955..450883) weakly similar to sp|P41...    45   2e-05
CAGL0L05786g complement(636176..637222) some similarities with t...    45   2e-05
Scas_711.56                                                            45   2e-05
YGR067C (YGR067C) [2029] chr7 complement(622404..624788) Protein...    45   2e-05
ADR308C [2049] [Homologous to NOHBY] (1241869..1242705) [837 bp,...    44   3e-05
ADL198W [1543] [Homologous to ScYNL027W (CRZ1) - SH] complement(...    44   3e-05
Kwal_14.2543                                                           45   3e-05
ADL042W [1699] [Homologous to ScYPR015C - SH] complement(615818....    44   4e-05
YER130C (YER130C) [1560] chr5 complement(421111..422442) Protein...    44   4e-05
Kwal_14.2206                                                           44   4e-05
CAGL0G08107g 768772..770649 weakly similar to tr|Q03833 Saccharo...    44   5e-05
Scas_720.33                                                            44   6e-05
Scas_707.31                                                            43   7e-05
YPR013C (YPR013C) [5448] chr16 complement(584627..585580) Putati...    43   8e-05
ADL051W [1690] [Homologous to NOHBY] complement(595496..596017) ...    42   1e-04
KLLA0F20636g complement(1914452..1915309) some similarities with...    42   1e-04
AEL077W [2429] [Homologous to NOHBY] complement(483028..484038) ...    42   1e-04
YMR182C (RGM1) [4137] chr13 complement(624531..625166) Transcrip...    42   1e-04
Scas_656.1*                                                            40   2e-04
YPR015C (YPR015C) [5449] chr16 complement(590278..591021) Protei...    42   2e-04
YJL056C (ZAP1) [2855] chr10 complement(330347..332989) Zinc-resp...    42   2e-04
Kwal_47.16577                                                          42   3e-04
CAGL0H07557g 738086..739516 some similarities with sp|P32805 Sac...    42   3e-04
KLLA0F10109g complement(939195..941066) weakly similar to sp|Q00...    42   3e-04
AFR461C [3653] [Homologous to ScYDR463W (STP1) - SH] (1269565..1...    42   3e-04
Sklu_2389.2 YJL056C, Contig c2389 3525-5828                            42   3e-04
Sklu_2244.3 , Contig c2244 4100-4915 reverse complement                41   4e-04
CAGL0E06116g complement(604708..606549) some similarities with t...    41   5e-04
Scas_719.68                                                            41   6e-04
Scas_378.1                                                             40   6e-04
CAGL0K04631g complement(440721..443762) some similarities with s...    41   6e-04
CAGL0E04312g 412563..414629 some similarities with sp|Q00947 Sac...    40   7e-04
AFL136W [3059] [Homologous to ScYPL230W - SH; ScYMR182C (RGM1) -...    40   8e-04
CAGL0J01595g 151584..152618 some similarities with tr|Q12531 Sac...    40   0.001
YMR070W (MOT3) [4029] chr13 (409153..410625) Transcription facto...    40   0.001
KLLA0B03454g complement(314015..315433) some similarities with s...    40   0.001
Scas_641.24                                                            39   0.002
Scas_602.4d                                                            39   0.002
Scas_693.31                                                            39   0.002
AGL246W [4066] [Homologous to ScYDR253C (MET32) - SH; ScYPL038W ...    39   0.002
Kwal_23.5400                                                           39   0.002
CAGL0J05060g 478650..480791 similar to sp|P47043 Saccharomyces c...    39   0.002
CAGL0K03003g 276756..278699 weakly similar to sp|P54785 Saccharo...    39   0.003
Kwal_47.18337                                                          39   0.003
ADL040W [1701] [Homologous to ScYPR013C - SH] complement(618855....    38   0.004
CAGL0G10021g complement(959154..960338) similar to sp|P39933 Sac...    38   0.004
YPR186C (PZF1) [5600] chr16 complement(909727..911016) RNA polym...    38   0.004
CAGL0L00583g 69547..70713 similar to tr|Q12132 Saccharomyces cer...    38   0.004
AEL278W [2227] [Homologous to ScYPR186C (PZF1) - SH] complement(...    38   0.005
KLLA0A10373g complement(907244..907864) some similarities with c...    37   0.005
Sklu_1527.1 YPL038W, Contig c1527 389-1006                             37   0.006
KLLA0C16005g 1397274..1398269 some similarities with sgd|S000615...    37   0.006
Scas_660.12                                                            37   0.007
YPL038W (MET31) [5401] chr16 (480530..481063) Zinc-finger protei...    37   0.007
Sklu_2154.3 , Contig c2154 4677-5249 reverse complement                37   0.008
Scas_627.6                                                             37   0.009
CAGL0I02816g complement(247817..248692) similar to sp|P41696 Sac...    37   0.009
YHR006W (STP2) [2292] chr8 (117808..119433) Transcription factor...    37   0.010
Kwal_26.8021                                                           37   0.010
Scas_602.4                                                             36   0.012
KLLA0E18645g complement(1648263..1649558) some similarities with...    37   0.012
YDR463W (STP1) [1281] chr4 (1386804..1388363) Transcription fact...    37   0.013
AEL174W [2332] [Homologous to ScYJL056C (ZAP1) - SH] complement(...    37   0.013
Scas_712.2                                                             36   0.016
AFR531W [3723] [Homologous to ScAFR531W] complement(1389487..139...    36   0.019
CAGL0M04323g complement(474158..476269) similar to sp|P21192 Sac...    36   0.023
CAGL0E01331g 124362..126431 weakly similar to sp|P08153 Saccharo...    36   0.024
Scas_604.4                                                             35   0.045
Kwal_34.15946                                                          35   0.046
AGL197W [4115] [Homologous to ScYDR146C (SWI5) - SH; ScYLR131C (...    35   0.053
CAGL0K06413g 627811..628890 some similarities with sp|Q00947 Sac...    34   0.057
YDR253C (MET32) [1086] chr4 complement(963982..964557) Zinc-fing...    34   0.059
ADL050W [1691] [Homologous to NOHBY] complement(597229..597669) ...    33   0.060
AGL071C [4240] [Homologous to ScYMR070W (MOT3) - SH] (574723..57...    34   0.063
Scas_631.7                                                             34   0.066
YLR131C (ACE2) [3541] chr12 complement(404511..406823) Metalloth...    34   0.079
YDR146C (SWI5) [991] chr4 complement(748607..750736) Transcripti...    34   0.11 
Sklu_2289.1 YGL254W, Contig c2289 150-1025 reverse complement          33   0.13 
Scas_713.52                                                            33   0.13 
KLLA0D16456g complement(1387846..1390410) weakly similar to sp|P...    33   0.15 
KLLA0F07073g 675221..676897 some similarities with sgd|S0004367 ...    33   0.16 
Kwal_27.11824                                                          32   0.25 
Kwal_56.23925                                                          33   0.26 
Scas_717.60d                                                           32   0.30 
Kwal_26.9300                                                           32   0.51 
AGR186C [4497] [Homologous to NOHBY] (1099513..1100376) [864 bp,...    31   0.55 
Sklu_2359.5 YPR022C, Contig c2359 10655-12818                          32   0.62 
CAGL0E03762g complement(351003..352757) weakly similar to sp|P33...    31   0.75 
Scas_568.5                                                             30   0.77 
CAGL0H04873g complement(465069..466424) some similarities with t...    31   0.80 
YPR022C (YPR022C) [5456] chr16 complement(603906..607307) Predic...    31   1.0  
Scas_670.2                                                             30   1.5  
AFR588W [3780] [Homologous to ScYLR375W (STP3) - SH; ScYDL048C (...    30   1.9  
Sklu_2206.2 YLR375W, Contig c2206 7136-8212                            30   2.0  
CAGL0I02838g complement(248704..250671) similar to sp|P41696 Sac...    30   2.0  
Kwal_55.20634                                                          30   2.0  
CAGL0L12562g complement(1350878..1351549) similar to sp|Q12041 S...    29   2.1  
Kwal_27.10167                                                          29   2.2  
YDL048C (STP4) [816] chr4 complement(366739..368211) Protein wit...    30   2.2  
Scas_646.7*                                                            30   2.3  
Sklu_2169.3 YIL128W, Contig c2169 4441-7500 reverse complement         30   2.6  
Sklu_2126.5 YHL027W, Contig c2126 7763-9109                            29   2.9  
CAGL0K04697g 458366..459913 some similarities with tr|Q07351 Sac...    29   3.0  
CAGL0K04257g complement(391287..392930) some similarities with s...    29   3.8  
Sklu_1682.2 YJL049W, Contig c1682 738-2018                             29   3.9  
Scas_683.30                                                            28   5.5  
Scas_636.14d                                                           28   6.3  
Scas_627.17d                                                           28   7.9  
YHL027W (RIM101) [2259] chr8 (51109..52986) Transcription factor...    28   9.8  
AFR190C [3382] [Homologous to ScYHL027W (RIM101) - SH] (783110.....    28   9.9  

>YDR043C (NRG1) [896] chr4 complement(542670..543365)
           Transcriptional repressor involved in glucose repression
           of STA1 and MUC1, suppressor of snf mutations, has two
           tandem C2H2-type zinc fingers [696 bp, 231 aa]
          Length = 231

 Score =  456 bits (1174), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 218/228 (95%), Positives = 218/228 (95%)

Query: 1   MFYPYNYSNLNVSTMPALPGISAFDGMQDEENVEISPERKYQTLLPVLTNSHVVENELKH 60
           MFYPYNYSNLNVSTMPALPGISAFDGMQDEENVEISPERKYQTLLPVLTNSHVVENELKH
Sbjct: 1   MFYPYNYSNLNVSTMPALPGISAFDGMQDEENVEISPERKYQTLLPVLTNSHVVENELKH 60

Query: 61  KLNKTAFDFRYQTKSENGSEKWEPKYLITPNLQTRSVSFDNSSVQYNXXXXXXXXXXQLT 120
           KLNKTAFDFRYQTKSENGSEKWEPKYLITPNLQTRSVSFDNSSVQYN          QLT
Sbjct: 61  KLNKTAFDFRYQTKSENGSEKWEPKYLITPNLQTRSVSFDNSSVQYNSDSSEKSSLSQLT 120

Query: 121 CNSSIIQQPENGIVSNDAYNKMANSRYSLKTRKQRTDPRNTLSDEEDLEQRRKYICKICA 180
           CNSSIIQQPENGIVSNDAYNKMANSRYSLKTRKQRTDPRNTLSDEEDLEQRRKYICKICA
Sbjct: 121 CNSSIIQQPENGIVSNDAYNKMANSRYSLKTRKQRTDPRNTLSDEEDLEQRRKYICKICA 180

Query: 181 RGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTHLK 228
           RGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTHLK
Sbjct: 181 RGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTHLK 228

>YBR066C (NRG2) [256] chr2 complement(369998..370660) Suppressor of
           snf mutations, predicted transcription factor with two
           tandem C2H2-type zinc fingers, involved in glucose
           repression of MUC1 transcription [663 bp, 220 aa]
          Length = 220

 Score =  138 bits (348), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 77/189 (40%), Positives = 105/189 (55%), Gaps = 28/189 (14%)

Query: 38  ERKYQTLLPVLTNSHVVENELKHKLNKTAFDFRYQTKSENGSEKWEPKYLITPNLQTRSV 97
           ERKYQTL+P++  SH+++++LK KLNK AFDF +  K  N +       L      +  +
Sbjct: 45  ERKYQTLIPLMKTSHLIDDDLKDKLNKCAFDF-FSGKQANRTSDGTISRLTASGKTSPIL 103

Query: 98  SFDNSSVQYNXXXXXXXXXXQLTCNSSIIQQPENGIVSNDAYNKMANSRYSLKTRKQRTD 157
              N +                     I++    G   +D Y+ +  S+ +    K ++ 
Sbjct: 104 PLQNIN---------------------IVKAENTGNGKSDPYSSIKISKPTKTVIKLKST 142

Query: 158 PRNTLSDEEDLEQRRKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHD 217
             NT        QR ++ CKIC+ GFTTSGHL+RHNRIHTGEKNH CP++GC QRFSRHD
Sbjct: 143 KTNTAG------QRTRHFCKICSTGFTTSGHLSRHNRIHTGEKNHICPHEGCGQRFSRHD 196

Query: 218 NCLQHYRTH 226
           NC QHYRTH
Sbjct: 197 NCNQHYRTH 205

>Scas_718.44
          Length = 266

 Score =  128 bits (322), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 82/250 (32%), Positives = 124/250 (49%), Gaps = 26/250 (10%)

Query: 4   PYNYSNLNVSTMPALPGISAFDGMQDEENVEISPERKYQTLLPVLTNSHVVENELKHKLN 63
           PY  SNL  +    +  + ++    +  ++++  E+K+QTLLP++  +  ++N+LK KL 
Sbjct: 16  PYTTSNLRENNKSPVQMMVSYALSSNNSSMDLPLEKKFQTLLPIVDTTSRIDNDLKWKLT 75

Query: 64  KTAFDFRYQT---------------KSENGS-EKWEPKYLITPNLQTRSVSFDNSSVQYN 107
           K  F F  +                KS N + E     YL  P      +     +    
Sbjct: 76  K-KFSFESEKSPITPTLTIPTITFEKSHNYTFETNTNIYLAPPTPSATPIGTPMGTPNVT 134

Query: 108 XXXXXXXXXXQLTCNSSIIQQPENGI----VSNDAYNKMANSRYSLKTRKQRTDPRNTLS 163
                      +T  +S+   P   +    +S    NK    +Y+   +           
Sbjct: 135 PSATPPPQIATMTHPTSMEHLPVELVSKSHLSPSINNKTWQDKYNNNKQPIMMKITKKTK 194

Query: 164 DEEDL-----EQRRKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDN 218
            ++++     + RRK++CKIC+ GFTTSGHL+RHNRIHTGEKNH CP++GC Q+FSRHDN
Sbjct: 195 TDKNIAMKRQQNRRKHVCKICSTGFTTSGHLSRHNRIHTGEKNHSCPFEGCNQKFSRHDN 254

Query: 219 CLQHYRTHLK 228
           CLQHYRTHLK
Sbjct: 255 CLQHYRTHLK 264

>Sklu_2357.7 YDR043C, Contig c2357 9816-10289 reverse complement
          Length = 157

 Score =  125 bits (313), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 52/61 (85%), Positives = 59/61 (96%)

Query: 168 LEQRRKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTHL 227
           +EQRR+Y+CKIC+RGFTTSGHLARHNRIHTGEKNH CP++GC QRFSRHDNC+QHYRTHL
Sbjct: 94  IEQRRRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTHL 153

Query: 228 K 228
           K
Sbjct: 154 K 154

>CAGL0K12078g complement(1168989..1170380) weakly similar to
           sp|Q03125 Saccharomyces cerevisiae YDR043c NRG1,
           hypothetical start
          Length = 463

 Score =  127 bits (319), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 65/76 (85%)

Query: 153 KQRTDPRNTLSDEEDLEQRRKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQR 212
           +Q+    ++L + +D+E RRKY+CK+C +GFTTSGHLARHNRIHTGEK H CPY+GC QR
Sbjct: 381 QQKKHSISSLCNSDDIELRRKYLCKVCGKGFTTSGHLARHNRIHTGEKRHVCPYEGCGQR 440

Query: 213 FSRHDNCLQHYRTHLK 228
           F+RHDNCLQHY+THLK
Sbjct: 441 FNRHDNCLQHYKTHLK 456

 Score = 30.0 bits (66), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 27/52 (51%), Gaps = 1/52 (1%)

Query: 34  EISP-ERKYQTLLPVLTNSHVVENELKHKLNKTAFDFRYQTKSENGSEKWEP 84
           ++SP +R++ TL+P L     VE+ L HKLN+   ++  +  S        P
Sbjct: 90  QLSPIQRQHCTLIPSLERKSSVEDSLIHKLNRNTLEYFSKPVSHGSPSNLSP 141

>Kwal_27.10925
          Length = 264

 Score =  123 bits (308), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 58/61 (95%)

Query: 168 LEQRRKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTHL 227
           +EQRR+Y+CKIC +GFTTSGHLARHNRIHTGEKNH CP++GC QRFSRHDNC+QHY+THL
Sbjct: 195 VEQRRRYVCKICVKGFTTSGHLARHNRIHTGEKNHVCPHEGCGQRFSRHDNCVQHYKTHL 254

Query: 228 K 228
           +
Sbjct: 255 R 255

>Scas_569.2
          Length = 293

 Score =  120 bits (301), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 50/64 (78%), Positives = 57/64 (89%)

Query: 165 EEDLEQRRKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYR 224
           EE+LE+RRKYICK+C++GFTTSGHLARHNRIHTGEK H C Y GC  +FSRHDNC+QHYR
Sbjct: 219 EEELEKRRKYICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYR 278

Query: 225 THLK 228
           TH K
Sbjct: 279 THFK 282

>AGR031W [4341] [Homologous to ScYDR043C (NRG1) - SH; ScYBR066C
           (NRG2) - SH] complement(769926..770348) [423 bp, 140 aa]
          Length = 140

 Score =  112 bits (280), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 48/61 (78%), Positives = 55/61 (90%)

Query: 168 LEQRRKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTHL 227
           +E+RRK++C+ C +GFTTSGHLARHNRIHTGEKNH C + GC QRFSRHDNCLQHYRTHL
Sbjct: 74  VEKRRKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTHL 133

Query: 228 K 228
           K
Sbjct: 134 K 134

>KLLA0F18524g complement(1701498..1702571) some similarities with
           sp|Q03125 Saccharomyces cerevisiae YDR043c NRG1
           transcriptional repressor for glucose repression of STA1
           gene expression, hypothetical start
          Length = 357

 Score =  115 bits (288), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 53/61 (86%)

Query: 168 LEQRRKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTHL 227
           L +RRKYICKIC+RGFTTSGHLARHNRIHTGEK H C + GC QRFSRHDN +QHYRTH 
Sbjct: 278 LAERRKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTHF 337

Query: 228 K 228
           K
Sbjct: 338 K 338

>CAGL0L07480g complement(822240..823184) some similarities with
           sp|P38082 Saccharomyces cerevisiae YBR066c NRG2 or
           sp|Q03125 Saccharomyces cerevisiae YDR043c NRG1,
           hypothetical start
          Length = 314

 Score =  114 bits (285), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 46/65 (70%), Positives = 56/65 (86%)

Query: 164 DEEDLEQRRKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHY 223
           + + +EQRRK+IC+IC  GFTTSGHL+RH +IHTGEK+H CP++GC Q FSRHDNCLQHY
Sbjct: 242 NTQKIEQRRKHICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHY 301

Query: 224 RTHLK 228
           RTH K
Sbjct: 302 RTHSK 306

>Sklu_2351.6 YGL035C, Contig c2351 12964-14610 reverse complement
          Length = 548

 Score = 73.9 bits (180), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 38/85 (44%), Positives = 47/85 (55%), Gaps = 6/85 (7%)

Query: 142 MANSRYSLKTRKQRTDPRNTLSDEEDLEQRRKYICKICARGFTTSGHLARHNRIHTGEKN 201
           +ANS  S  TRK++  P N+  D       R Y+C IC+R F    H  RH R HTGEK 
Sbjct: 8   VANSGDSASTRKKKRSP-NSGPDSP-----RPYVCPICSRAFHRLEHQTRHIRTHTGEKP 61

Query: 202 HCCPYKGCTQRFSRHDNCLQHYRTH 226
           H C + GC +RFSR D   +H R H
Sbjct: 62  HACEFPGCGKRFSRSDELTRHTRIH 86

>Kwal_14.2278
          Length = 463

 Score = 72.8 bits (177), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 35/58 (60%)

Query: 169 EQRRKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTH 226
           E  R YIC IC+R F    H  RH R HTGEK H C + GCT+RFSR D   +H R H
Sbjct: 18  ESPRPYICPICSRAFHRLEHQTRHIRTHTGEKPHACDFAGCTKRFSRSDELTRHKRIH 75

>KLLA0E10989g 966805..968229 gi|1709030|sp|P50898|MIG1_KLULA
           Kluyveromyces lactis Regulatory protein MIG1, start by
           similarity
          Length = 474

 Score = 70.9 bits (172), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 38/63 (60%)

Query: 164 DEEDLEQRRKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHY 223
           ++ D +  R Y+C IC RGF    H  RH R HTGE+ H C + GC++RFSR D   +H 
Sbjct: 16  NDHDKDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHR 75

Query: 224 RTH 226
           R H
Sbjct: 76  RIH 78

>AFR471C [3663] [Homologous to ScYGL035C (MIG1) - SH; ScYGL209W
           (MIG2) - NSH] (1287076..1288245) [1170 bp, 389 aa]
          Length = 389

 Score = 68.6 bits (166), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 29/55 (52%), Positives = 33/55 (60%)

Query: 172 RKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTH 226
           R Y+C ICAR F    H  RH R HTGEK H C + GC +RFSR D   +H R H
Sbjct: 20  RPYVCPICARAFHRLEHQTRHIRTHTGEKPHACDFAGCGKRFSRQDELTRHRRIH 74

>YGL035C (MIG1) [1940] chr7 complement(431551..433065) Zinc-finger
           transcriptional repressor involved in
           glucose-repression, has two tandem C2H2-type zinc
           fingers, has similarity to mammalian Sp1, Krox/Egr, and
           Wilms tumor proteins [1515 bp, 504 aa]
          Length = 504

 Score = 68.2 bits (165), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 33/58 (56%)

Query: 169 EQRRKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTH 226
           E  R + C IC R F    H  RH RIHTGEK H C + GC +RFSR D   +H R H
Sbjct: 33  EAPRPHACPICHRAFHRLEHQTRHMRIHTGEKPHACDFPGCVKRFSRSDELTRHRRIH 90

>CAGL0A01628g 156635..157909 similar to sp|P27705 Saccharomyces
           cerevisiae YGL035c MIG1 transcriptional repressor,
           hypothetical start
          Length = 424

 Score = 67.8 bits (164), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 32/55 (58%)

Query: 172 RKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTH 226
           R ++C IC R F    H  RH R HTGEK H C + GC +RFSR D   +H R H
Sbjct: 41  RPHVCPICGRAFHRLEHQTRHMRTHTGEKPHACDFPGCVKRFSRSDELTRHRRIH 95

>Kwal_47.19045
          Length = 266

 Score = 65.1 bits (157), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 34/56 (60%)

Query: 172 RKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTHL 227
           R + C +C +GF    H  RH R HTGEK H C + GC +RFSR D   +H RTH+
Sbjct: 12  RPFKCDMCGKGFHRLEHKRRHIRTHTGEKPHSCNFPGCVKRFSRSDELKRHVRTHM 67

>YER028C (MIG3) [1453] chr5 complement(210691..211875) Protein that
           contains two tandem C2H2-type zinc finger domains, has
           strong similarity to Mig2p, a Tup1p-dependent and
           glucose-dependent transcriptional repressor [1185 bp,
           394 aa]
          Length = 394

 Score = 65.9 bits (159), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 36/58 (62%)

Query: 171 RRKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTHLK 228
           +R + C+IC+RGF    H  RH R HTGEK H C  +GC + FSR D   +H RTH K
Sbjct: 14  QRPFRCEICSRGFHRLEHKKRHGRTHTGEKPHKCTVQGCPKSFSRSDELKRHLRTHTK 71

>CAGL0M01870g complement(219813..220760) some similarities with
           tr|Q12145 Saccharomyces cerevisiae YPR013c or tr|Q12531
           Saccharomyces cerevisiae YPR015c, hypothetical start
          Length = 315

 Score = 64.7 bits (156), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 35/56 (62%)

Query: 173 KYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTHLK 228
           K+ICK+C + F     L+ H  IHTGEK + CP+  CT+ F+   N L+HY+ H K
Sbjct: 172 KFICKVCLKKFKRPSSLSTHMNIHTGEKPYPCPFDNCTKSFNAKSNMLRHYKLHFK 227

>Scas_575.3
          Length = 455

 Score = 64.7 bits (156), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 37/69 (53%)

Query: 158 PRNTLSDEEDLEQRRKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHD 217
           PR      +D +  R ++C IC R F    H  RH R HTGEK H C + GC ++FSR D
Sbjct: 52  PRPRSRANKDGDAPRPHVCPICQRAFHRLEHQTRHMRTHTGEKPHECDFPGCVKKFSRSD 111

Query: 218 NCLQHYRTH 226
              +H R H
Sbjct: 112 ELTRHKRIH 120

>Scas_712.42*
          Length = 290

 Score = 62.8 bits (151), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 28/55 (50%), Positives = 33/55 (60%)

Query: 172 RKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTH 226
           R + C+ CARGF    H  RH R HTGEK H C + GC + FSR D   +H RTH
Sbjct: 16  RPFRCETCARGFHRLEHKKRHMRTHTGEKPHHCAFPGCGKGFSRSDELKRHLRTH 70

>CAGL0C02519g 253051..254007 weakly similar to sp|P39943
           Saccharomyces cerevisiae YER028c, hypothetical start
          Length = 318

 Score = 62.4 bits (150), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 35/57 (61%)

Query: 171 RRKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTHL 227
           +R + C+IC+RGF    H  RH R HTGEK H C +  C + FSR D   +H RTH+
Sbjct: 17  KRPFRCEICSRGFHRLEHKKRHFRTHTGEKPHKCKFPSCPKSFSRADELKRHSRTHM 73

>KLLA0B00605g complement(46736..47455) some similarities with
           sp|P39943 Saccharomyces cerevisiae YER028c, hypothetical
           start
          Length = 239

 Score = 60.8 bits (146), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 33/57 (57%)

Query: 172 RKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTHLK 228
           R Y+C+IC   F    H  RH R HTGEK   C   GC +RFSR+D   +H +TH K
Sbjct: 10  RPYLCEICGNRFHRLEHKTRHIRTHTGEKPFACTVPGCPKRFSRNDELKRHIKTHFK 66

>CAGL0K09372g complement(924818..926008) similar to sp|P53035
           Saccharomyces cerevisiae YGL209w MIG2 C2H2 zinc-finger
           protein, start by similarity
          Length = 396

 Score = 61.6 bits (148), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 34/57 (59%)

Query: 170 QRRKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTH 226
           + R + C+ C+RGF    H  RH R HTGEK H C + GC + FSR D   +H RTH
Sbjct: 13  KERPFKCEHCSRGFHRLEHKKRHMRTHTGEKPHGCSFPGCGKSFSRSDELKRHNRTH 69

 Score = 29.3 bits (64), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 11/20 (55%), Positives = 13/20 (65%)

Query: 179 CARGFTTSGHLARHNRIHTG 198
           C + F+ S  L RHNR HTG
Sbjct: 52  CGKSFSRSDELKRHNRTHTG 71

>AGR117C [4428] [Homologous to ScYER169W (RPH1) - SH; ScYDR096W
           (GIS1) - SH] (964417..966816) [2400 bp, 799 aa]
          Length = 799

 Score = 61.6 bits (148), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 34/95 (35%), Positives = 56/95 (58%), Gaps = 9/95 (9%)

Query: 132 GIVSNDAYNKMANSRYSLKTRKQR-TDPRNTLSDEEDL--EQRRKYICKICARGFTTSGH 188
            ++++DA   + NS      R +R T P + +S EE +  ++ + Y+C+ C R F++  H
Sbjct: 690 ALLNDDA---LTNSVLPGAGRPERATSPTSKISAEEIIISDKGKAYVCQECQRQFSSGHH 746

Query: 189 LARHNR-IHTGEKNHCCPYKGCTQRFSRHDNCLQH 222
           L RH + +H+GEK H CP   C ++F R D+ LQH
Sbjct: 747 LTRHKKSVHSGEKPHSCP--KCGKKFKRRDHVLQH 779

>YGL209W (MIG2) [1787] chr7 (95860..97008) Zinc-finger protein
           involved in glucose repression of SUC2, contains two
           tandem zinc-fingers [1149 bp, 382 aa]
          Length = 382

 Score = 60.8 bits (146), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 31/55 (56%)

Query: 172 RKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTH 226
           R + C  C RGF    H  RH R HTGEK H C + GC + FSR D   +H RTH
Sbjct: 15  RPFRCDTCHRGFHRLEHKKRHLRTHTGEKPHHCAFPGCGKSFSRSDELKRHMRTH 69

>Scas_687.33
          Length = 288

 Score = 60.1 bits (144), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 33/57 (57%)

Query: 171 RRKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTHL 227
           +R + C IC+RGF    H  RH R HTGEK H C +  C + FSR D   +H R HL
Sbjct: 14  QRPFRCPICSRGFHRLEHKKRHVRTHTGEKPHPCTFAHCGKSFSRGDELKRHIRIHL 70

>YER169W (RPH1) [1597] chr5 (523364..525754) DNA damage-responsive
           repressor of PHR1, contains two C2H2-type zinc finger
           domains [2391 bp, 796 aa]
          Length = 796

 Score = 60.5 bits (145), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 45/75 (60%), Gaps = 6/75 (8%)

Query: 152 RKQRTDPRNTLSDEEDL---EQRRKYICKICARGFTTSGHLARHNR-IHTGEKNHCCPYK 207
           ++Q + P N+    E++    + + YICK C R F++  HL RH + +H+GEK H CP  
Sbjct: 684 KEQGSSPLNSKFAPEEIVLSGKNKIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCP-- 741

Query: 208 GCTQRFSRHDNCLQH 222
            C +RF R D+ LQH
Sbjct: 742 KCGKRFKRRDHVLQH 756

>Kwal_26.8351
          Length = 698

 Score = 60.1 bits (144), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 51/166 (30%), Positives = 74/166 (44%), Gaps = 17/166 (10%)

Query: 68  DFRYQTKSE---NGSEKWEPKYLIT-PNLQTRSVSFDNSSVQYNXXXXXXXXXXQLTCNS 123
           D   Q +SE   NGS+   P  LI  PN    + S D +++             QL+  +
Sbjct: 541 DILQQLESEINQNGSKFIHPNLLINDPNQILDNTSLDVANLSSGSAGSVALNPLQLSLTA 600

Query: 124 SIIQQPENGIVSNDAYNKMANSRYSLKTRKQRTDPRNTLSDEEDLEQRRKYICKICARGF 183
           S          S  +Y   +N +   KT      PRN+ S     E+ + + C+ C + F
Sbjct: 601 S---------TSPSSYTSNSNPKQR-KTHSFSKPPRNSKSSSPVEEEEKPFKCQECTKAF 650

Query: 184 TTSGHLARHNR-IHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTHLK 228
             S HL RH R +H+ E+   C Y  C ++FSR DN  QH +TH K
Sbjct: 651 RRSEHLKRHIRSVHSSERPFHCSY--CDKKFSRSDNLSQHLKTHKK 694

>KLLA0C17710g 1569331..1571796 similar to sp|P39956 Saccharomyces
           cerevisiae YER169w RPH1, start by similarity
          Length = 821

 Score = 59.3 bits (142), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 27/68 (39%), Positives = 44/68 (64%), Gaps = 6/68 (8%)

Query: 159 RNTLSDEEDL---EQRRKYICKICARGFTTSGHLARHNR-IHTGEKNHCCPYKGCTQRFS 214
           ++ ++DEE +   +  + Y+C+ CAR F++  HL RH + +H+GEK H CP   C ++F 
Sbjct: 737 QSKINDEEIMFLDDGSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCP--KCGKKFK 794

Query: 215 RHDNCLQH 222
           R D+ LQH
Sbjct: 795 RRDHVLQH 802

>Kwal_27.10467
          Length = 302

 Score = 58.2 bits (139), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 34/61 (55%)

Query: 168 LEQRRKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTHL 227
           L  + +Y C  C + F     LA HN  HTG+K +CCP+  C ++F+   N  +HY+ H 
Sbjct: 192 LRNQPRYTCTKCGKVFNRPSSLATHNNTHTGDKPYCCPFDNCDKQFNARSNMTRHYKLHF 251

Query: 228 K 228
           K
Sbjct: 252 K 252

>CAGL0L11880g 1272624..1275566 some similarities with sp|P39956
           Saccharomyces cerevisiae YER169w, hypothetical start
          Length = 980

 Score = 57.8 bits (138), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 33/50 (66%), Gaps = 3/50 (6%)

Query: 174 YICKICARGFTTSGHLARHNR-IHTGEKNHCCPYKGCTQRFSRHDNCLQH 222
           Y+C+ C R F++  HL RH + +H+GEK H CP   C +RF R D+ LQH
Sbjct: 902 YVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCP--KCGKRFKRRDHVLQH 949

>Scas_718.36d
          Length = 330

 Score = 57.0 bits (136), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 34/61 (55%)

Query: 168 LEQRRKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTHL 227
            +++  Y C +C +GF     L  H+ I +G + + CPY  CT+ F+   N L+HY+ H 
Sbjct: 233 FDEKLGYFCDVCGKGFRRPSSLRTHSNIRSGNRPYKCPYSNCTKSFNAKSNMLRHYKLHF 292

Query: 228 K 228
           +
Sbjct: 293 R 293

>AGL207W [4105] [Homologous to NOHBY] complement(310750..311583)
           [834 bp, 277 aa]
          Length = 277

 Score = 56.2 bits (134), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 34/57 (59%)

Query: 172 RKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTHLK 228
           ++Y+C  C +GF  +  L  H  IHTG++   CP+K C + F+   N L+H++ H +
Sbjct: 181 QRYVCTECGKGFARASSLRTHRNIHTGDRPFTCPFKNCGKSFNARSNMLRHHKLHFR 237

>Scas_681.19
          Length = 864

 Score = 57.0 bits (136), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 34/55 (61%), Gaps = 3/55 (5%)

Query: 169 EQRRKYICKICARGFTTSGHLARHNR-IHTGEKNHCCPYKGCTQRFSRHDNCLQH 222
           E  + Y+C  C R FT+  HL RH + +H+GEK H CP   C ++F R D+ LQH
Sbjct: 760 ETGKVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCP--KCGKKFKRRDHVLQH 812

>YDR096W (GIS1) [946] chr4 (637133..639817) DNA damage-responsive
           repressor of PHR1, has two tandem C2H2-type zinc finger
           domains [2685 bp, 894 aa]
          Length = 894

 Score = 56.6 bits (135), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 34/52 (65%), Gaps = 3/52 (5%)

Query: 172 RKYICKICARGFTTSGHLARHNR-IHTGEKNHCCPYKGCTQRFSRHDNCLQH 222
           + YIC+ C R F++  HL RH + +H+GEK H CP   C +RF R D+ LQH
Sbjct: 826 KIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPR--CGKRFKRRDHVLQH 875

>Scas_709.32
          Length = 822

 Score = 55.8 bits (133), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 36/61 (59%), Gaps = 3/61 (4%)

Query: 169 EQRRKYICKICARGFTTSGHLARHNR-IHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTHL 227
           ++ + + C+ C + F  S HL RH R +H+ E+   CP   C ++FSR DN  QH +TH 
Sbjct: 760 DENKTFKCETCGKAFRRSEHLKRHIRSVHSSERPFACPT--CDKKFSRSDNLAQHIKTHK 817

Query: 228 K 228
           K
Sbjct: 818 K 818

>Kwal_56.23453
          Length = 828

 Score = 55.8 bits (133), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 36/55 (65%), Gaps = 3/55 (5%)

Query: 169 EQRRKYICKICARGFTTSGHLARHNR-IHTGEKNHCCPYKGCTQRFSRHDNCLQH 222
           ++ + Y+C+ C R F++  HL RH + +H+GEK H CP   C ++F R D+ LQH
Sbjct: 730 DKGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCP--KCGKKFKRRDHVLQH 782

>KLLA0A04609g complement(411494..412765) some similarities with
           sgd|S0006217 Saccharomyces cerevisiae YPR013c,
           hypothetical start
          Length = 423

 Score = 54.7 bits (130), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 35/113 (30%), Positives = 58/113 (51%), Gaps = 6/113 (5%)

Query: 120 TCNSSIIQQPENGIVSNDAYNKMANSRYSLKT--RKQRTDPRNTLSDEEDLEQR----RK 173
           T N+S IQ+ ++G V ND  +  + S    +T  R  +T+   ++++   +       +K
Sbjct: 281 TANASQIQEEQDGSVVNDKDDHSSGSTTERETTLRISKTELDGSITNAMPINDSSLPLKK 340

Query: 174 YICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTH 226
             C IC R  +    L  H  IHTG+K + CP + C +RF+   N L+HY+ H
Sbjct: 341 NQCHICGRICSRPSTLQTHLSIHTGDKPYKCPKRNCHKRFNVKSNMLRHYKRH 393

>Sklu_2398.2 , Contig c2398 2210-3076 reverse complement
          Length = 288

 Score = 53.5 bits (127), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 43/95 (45%)

Query: 134 VSNDAYNKMANSRYSLKTRKQRTDPRNTLSDEEDLEQRRKYICKICARGFTTSGHLARHN 193
           V  D      +   + K  +Q + P   +  E     + +++C  C + F     L  H+
Sbjct: 178 VERDRSTSAPDLLIASKGSQQHSGPLCPVVSEAPARPKLQHLCPECGKSFRRPSALKTHS 237

Query: 194 RIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTHLK 228
            IH G   + C + GC++RF+   N L+HYR H K
Sbjct: 238 IIHVGRSPYACTWNGCSKRFNVKGNLLRHYRIHTK 272

 Score = 28.5 bits (62), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 18/32 (56%), Gaps = 2/32 (6%)

Query: 171 RRKYICKI--CARGFTTSGHLARHNRIHTGEK 200
           R  Y C    C++ F   G+L RH RIHT +K
Sbjct: 243 RSPYACTWNGCSKRFNVKGNLLRHYRIHTKKK 274

>KLLA0B07909g 697885..700653 some similarities with sp|P53243
           Saccharomyces cerevisiae YGR067c singleton, hypothetical
           start
          Length = 922

 Score = 54.3 bits (129), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 26/58 (44%), Positives = 32/58 (55%), Gaps = 2/58 (3%)

Query: 168 LEQRRKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRT 225
           +  +RKYIC  CA+ F+ S H ARH R HTG K   C    C+  F R D   +H RT
Sbjct: 2   VASQRKYICSFCAKPFSRSEHKARHERSHTGSKPFSCSI--CSHSFVRRDLLQRHIRT 57

>KLLA0F11682g complement(1068992..1070116) some similarities with
           sgd|S0006219 Saccharomyces cerevisiae YPR015c,
           hypothetical start
          Length = 374

 Score = 53.9 bits (128), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 32/56 (57%)

Query: 173 KYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTHLK 228
           KY C  C + F     L+ H  IHTG+K + C Y  C ++F+   N L+HY+ HLK
Sbjct: 303 KYRCAECGKAFARPSSLSTHMNIHTGDKPYKCLYPNCYKQFNAKSNMLRHYKLHLK 358

>YKL062W (MSN4) [3197] chr11 (322873..324765) Zinc-finger
           transcriptional activator for genes regulated through
           Snf1p, has strong similarity to Msn2p, has two tandem
           C2H2-type zinc fingers [1893 bp, 630 aa]
          Length = 630

 Score = 53.9 bits (128), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 48/86 (55%), Gaps = 6/86 (6%)

Query: 144 NSRYSLKTRKQRTDPRNTLSDEEDLEQRRKYICKICARGFTTSGHLARHNR-IHTGEKNH 202
           N +  ++ RK+++    T  D  + ++ + + CK C + F  S HL RH R +H+ E+  
Sbjct: 546 NGKVPVQPRKRKSI---TTIDPNNYDKNKPFKCKDCEKAFRRSEHLKRHIRSVHSTERPF 602

Query: 203 CCPYKGCTQRFSRHDNCLQHYRTHLK 228
            C +  C ++FSR DN  QH +TH K
Sbjct: 603 ACMF--CEKKFSRSDNLSQHLKTHKK 626

>CAGL0E04884g complement(469295..473764) weakly similar to sp|P07248
           Saccharomyces cerevisiae YDR216w ADR1 zinc-finger
           transcription factor, hypothetical start
          Length = 1489

 Score = 53.9 bits (128), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 30/51 (58%), Gaps = 2/51 (3%)

Query: 172 RKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQH 222
           R ++C+ C R F    HL RH R HT EK +CC    C +RF+R D  L+H
Sbjct: 28  RLFVCQTCTRAFARQEHLTRHERSHTKEKPYCCGI--CDRRFTRRDLLLRH 76

>Scas_683.25
          Length = 879

 Score = 53.9 bits (128), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 34/55 (61%), Gaps = 2/55 (3%)

Query: 171 RRKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRT 225
           ++++IC  CA+GF+ + H  RH R HTG K + C  K CT  F R D  L+H +T
Sbjct: 12  QKRFICSFCAKGFSRAEHKIRHERSHTGLKPYKC--KVCTHCFVRSDLALRHIKT 64

>YOR113W (AZF1) [4916] chr15 (534075..536819) Glucose-dependent
           transcriptional activator with four tandem C2H2-type
           zinc fingers [2745 bp, 914 aa]
          Length = 914

 Score = 53.5 bits (127), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 32/57 (56%), Gaps = 2/57 (3%)

Query: 172 RKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTHLK 228
           + ++C  C + FT  G+L  H R+HTGEK + C    C ++FSR  N   H  TH K
Sbjct: 619 KPFVCDYCGKRFTQGGNLRTHERLHTGEKPYSCDI--CDKKFSRKGNLAAHLVTHQK 673

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 28/55 (50%), Gaps = 2/55 (3%)

Query: 172 RKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTH 226
           +K+ C  C R F+ + HL  H R H G K   C Y  C +RF++  N   H R H
Sbjct: 591 KKHECPYCHRLFSQATHLEVHVRSHIGYKPFVCDY--CGKRFTQGGNLRTHERLH 643

 Score = 35.4 bits (80), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 24/51 (47%)

Query: 172 RKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQH 222
           + Y C IC + F+  G+LA H   H   K   C  + C + F++  N   H
Sbjct: 647 KPYSCDICDKKFSRKGNLAAHLVTHQKLKPFVCKLENCNKTFTQLGNMKAH 697

>Scas_710.9
          Length = 505

 Score = 53.1 bits (126), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 36/114 (31%), Positives = 60/114 (52%), Gaps = 10/114 (8%)

Query: 120 TCNSSIIQQPENGI--VSND---AYNKMANSRYSLKT-RKQRTDPRNTLSDEEDLEQRRK 173
           + NS ++QQ  + +   SND   ++N++ +S  S K+   QR +PR     +E   ++RK
Sbjct: 391 SSNSPLLQQYYSNMRQFSNDNPSSFNRVGSSELSSKSVGSQRRNPRM----QELQTRKRK 446

Query: 174 YICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTHL 227
             CK+C +  T +  L  H  IHTG +   C + GC + F+   N  +H + HL
Sbjct: 447 KQCKLCGKVVTRTSSLQTHMLIHTGVRPFSCTWPGCKKTFNVKSNMNRHLKLHL 500

>Kwal_47.16621
          Length = 1178

 Score = 53.1 bits (126), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 29/51 (56%), Gaps = 2/51 (3%)

Query: 172 RKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQH 222
           R ++C IC RGF    HL RH R HT EK   C +  C + F+R D  L+H
Sbjct: 76  RPFLCSICTRGFARQEHLKRHQRAHTNEKPFLCAF--CGRCFARRDLVLRH 124

>CAGL0H04213g 398544..402509 similar to sp|Q04545 Saccharomyces
           cerevisiae YML081w, start by similarity
          Length = 1321

 Score = 52.8 bits (125), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 34/59 (57%), Gaps = 3/59 (5%)

Query: 169 EQRRKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQH-YRTH 226
           ++ R ++C IC RGF    HL RH R HT EK   C +  C + F+R D  L+H Y+ H
Sbjct: 28  DKPRPHLCPICTRGFVRLEHLKRHQRAHTNEKPFLCVF--CGRCFARRDLVLRHQYKLH 84

>YML081W (YML081W) [3888] chr13 (104777..108532) Protein with
           similarity to Zms1p and Adr1p, has two tandem C2H2-type
           zinc fingers [3756 bp, 1251 aa]
          Length = 1251

 Score = 52.8 bits (125), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 31/54 (57%), Gaps = 2/54 (3%)

Query: 169 EQRRKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQH 222
           ++ R ++C IC RGF    HL RH R HT EK   C +  C + F+R D  L+H
Sbjct: 56  DKPRPFLCHICTRGFVRQEHLKRHQRAHTNEKPFLCVF--CGRCFARRDLVLRH 107

>ABR089C [680] [Homologous to ScYKL062W (MSN4) - SH; ScYMR037C
           (MSN2) - SH] (548266..549981) [1716 bp, 571 aa]
          Length = 571

 Score = 52.4 bits (124), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 51/100 (51%), Gaps = 8/100 (8%)

Query: 134 VSNDAYNKMANSRYSLKTRKQRTDPRNTLSDEEDL----EQRRKYICKICARGFTTSGHL 189
           + N +Y+ M N  Y + TR++R          +      E+ + + C+ C + F  S HL
Sbjct: 461 LDNTSYD-MRNPSYVVPTRRKRASVSKASRASKSSSPLEEEEKPFKCQECTKAFRRSEHL 519

Query: 190 ARHNR-IHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTHLK 228
            RH R +H+ ++   C Y  C ++FSR DN  QH +TH K
Sbjct: 520 KRHIRSVHSSDRPFPCTY--CDKKFSRSDNLSQHLKTHRK 557

>KLLA0F13046g 1201353..1205492 some similarities with sp|P07248
           Saccharomyces cerevisiae YDR216w ADR1 zinc-finger
           transcription factor, hypothetical start
          Length = 1379

 Score = 52.0 bits (123), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 30/51 (58%), Gaps = 2/51 (3%)

Query: 172 RKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQH 222
           R ++CK+C R F    HL RH R HT EK + C    C +RF+R D  ++H
Sbjct: 123 RLFVCKVCTRAFARQEHLTRHERSHTKEKPYVCGI--CERRFTRRDLLIRH 171

 Score = 30.8 bits (68), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 24/49 (48%), Gaps = 4/49 (8%)

Query: 170 QRRKYICKICARGFTTSGHLARH-NRIHTGEKNHCCPYKGCTQRFSRHD 217
           + + Y+C IC R FT    L RH  ++H G   +C  Y   T R  R D
Sbjct: 149 KEKPYVCGICERRFTRRDLLIRHCQKLHGG---NCGDYIRRTSRKVRRD 194

>AFR580C [3772] [Homologous to ScYGR067C - SH] (1478059..1480575)
           [2517 bp, 838 aa]
          Length = 838

 Score = 52.0 bits (123), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 26/58 (44%), Positives = 31/58 (53%), Gaps = 2/58 (3%)

Query: 168 LEQRRKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRT 225
           +  +RKYIC  CA+ F+ S H  RH R HTG K   C  K C   F R D   +H RT
Sbjct: 2   VASQRKYICSFCAQAFSRSEHKTRHERSHTGVKPFSC--KVCNHSFVRRDLLQRHIRT 57

>KLLA0B04477g 400019..404017 similar to sp|Q04545 Saccharomyces
           cerevisiae YML081w, start by similarity
          Length = 1332

 Score = 52.0 bits (123), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 29/51 (56%), Gaps = 2/51 (3%)

Query: 172 RKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQH 222
           R ++C IC RGF    HL RH R HT EK   C +  C + F+R D  L+H
Sbjct: 81  RPFLCPICTRGFARQEHLRRHERSHTNEKPFLCAF--CGRCFARRDLVLRH 129

>Scas_721.92
          Length = 1152

 Score = 51.6 bits (122), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 31/51 (60%), Gaps = 2/51 (3%)

Query: 172 RKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQH 222
           R ++C +C+R F    HL RH R HT EK + C    CT++F+R D  L+H
Sbjct: 76  RLFVCDVCSRAFARQEHLDRHARSHTNEKPYQCGI--CTKKFTRRDLLLRH 124

>Sklu_2181.1 YER130C, Contig c2181 4015-5247
          Length = 410

 Score = 51.2 bits (121), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 36/60 (60%), Gaps = 3/60 (5%)

Query: 168 LEQRRKYICKICARGFTTSGHLARHNR-IHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTH 226
           L+  +++ C+ C R F    HL RH R +H GEK + C  + C ++FSR DN  QH +TH
Sbjct: 348 LDASKQFGCEFCDRRFKRQEHLKRHVRSLHMGEKPYGC--EICGKKFSRSDNLNQHIKTH 405

 Score = 28.9 bits (63), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 10/28 (35%), Positives = 18/28 (64%)

Query: 172 RKYICKICARGFTTSGHLARHNRIHTGE 199
           + Y C+IC + F+ S +L +H + H G+
Sbjct: 381 KPYGCEICGKKFSRSDNLNQHIKTHGGD 408

>Sklu_2443.22 , Contig c2443 45390-46027
          Length = 213

 Score = 50.1 bits (118), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 29/51 (56%), Gaps = 2/51 (3%)

Query: 172 RKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQH 222
           R ++C IC RGF    HL RH R HT EK   C +  C + F+R D  L+H
Sbjct: 46  RPFLCPICTRGFARQEHLKRHQRSHTNEKPFLCAF--CGRCFARRDLVLRH 94

>Scas_602.9
          Length = 547

 Score = 51.2 bits (121), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 32/59 (54%), Gaps = 3/59 (5%)

Query: 169 EQRRKYICKICARGFTTSGHLARHNR-IHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTH 226
           +  +++ C  C R F    HL RH R +H GEK + C    C + FSR DN  QH +TH
Sbjct: 490 DATKQFACDYCERRFKRQEHLKRHVRSLHIGEKPYACHI--CNKNFSRSDNLTQHIKTH 546

>AER159C [2662] [Homologous to ScYML081W - SH; ScYJR127C (ZMS1) -
           SH] (935544..939119) [3576 bp, 1191 aa]
          Length = 1191

 Score = 51.2 bits (121), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 31/54 (57%), Gaps = 2/54 (3%)

Query: 169 EQRRKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQH 222
           ++ R ++C +C RGF    HL RH R HT EK   C +  C + F+R D  L+H
Sbjct: 75  DKPRPFLCPVCTRGFARQEHLKRHQRSHTNEKPFLCAF--CGRCFARRDLVLRH 126

>Scas_697.35
          Length = 839

 Score = 51.2 bits (121), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 32/57 (56%), Gaps = 2/57 (3%)

Query: 172 RKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTHLK 228
           + Y C  C + FT  G+L  H R+HTGEK + C  + C ++FSR  N   H  TH K
Sbjct: 541 KPYQCGYCGKRFTQGGNLRTHQRLHTGEKPYEC--ELCDKKFSRKGNLAAHLLTHQK 595

 Score = 41.2 bits (95), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 29/58 (50%), Gaps = 2/58 (3%)

Query: 169 EQRRKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTH 226
           E  +++ C  C R F  S HL  H R H G K + C Y  C +RF++  N   H R H
Sbjct: 510 EGSKQHKCPYCHRLFAQSTHLEVHIRSHLGYKPYQCGY--CGKRFTQGGNLRTHQRLH 565

 Score = 35.4 bits (80), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 27/57 (47%), Gaps = 1/57 (1%)

Query: 172 RKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHY-RTHL 227
           + Y C++C + F+  G+LA H   H   K   C    C + F++  N   H  R HL
Sbjct: 569 KPYECELCDKKFSRKGNLAAHLLTHQKVKPFICKLDNCNRSFTQLGNMKAHQNRFHL 625

 Score = 31.2 bits (69), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 22/41 (53%), Gaps = 2/41 (4%)

Query: 187 GHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTHL 227
           G + +   +H G K H CPY  C + F++  +   H R+HL
Sbjct: 500 GGVEKPKTLHEGSKQHKCPY--CHRLFAQSTHLEVHIRSHL 538

>Scas_717.18
          Length = 354

 Score = 50.4 bits (119), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 37/73 (50%)

Query: 156 TDPRNTLSDEEDLEQRRKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSR 215
           T P++T     + +  R + C IC +  T S  L  H  IHTGEK + C +  C    S 
Sbjct: 278 TTPKSTSRPSREKKPARIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSV 337

Query: 216 HDNCLQHYRTHLK 228
             N  +HY++HLK
Sbjct: 338 KSNITRHYKSHLK 350

>Scas_649.28
          Length = 730

 Score = 50.8 bits (120), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 35/61 (57%), Gaps = 3/61 (4%)

Query: 169 EQRRKYICKICARGFTTSGHLARHNR-IHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTHL 227
           ++ + + C  C + F  S HL RH R +H+ E+   C +  C ++FSR DN  QH +TH 
Sbjct: 668 DKNKPFKCSECIKAFRRSEHLKRHIRSVHSSERPFACMF--CEKKFSRSDNLSQHLKTHK 725

Query: 228 K 228
           K
Sbjct: 726 K 726

>Scas_717.17
          Length = 525

 Score = 50.8 bits (120), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 34/67 (50%), Gaps = 7/67 (10%)

Query: 158 PRNTLSDEEDLEQRRKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHD 217
           PR T   E  +     YIC IC++ F     L RH   H+ E+++ CP+  C  R  R D
Sbjct: 377 PRGTFDSENAV-----YICHICSKNFKRRSWLKRHLLSHSSERHYFCPW--CLSRHKRRD 429

Query: 218 NCLQHYR 224
           N LQH +
Sbjct: 430 NLLQHMK 436

>Kwal_47.17241
          Length = 403

 Score = 50.4 bits (119), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 33/60 (55%), Gaps = 3/60 (5%)

Query: 168 LEQRRKYICKICARGFTTSGHLARHNR-IHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTH 226
           L+  +++ C  C R F    HL RH R +H GEK   C    C ++FSR DN  QH +TH
Sbjct: 340 LDASKQFACDFCDRRFKRQEHLKRHVRSLHMGEKPFDCHI--CGKKFSRSDNLNQHIKTH 397

>YMR037C (MSN2) [4001] chr13 complement(344402..346516) Zinc-finger
           transcriptional activator for genes involved in the
           multistress response, has two tandem C2H2-type zinc
           fingers [2115 bp, 704 aa]
          Length = 704

 Score = 50.4 bits (119), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 34/60 (56%), Gaps = 3/60 (5%)

Query: 170 QRRKYICKICARGFTTSGHLARHNR-IHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTHLK 228
           + + + C IC + F  S HL RH R +H+ E+   C    C ++FSR DN  QH +TH K
Sbjct: 643 EEKPFHCHICPKSFKRSEHLKRHVRSVHSNERPFACHI--CDKKFSRSDNLSQHIKTHKK 700

>Scas_703.23
          Length = 1341

 Score = 50.1 bits (118), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 30/54 (55%), Gaps = 2/54 (3%)

Query: 169 EQRRKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQH 222
           ++ R ++C  C RGF    HL RH R HT EK   C +  C + F+R D  L+H
Sbjct: 67  DKPRPFLCPTCTRGFVRQEHLKRHQRSHTNEKPFLCVF--CGRCFARRDLVLRH 118

>YNL027W (CRZ1) [4559] chr14 (579578..581614) Calcineurin-dependent
           transcription factor, regulates gene expression
           downstream of calcineurin in response to multiple
           environmental signals, has two C2H2-type zinc finger
           domains [2037 bp, 678 aa]
          Length = 678

 Score = 50.1 bits (118), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 32/61 (52%), Gaps = 7/61 (11%)

Query: 172 RKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYK-------GCTQRFSRHDNCLQHYR 224
           R +IC IC + F       RH  +HTG+K + C  K       GC ++F+R D   +H++
Sbjct: 595 RPFICSICGKAFARQHDRKRHEDLHTGKKRYVCGGKLKDGKPWGCGKKFARSDALGRHFK 654

Query: 225 T 225
           T
Sbjct: 655 T 655

 Score = 34.3 bits (77), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 25/53 (47%), Gaps = 2/53 (3%)

Query: 174 YICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTH 226
           + C +C + FT   +L  H R HT E+   C    C + F+R  +  +H   H
Sbjct: 569 FACDVCGKKFTRPYNLKSHLRTHTNERPFICSI--CGKAFARQHDRKRHEDLH 619

>ACL057W [992] [Homologous to ScYER130C - SH]
           complement(264934..266496) [1563 bp, 520 aa]
          Length = 520

 Score = 49.7 bits (117), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 40/78 (51%), Gaps = 11/78 (14%)

Query: 150 KTRKQRTDPRNTLSDEEDLEQRRKYICKICARGFTTSGHLARHNR-IHTGEKNHCCPYKG 208
           KTR ++  P         L+  + + C+ C R F    HL RH R +H GEK + C    
Sbjct: 444 KTRGRKPSPA--------LDATKPFGCEYCERRFKRQEHLKRHIRSLHMGEKPYGCDI-- 493

Query: 209 CTQRFSRHDNCLQHYRTH 226
           C ++FSR DN  QH +TH
Sbjct: 494 CGKKFSRSDNLNQHIKTH 511

>AGR172W [4483] [Homologous to ScYDR216W (ADR1) - SH]
           complement(1071491..1074664) [3174 bp, 1057 aa]
          Length = 1057

 Score = 49.7 bits (117), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 28/51 (54%), Gaps = 2/51 (3%)

Query: 172 RKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQH 222
           R ++C  C R F    HL RH R HT EK + C    C +RFSR D  L+H
Sbjct: 47  RLFVCHTCTRAFARQEHLIRHKRSHTNEKPYICGI--CDRRFSRRDLLLRH 95

>Kwal_26.8011
          Length = 190

 Score = 47.8 bits (112), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 31/54 (57%)

Query: 173 KYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTH 226
           KY C++C + F+ S  L  H   HTG +   CP+  C++ F+   N ++H +TH
Sbjct: 127 KYQCQLCLKIFSRSSALQAHLLTHTGSRPFRCPFASCSKTFNVKSNMVRHLKTH 180

>Kwal_47.17888
          Length = 786

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 32/55 (58%), Gaps = 2/55 (3%)

Query: 172 RKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTH 226
           + + C+ C + FT  G+L  H R+HTGEK + C  + C +RFSR  N   H  TH
Sbjct: 529 KPFQCEYCGKRFTQGGNLRTHVRLHTGEKPYEC--EKCGRRFSRKGNLAAHRLTH 581

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 28/55 (50%), Gaps = 2/55 (3%)

Query: 172 RKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTH 226
           +++ C  C + FT S HL  H R H G K   C Y  C +RF++  N   H R H
Sbjct: 501 KQHECPYCHKCFTQSTHLEVHVRSHIGYKPFQCEY--CGKRFTQGGNLRTHVRLH 553

 Score = 37.0 bits (84), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 28/58 (48%), Gaps = 1/58 (1%)

Query: 172 RKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHY-RTHLK 228
           + Y C+ C R F+  G+LA H   H   K   C   GC + F++  N   H  R HL+
Sbjct: 557 KPYECEKCGRRFSRKGNLAAHRLTHENLKPFHCKLDGCNKSFTQLGNMKAHQNRFHLQ 614

>KLLA0F23782g 2219920..2222268 some similarities with sp|P41696
           Saccharomyces cerevisiae YOR113w AZF1 asparagine-rich
           zinc finger protein, hypothetical start
          Length = 782

 Score = 48.9 bits (115), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 32/55 (58%), Gaps = 2/55 (3%)

Query: 172 RKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTH 226
           + + C+ C + FT  G+L  H R+HTGEK + C  + C ++FSR  N   H  TH
Sbjct: 549 KPFSCEFCGKRFTQGGNLRTHIRLHTGEKPYEC--ERCGRKFSRKGNLAAHKLTH 601

 Score = 41.2 bits (95), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 48/105 (45%), Gaps = 7/105 (6%)

Query: 125 IIQQPENGIVSNDAYNKMANSRYSLKTRKQRTDPRNTLS---DEEDLEQRRKYICKICAR 181
           +IQ  +NG+   D   + A+    L++      P + L    ++   +  +++ C  C +
Sbjct: 473 VIQARKNGVT--DKVPRSADGSLLLESAPSIIPPLSQLVGGVEKPKSKGVKQFQCPYCHK 530

Query: 182 GFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTH 226
            FT S HL  H R H G K   C +  C +RF++  N   H R H
Sbjct: 531 YFTQSTHLEVHVRSHIGYKPFSCEF--CGKRFTQGGNLRTHIRLH 573

 Score = 35.4 bits (80), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 27/58 (46%), Gaps = 1/58 (1%)

Query: 172 RKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHY-RTHLK 228
           + Y C+ C R F+  G+LA H   H   K   C    C + F++  N   H  R HL+
Sbjct: 577 KPYECERCGRKFSRKGNLAAHKLTHDNLKPFECKLDDCNKNFTQLGNMKAHQNRFHLQ 634

>CAGL0K02145g 190055..191008 some similarities with sp|P39959
           Saccharomyces cerevisiae YER130c, hypothetical start
          Length = 317

 Score = 48.1 bits (113), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 33/56 (58%), Gaps = 3/56 (5%)

Query: 172 RKYICKICARGFTTSGHLARHNR-IHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTH 226
           +++ C+ C R F    HL RH R +H GEK + C    C ++FSR DN  QH +TH
Sbjct: 262 KQFGCEFCDRRFKRQEHLKRHIRSLHMGEKPYECHI--CNKKFSRSDNLNQHIKTH 315

>KLLA0F26961g 2486804..2488888 some similarities with sp|P33748
           Saccharomyces cerevisiae YMR037c MSN2 stress responsive
           regulatory protein, hypothetical start
          Length = 694

 Score = 48.1 bits (113), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 35/61 (57%), Gaps = 3/61 (4%)

Query: 169 EQRRKYICKICARGFTTSGHLARHNR-IHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTHL 227
           E+ + + C  C + F  S HL RH R +H+ E+   C +  C ++FSR DN  QH +TH 
Sbjct: 616 EEEKPFKCDQCNKTFRRSEHLKRHVRSVHSTERPFHCQF--CDKKFSRSDNLSQHLKTHK 673

Query: 228 K 228
           K
Sbjct: 674 K 674

>YPL230W (YPL230W) [5219] chr16 (115312..116487) Putative
           transcription factor that contains two tandem C2H2-type
           zinc fingers [1176 bp, 391 aa]
          Length = 391

 Score = 47.8 bits (112), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 24/44 (54%), Positives = 26/44 (59%), Gaps = 2/44 (4%)

Query: 179 CARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQH 222
           C   FT + HLARH R HTGEK   CP   C + FSR DN  QH
Sbjct: 49  CTMSFTRAEHLARHIRKHTGEKPFQCP--ACLKFFSRVDNLKQH 90

 Score = 28.5 bits (62), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 10/24 (41%), Positives = 14/24 (58%)

Query: 203 CCPYKGCTQRFSRHDNCLQHYRTH 226
           C  Y GCT  F+R ++  +H R H
Sbjct: 43  CTGYDGCTMSFTRAEHLARHIRKH 66

>CAGL0L06072g complement(679924..680826) some similarities with
           sp|P39959 Saccharomyces cerevisiae YER130c or sp|P33749
           Saccharomyces cerevisiae YKL062w MSN4 transcriptional
           activator, hypothetical start
          Length = 300

 Score = 47.4 bits (111), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 32/60 (53%), Gaps = 3/60 (5%)

Query: 168 LEQRRKYICKICARGFTTSGHLARH-NRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTH 226
            +  + + C +C R F    HL RH + +H GE+ + C    C + FSR DN  QH RTH
Sbjct: 212 FDDAKIFKCDMCERRFKRQEHLKRHVSSLHMGERPYSCDI--CLKSFSRSDNLNQHKRTH 269

>ACR264W [1311] [Homologous to ScYOR113W (AZF1) - SH]
           complement(835313..837622) [2310 bp, 769 aa]
          Length = 769

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 31/55 (56%), Gaps = 2/55 (3%)

Query: 172 RKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTH 226
           + + C+ C + FT  G+L  H R+HTGE+ + C    C +RFSR  N   H  TH
Sbjct: 513 KPFQCEYCGKRFTQGGNLRTHVRLHTGERPYEC--DKCGKRFSRKGNLAAHMLTH 565

 Score = 39.7 bits (91), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 28/55 (50%), Gaps = 2/55 (3%)

Query: 172 RKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTH 226
           +++ C  C + FT S HL  H R H G K   C Y  C +RF++  N   H R H
Sbjct: 485 KQHKCPYCHKCFTQSTHLEVHVRSHIGYKPFQCEY--CGKRFTQGGNLRTHVRLH 537

 Score = 33.1 bits (74), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 26/58 (44%), Gaps = 1/58 (1%)

Query: 172 RKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHY-RTHLK 228
           R Y C  C + F+  G+LA H   H   K   C    C + F++  N   H  R HL+
Sbjct: 541 RPYECDKCGKRFSRKGNLAAHMLTHENYKPFQCKLDDCNKSFTQLGNMKAHQNRFHLQ 598

>CAGL0M00594g 70659..73721 similar to sp|P46974 Saccharomyces
           cerevisiae YJR127c ZMS1 or sp|Q04545 Saccharomyces
           cerevisiae YML081w, hypothetical start
          Length = 1020

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 31/56 (55%), Gaps = 2/56 (3%)

Query: 169 EQRRKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYR 224
           ++ R ++C IC+RGF    HL RH   HT EK   C    C + F+R D  L+H +
Sbjct: 22  DKPRPFLCPICSRGFVRQEHLKRHQNSHTHEKPFLCLI--CGKCFARKDLVLRHLQ 75

>CAGL0F05995g complement(598819..600612) some similarities with
           sp|P33748 Saccharomyces cerevisiae YMR037c MSN2,
           hypothetical start
          Length = 597

 Score = 47.4 bits (111), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 34/58 (58%), Gaps = 3/58 (5%)

Query: 172 RKYICKICARGFTTSGHLARHNR-IHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTHLK 228
           + + C +C++ F  S HL RH R +H+ ++   C    C ++FSR DN  QH +TH K
Sbjct: 533 KPFGCHLCSKAFKRSEHLKRHVRSVHSTDRPFSCHL--CEKKFSRSDNLSQHIKTHKK 588

>CAGL0M13189g complement(1294293..1295918) weakly similar to
           sp|P33749 Saccharomyces cerevisiae YKL062w MSN4
           transcriptional activator, hypothetical start
          Length = 541

 Score = 47.4 bits (111), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%), Gaps = 3/56 (5%)

Query: 172 RKYICKICARGFTTSGHLARHNR-IHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTH 226
           + + C  C + F  S HL RH R +H+ E+   C +  C ++FSR DN  QH +TH
Sbjct: 482 KPFQCADCDKAFRRSEHLKRHVRSVHSTERPFPCMF--CEKKFSRSDNLSQHLKTH 535

>YJR127C (ZMS1) [3019] chr10 complement(658832..662974) Protein with
           similarity to Adr1p and Yml081p, has two tandem zinc
           finger domains [4143 bp, 1380 aa]
          Length = 1380

 Score = 47.4 bits (111), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 30/54 (55%), Gaps = 2/54 (3%)

Query: 169 EQRRKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQH 222
           ++ R ++C  C RGF    HL RH   HT EK + C +  C + F+R D  L+H
Sbjct: 146 DKPRPFLCPTCTRGFVRQEHLKRHQHSHTREKPYLCIF--CGRCFARRDLVLRH 197

>KLLA0E08679g 777005..778795 some similarities with sp|P53968
           Saccharomyces cerevisiae YNL027w CRZ1 calcineurin
           responsive zinc-finger, hypothetical start
          Length = 596

 Score = 47.4 bits (111), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 38/82 (46%), Gaps = 7/82 (8%)

Query: 153 KQRTDPRNTLSDEEDLEQRRKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYK----- 207
           K+ T P N  S        R Y+C +C + F       RH  +HTG++ + C        
Sbjct: 476 KKFTRPYNLKSHLRSHTDERPYVCSVCGKAFARMHDKNRHEDLHTGKRRYVCGGILKNGN 535

Query: 208 --GCTQRFSRHDNCLQHYRTHL 227
             GC ++F+R D   +H++T L
Sbjct: 536 SWGCGKKFARSDALGRHFKTEL 557

 Score = 34.3 bits (77), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 26/53 (49%), Gaps = 2/53 (3%)

Query: 174 YICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTH 226
           Y C IC + FT   +L  H R HT E+ + C    C + F+R  +  +H   H
Sbjct: 469 YACDICDKKFTRPYNLKSHLRSHTDERPYVCSV--CGKAFARMHDKNRHEDLH 519

>Scas_707.46
          Length = 338

 Score = 47.0 bits (110), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 35/70 (50%)

Query: 159 RNTLSDEEDLEQRRKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDN 218
           R+ +    +L  R +  C +C +  +    L  H  IHTG+    CP+K C + F+   N
Sbjct: 255 RSAIQKNLNLASRLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSN 314

Query: 219 CLQHYRTHLK 228
            L+H ++H K
Sbjct: 315 MLRHLKSHQK 324

>Sklu_2436.9 YDR463W, Contig c2436 18516-20069
          Length = 517

 Score = 47.0 bits (110), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 39/84 (46%), Gaps = 16/84 (19%)

Query: 157 DPRNTLSDEE--DLEQRRKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKG------ 208
           D +N    EE  D EQR KY+C  C   F   G+L RH + H  EK + CP+        
Sbjct: 143 DSQNPKDGEEIDDEEQRGKYVCHYCDAEFRIRGYLTRHIKKHAVEKAYHCPFFNSKLPPE 202

Query: 209 ----CTQRFSRHDNCLQHYRTHLK 228
                T  FSR D     Y+THLK
Sbjct: 203 SRCHTTGGFSRRDT----YKTHLK 222

>CAGL0M06831g 695162..697099 weakly similar to sp|P53968
           Saccharomyces cerevisiae YNL027w CRZ1, hypothetical
           start
          Length = 645

 Score = 47.0 bits (110), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 31/62 (50%), Gaps = 7/62 (11%)

Query: 171 RRKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYK-------GCTQRFSRHDNCLQHY 223
            + Y C IC + F       RH  +HTG+K + C  K       GC ++F+R D   +H+
Sbjct: 546 EKPYQCSICGKAFARQHDKKRHEDLHTGKKRYVCGGKLKDGTFWGCGKKFARSDALGRHF 605

Query: 224 RT 225
           +T
Sbjct: 606 KT 607

 Score = 37.4 bits (85), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 28/53 (52%), Gaps = 2/53 (3%)

Query: 174 YICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTH 226
           Y+C++C + F+   +L  H R HT EK + C    C + F+R  +  +H   H
Sbjct: 521 YVCEVCGKVFSRPYNLKSHLRTHTDEKPYQCSI--CGKAFARQHDKKRHEDLH 571

>KLLA0F01463g 140343..142688 some similarities with sp|P47043
           Saccharomyces cerevisiae YJL056c ZAP1 metalloregulatory
           protein involved in zinc-responsive transcriptional
           regulation, hypothetical start
          Length = 781

 Score = 47.0 bits (110), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 31/56 (55%), Gaps = 2/56 (3%)

Query: 171 RRKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTH 226
            R + C +C + ++TS  L  H R HTGEK   CP   C +RF+   N  +H RTH
Sbjct: 717 ERPFKCHLCPKSYSTSSSLRIHIRTHTGEKPLSCPI--CNKRFNESSNLAKHIRTH 770

 Score = 28.1 bits (61), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 18/87 (20%), Positives = 41/87 (47%), Gaps = 5/87 (5%)

Query: 147 YSLKTRKQRTDPRNTLSDEEDLEQRRKYICKI--CARGFTTSGHLARHNR---IHTGEKN 201
           + +K    +T  +   + ++  E+ +  ICK   C + F ++  L  H     + +G  +
Sbjct: 602 FDVKVLDNKTMAKQVTAHKQLHEEPQSCICKWAGCNKEFDSAKSLNEHIENFHVPSGLSS 661

Query: 202 HCCPYKGCTQRFSRHDNCLQHYRTHLK 228
           + C ++GC + F +    ++H + H K
Sbjct: 662 YKCEWEGCNKVFVQKQKLIRHLKVHSK 688

>YDR216W (ADR1) [1053] chr4 (895027..898998) Zinc-finger
           transcription factor involved in regulation of ADH2 and
           peroxisomal genes [3972 bp, 1323 aa]
          Length = 1323

 Score = 46.6 bits (109), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 47/101 (46%), Gaps = 10/101 (9%)

Query: 124 SIIQQPENG--IVSNDAYNKMANSRYSLKTRKQRTDPRNTLSDEEDLEQRRKYICKICAR 181
           S+IQ+  +G  I +N+  N   N +        R + R          + R ++C++C R
Sbjct: 58  SVIQRTPDGKIITTNNNMNSKINKQLDKLPENLRLNGRTPSG------KLRSFVCEVCTR 111

Query: 182 GFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQH 222
            F    HL RH R HT EK + C    C + F+R D  ++H
Sbjct: 112 AFARQEHLKRHYRSHTNEKPYPCGL--CNRCFTRRDLLIRH 150

>KLLA0C17072g 1494101..1495525 weakly similar to sp|P39959
           Saccharomyces cerevisiae YER130c, hypothetical start
          Length = 474

 Score = 46.2 bits (108), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 33/60 (55%), Gaps = 3/60 (5%)

Query: 168 LEQRRKYICKICARGFTTSGHLARHNR-IHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTH 226
           L+  + + C+ C R F    HL RH R +H  EK + C    C ++FSR DN  QH +TH
Sbjct: 412 LDASKPFGCEYCDRRFKRQEHLKRHIRSLHICEKPYGCHL--CGKKFSRSDNLSQHLKTH 469

 Score = 28.1 bits (61), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 10/28 (35%), Positives = 18/28 (64%)

Query: 172 RKYICKICARGFTTSGHLARHNRIHTGE 199
           + Y C +C + F+ S +L++H + HT E
Sbjct: 445 KPYGCHLCGKKFSRSDNLSQHLKTHTHE 472

>Kwal_27.11460
          Length = 531

 Score = 46.2 bits (108), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 31/62 (50%), Gaps = 7/62 (11%)

Query: 172 RKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYK-------GCTQRFSRHDNCLQHYR 224
           R + C IC + F       RH  +HTG+K + C  K       GC ++F+R D   +H++
Sbjct: 439 RPFSCAICGKAFARQHDRKRHEDLHTGQKRYTCHGKLKDGTEWGCGKKFARSDALGRHFK 498

Query: 225 TH 226
           T 
Sbjct: 499 TE 500

>Scas_717.17d
          Length = 350

 Score = 45.4 bits (106), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 34/65 (52%), Gaps = 3/65 (4%)

Query: 167 DLEQRRKY---ICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHY 223
           ++++RR +   IC +C +  T S  L  H  IHTG +   C +  C    S   N  +H+
Sbjct: 275 NVKKRRGHKLHICVVCGKSLTRSTSLRTHMLIHTGSRPFKCSWPNCKASSSVKSNITRHF 334

Query: 224 RTHLK 228
           ++HLK
Sbjct: 335 KSHLK 339

>Scas_695.2
          Length = 571

 Score = 45.8 bits (107), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 32/60 (53%), Gaps = 9/60 (15%)

Query: 174 YICKICARGFTTSGHLARHNRIHTGEKNHCC--------PYKGCTQRFSRHDNCLQHYRT 225
           ++C IC + F       RH  +HTG+K + C        P+ GC ++F+R D   +H++T
Sbjct: 480 FVCNICGKAFARQHDRKRHEDLHTGKKRYVCGGVLKNGTPW-GCHKKFARSDALGRHFKT 538

 Score = 33.1 bits (74), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 25/53 (47%), Gaps = 2/53 (3%)

Query: 174 YICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTH 226
           Y C++C + FT   +L  H R HT E    C    C + F+R  +  +H   H
Sbjct: 452 YACELCDKTFTRPYNLKSHLRTHTNEXPFVCNI--CGKAFARQHDRKRHEDLH 502

>CAGL0L03916g complement(448955..450883) weakly similar to sp|P41696
           Saccharomyces cerevisiae YOR113w AZF1 asparagine-rich
           zinc finger protein, hypothetical start
          Length = 642

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 30/55 (54%), Gaps = 2/55 (3%)

Query: 172 RKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTH 226
           + + C+ C + FT +G+L  H R+HTGE+   C    C + F+R  N   H  TH
Sbjct: 506 KPFECEFCGKRFTQAGNLRTHRRLHTGERPFKC--DKCDKTFARRGNLTAHEFTH 558

 Score = 38.9 bits (89), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 27/53 (50%), Gaps = 2/53 (3%)

Query: 174 YICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTH 226
           Y C  C++ F+ S HL  H + H G K   C +  C +RF++  N   H R H
Sbjct: 480 YQCAYCSKMFSQSTHLDVHIKAHMGYKPFECEF--CGKRFTQAGNLRTHRRLH 530

>CAGL0L05786g complement(636176..637222) some similarities with
           tr|Q12145 Saccharomyces cerevisiae YPR013c or tr|Q12531
           Saccharomyces cerevisiae YPR015c, hypothetical start
          Length = 348

 Score = 45.1 bits (105), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 35/66 (53%), Gaps = 1/66 (1%)

Query: 161 TLSDEEDLEQRRKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCL 220
           T+S  ++L + RK  C +C +  +    L  H  IHTG+    CP+K C + F+   N L
Sbjct: 273 TVSAIDELSKLRKQ-CPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNML 331

Query: 221 QHYRTH 226
           +H + H
Sbjct: 332 RHLKCH 337

>Scas_711.56
          Length = 832

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/75 (38%), Positives = 38/75 (50%), Gaps = 11/75 (14%)

Query: 162 LSDEEDLEQRRK-------YICKICARGFTTSGHLARHNRIHTGEKN-HCCPYKGCTQRF 213
            S+EE L+Q  +       + C IC + F  S  L  H R HTGEK  HC   K C + F
Sbjct: 735 FSNEETLKQHERTHSGEKPFKCDICGKRFAISSSLKIHIRTHTGEKPLHC---KICGKAF 791

Query: 214 SRHDNCLQHYRTHLK 228
           +   N  +H +THLK
Sbjct: 792 NESSNLSKHMKTHLK 806

 Score = 37.0 bits (84), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 30/57 (52%), Gaps = 6/57 (10%)

Query: 172 RKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKG--CTQRFSRHDNCLQHYRTH 226
           + + C IC + F+    L +H R H+GEK    P+K   C +RF+   +   H RTH
Sbjct: 724 KPFQCSICKKHFSNEETLKQHERTHSGEK----PFKCDICGKRFAISSSLKIHIRTH 776

 Score = 33.1 bits (74), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 30/61 (49%), Gaps = 4/61 (6%)

Query: 168 LEQRRKYICKI--CARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRT 225
           L+ + +Y C    C + F+    L RH R+H+G K   C    C + FS  +   QH RT
Sbjct: 690 LKGQSQYECHWANCHKIFSQRQRLVRHMRVHSGYKPFQCSI--CKKHFSNEETLKQHERT 747

Query: 226 H 226
           H
Sbjct: 748 H 748

>YGR067C (YGR067C) [2029] chr7 complement(622404..624788) Protein
           with two tandem zinc finger domains [2385 bp, 794 aa]
          Length = 794

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 28/55 (50%), Gaps = 2/55 (3%)

Query: 171 RRKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRT 225
           ++KYIC  C + F+ S H  RH R H G K   C  + C   F R D   +H RT
Sbjct: 5   QKKYICSFCLKPFSRSEHKIRHERSHAGVKPFQC--QVCKHSFVRRDLLQRHIRT 57

>ADR308C [2049] [Homologous to NOHBY] (1241869..1242705) [837 bp,
           278 aa]
          Length = 278

 Score = 43.9 bits (102), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 29/55 (52%)

Query: 172 RKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTH 226
           +K +CK+C R       L  H   HTG++   C + GC++ F+   N L+H R H
Sbjct: 202 KKNVCKVCGRECRRPSTLKTHMLTHTGQRPFSCRHPGCSKSFNVRSNMLRHERLH 256

>ADL198W [1543] [Homologous to ScYNL027W (CRZ1) - SH]
           complement(349070..350713) [1644 bp, 547 aa]
          Length = 547

 Score = 44.3 bits (103), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 37/80 (46%), Gaps = 7/80 (8%)

Query: 153 KQRTDPRNTLSDEEDLEQRRKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYK----- 207
           K+ T P N  S        R + C +C + F       RH  +H+G+K + C  K     
Sbjct: 433 KKFTRPYNLKSHLRTHTDERPFSCSVCGKAFARQHDRKRHEDLHSGKKRYVCGGKLKGGA 492

Query: 208 --GCTQRFSRHDNCLQHYRT 225
             GC ++F+R D   +H++T
Sbjct: 493 TWGCGKKFARSDALGRHFKT 512

 Score = 32.0 bits (71), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 25/53 (47%), Gaps = 2/53 (3%)

Query: 174 YICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTH 226
           Y C +C + FT   +L  H R HT E+   C    C + F+R  +  +H   H
Sbjct: 426 YSCNLCDKKFTRPYNLKSHLRTHTDERPFSCSV--CGKAFARQHDRKRHEDLH 476

>Kwal_14.2543
          Length = 711

 Score = 44.7 bits (104), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 29/73 (39%), Positives = 37/73 (50%), Gaps = 9/73 (12%)

Query: 161 TLSDEEDLEQ-------RRKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRF 213
           T S ++ L+Q        + Y C  C +GF TS  L  H R HTGEK   C  K C +RF
Sbjct: 614 TFSTQDILQQHMRTHSGEKPYKCSHCGKGFATSSSLRIHIRTHTGEKPLEC--KVCGKRF 671

Query: 214 SRHDNCLQHYRTH 226
           +   N  +H RTH
Sbjct: 672 NESSNLSKHMRTH 684

 Score = 32.7 bits (73), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 45/100 (45%), Gaps = 6/100 (6%)

Query: 131 NGIVSNDAYNKMANSRYSLKTRK-QRTDPRNTLSDEEDLEQ-RRKYICKI--CARGFTTS 186
           N ++ N+  N+    R+    ++    +  NT  ++E + + +  Y+C    C R  T  
Sbjct: 531 NSLIPNETDNQKHICRWDACMQEFSSCEELNTHIEKEHIPRGKSSYVCGWENCGRVITQR 590

Query: 187 GHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTH 226
             L RH R+HT  K   C    C + FS  D   QH RTH
Sbjct: 591 QKLLRHLRVHTRYKP--CKCVHCLKTFSTQDILQQHMRTH 628

 Score = 31.2 bits (69), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 27/51 (52%), Gaps = 2/51 (3%)

Query: 176 CKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTH 226
           C  C + F+T   L +H R H+GEK + C +  C + F+   +   H RTH
Sbjct: 608 CVHCLKTFSTQDILQQHMRTHSGEKPYKCSH--CGKGFATSSSLRIHIRTH 656

>ADL042W [1699] [Homologous to ScYPR015C - SH]
           complement(615818..616663) [846 bp, 281 aa]
          Length = 281

 Score = 43.9 bits (102), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 29/52 (55%)

Query: 175 ICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTH 226
           +C+IC + F     L  H  +H  +K + C ++GC +RF+   N L+H R H
Sbjct: 226 VCEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMRKH 277

>YER130C (YER130C) [1560] chr5 complement(421111..422442) Protein
           with two tandem zinc finger domains [1332 bp, 443 aa]
          Length = 443

 Score = 43.9 bits (102), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 30/56 (53%), Gaps = 3/56 (5%)

Query: 172 RKYICKICARGFTTSGHLARHNR-IHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTH 226
           +++ C+ C R F    HL RH R +H  EK   C    C + FSR DN  QH +TH
Sbjct: 387 KQFGCEFCDRRFKRQEHLKRHVRSLHMCEKPFTCHI--CNKNFSRSDNLNQHVKTH 440

>Kwal_14.2206
          Length = 254

 Score = 43.5 bits (101), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 29/53 (54%)

Query: 176 CKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTHLK 228
           C+IC + F+    L+ H  IHTG + + C    C +RF+   N ++H + H K
Sbjct: 196 CRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHAK 248

>CAGL0G08107g 768772..770649 weakly similar to tr|Q03833
           Saccharomyces cerevisiae YDR096w GIS1 DNA
           damage-responsive repressor of PHR1, hypothetical start
          Length = 625

 Score = 43.9 bits (102), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 32/54 (59%), Gaps = 3/54 (5%)

Query: 172 RKYICKICARGFTTSGHLARH-NRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYR 224
           + + C+IC   F +S HL RH N +H+ EK + CP   C++ F R D+  QH +
Sbjct: 560 KYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPI--CSKGFKRKDHVSQHLK 611

>Scas_720.33
          Length = 316

 Score = 43.5 bits (101), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 32/60 (53%), Gaps = 5/60 (8%)

Query: 169 EQRRKYIC---KICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRT 225
           ++R+ + C   K C   FT   HLARH R HTGEK   C    C + FSR DN  QH  T
Sbjct: 10  KERKTFACQGYKDCHMTFTREEHLARHIRKHTGEKPFQCYI--CFRFFSRMDNLKQHRDT 67

>Scas_707.31
          Length = 289

 Score = 43.1 bits (100), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 30/56 (53%), Gaps = 3/56 (5%)

Query: 172 RKYICKICARGFTTSGHLARHNR-IHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTH 226
           ++Y C +C + F    HL RH R IH   +   C    C +RFSR+DN  QH R H
Sbjct: 221 KQYFCHLCKKRFKRHEHLKRHFRTIHLRVRPFEC--SVCHKRFSRNDNLNQHVRIH 274

>YPR013C (YPR013C) [5448] chr16 complement(584627..585580) Putative
           transcription factor with similarity to mouse REX1
           encoded transcription factor, has two tandem C2H2-type
           zinc fingers [954 bp, 317 aa]
          Length = 317

 Score = 43.1 bits (100), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 28/51 (54%)

Query: 176 CKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTH 226
           C +C +  +    L  H  IHTG+    C ++GCT+ F+   N L+H ++H
Sbjct: 256 CPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSH 306

>ADL051W [1690] [Homologous to NOHBY] complement(595496..596017)
           [522 bp, 173 aa]
          Length = 173

 Score = 41.6 bits (96), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 36/79 (45%), Gaps = 6/79 (7%)

Query: 148 SLKTRKQRTDPRNTLSDEEDLEQRRKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYK 207
           S +  K  +DP N++       +     C IC + FT    L  H  IHT  K + CPY+
Sbjct: 96  SCELSKGVSDPANSV------HKVSGKTCAICRKSFTRKTSLQTHMLIHTKAKPYRCPYR 149

Query: 208 GCTQRFSRHDNCLQHYRTH 226
            C + F+   N  +H R H
Sbjct: 150 TCNKTFNVKSNLYRHERIH 168

>KLLA0F20636g complement(1914452..1915309) some similarities with
           sgd|S0006217 Saccharomyces cerevisiae YPR013c,
           hypothetical start
          Length = 285

 Score = 42.0 bits (97), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 29/52 (55%)

Query: 175 ICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTH 226
           IC  C + FT    L  H  +H+G+K   C ++GC ++F+   N ++H + H
Sbjct: 233 ICAQCGKQFTRPSALRTHMLVHSGDKPFECTWEGCNKKFNVKSNLIRHLKLH 284

>AEL077W [2429] [Homologous to NOHBY] complement(483028..484038)
           [1011 bp, 336 aa]
          Length = 336

 Score = 42.4 bits (98), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 26/51 (50%)

Query: 176 CKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTH 226
           C +C +       L  H  IHTG +   C + GC +RF+   N ++HYR H
Sbjct: 276 CPVCGKVCHRPSSLRNHMYIHTGRRPFLCEWPGCEKRFNVKSNMVRHYRLH 326

>YMR182C (RGM1) [4137] chr13 complement(624531..625166)
           Transcriptional repressor, has strong similarity to
           mammalian EGR (early growth response) factor, contains
           two tandem C2H2-type zinc fingers [636 bp, 211 aa]
          Length = 211

 Score = 41.6 bits (96), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 32/62 (51%), Gaps = 5/62 (8%)

Query: 164 DEEDLEQRRKYIC---KICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCL 220
           ++++   +R Y C     C   F  + HLARH R HTGEK   C    C + FSR DN  
Sbjct: 9   NKDNASVKRNYRCVGYPDCNMSFNRTEHLARHIRKHTGEKPFQC--NICLKFFSRIDNLR 66

Query: 221 QH 222
           QH
Sbjct: 67  QH 68

>Scas_656.1*
          Length = 102

 Score = 40.0 bits (92), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 34/66 (51%), Gaps = 7/66 (10%)

Query: 170 QRRKYI-------CKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQH 222
           Q++K+I       C IC +  T S  L  H  +HTG++   C +  C + F+   N  +H
Sbjct: 29  QQQKFIYRRPSRQCPICGKIVTRSSSLQTHMLVHTGDRPFKCKWLNCGKTFNVKSNMNRH 88

Query: 223 YRTHLK 228
           Y+ HLK
Sbjct: 89  YKLHLK 94

>YPR015C (YPR015C) [5449] chr16 complement(590278..591021) Protein
           with similarity to human GT box-binding protein
           (SP:B44489), has two tandem C2H2-type zinc fingers [744
           bp, 247 aa]
          Length = 247

 Score = 42.0 bits (97), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 46/100 (46%), Gaps = 10/100 (10%)

Query: 139 YNKMANSRYSLKTRKQRTDPRNTLSDEE-DLEQRRKYI---------CKICARGFTTSGH 188
           +  ++N +YSL       +P   LS  + DL+  +K +         C IC +  +    
Sbjct: 140 HRAVSNEQYSLPNVHIGQNPGTLLSQTQTDLDLIQKQLRAVVKLRKQCPICGKVCSRPST 199

Query: 189 LARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTHLK 228
           L  H  IHTG+    C ++ C + F+   N L+H RTH K
Sbjct: 200 LRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQK 239

>YJL056C (ZAP1) [2855] chr10 complement(330347..332989)
           Zinc-responsive transcriptional activator, regulates
           genes involved in zinc uptake, has eight C2H2-type zinc
           fingers [2643 bp, 880 aa]
          Length = 880

 Score = 42.0 bits (97), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 35/74 (47%), Gaps = 9/74 (12%)

Query: 162 LSDEEDLEQ-------RRKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFS 214
            S EE L Q        + Y C IC + F  S  L  H R HTGEK   C  K C +RF+
Sbjct: 777 FSSEETLVQHTRTHSGEKPYKCHICNKKFAISSSLKIHIRTHTGEKPLQC--KICGKRFN 834

Query: 215 RHDNCLQHYRTHLK 228
              N  +H +TH K
Sbjct: 835 ESSNLSKHIKTHQK 848

 Score = 39.7 bits (91), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 31/57 (54%), Gaps = 6/57 (10%)

Query: 172 RKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKG--CTQRFSRHDNCLQHYRTH 226
           + Y CK C R F++   L +H R H+GEK    PYK   C ++F+   +   H RTH
Sbjct: 766 KPYKCKTCKRCFSSEETLVQHTRTHSGEK----PYKCHICNKKFAISSSLKIHIRTH 818

>Kwal_47.16577
          Length = 881

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 29/50 (58%), Gaps = 1/50 (2%)

Query: 179 CARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTHLK 228
           C++ F+ S HL RH   H+ EK + C +  C + FSR D   +H+  HL+
Sbjct: 20  CSKSFSRSDHLGRHKANHSSEK-YKCEWPACGREFSRLDVKKKHFGRHLR 68

 Score = 29.6 bits (65), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 16/29 (55%)

Query: 198 GEKNHCCPYKGCTQRFSRHDNCLQHYRTH 226
           G     CP+ GC++ FSR D+  +H   H
Sbjct: 9   GSGPFFCPFPGCSKSFSRSDHLGRHKANH 37

>CAGL0H07557g 738086..739516 some similarities with sp|P32805
           Saccharomyces cerevisiae YGL254w FZF1, hypothetical
           start
          Length = 476

 Score = 41.6 bits (96), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 30/57 (52%), Gaps = 2/57 (3%)

Query: 172 RKYICKI--CARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTH 226
           RKY+C+I  C R F+    LA+H   HT E+ + C    C +RF R  +   H  TH
Sbjct: 55  RKYVCQIDGCKREFSVPSLLAQHRNAHTDERPYVCDEPNCGKRFLRPCHLRVHKWTH 111

>KLLA0F10109g complement(939195..941066) weakly similar to sp|Q00947
           Saccharomyces cerevisiae YDR463w STP1 pre-tRNA splicing
           protein, transcription factor, start by similarity
          Length = 623

 Score = 41.6 bits (96), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 36/74 (48%), Gaps = 14/74 (18%)

Query: 165 EEDLEQRRKYICKICARGFTTSGHLARHNRIHTGEKNHCCPY--------KGC--TQRFS 214
           +E  E   K++C  C   F   G+L RH + H  EK + CP+        K C  T  FS
Sbjct: 233 DEKKETDMKFVCHYCDAEFKMRGYLTRHIKKHAIEKAYHCPFWDASLPSEKRCHSTGGFS 292

Query: 215 RHDNCLQHYRTHLK 228
           R D+    Y+THL+
Sbjct: 293 RRDS----YKTHLR 302

>AFR461C [3653] [Homologous to ScYDR463W (STP1) - SH]
           (1269565..1271199) [1635 bp, 544 aa]
          Length = 544

 Score = 41.6 bits (96), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 33/121 (27%), Positives = 55/121 (45%), Gaps = 22/121 (18%)

Query: 124 SIIQQPENGIVSNDAYNKMANSRYSLKTRKQRTDPRNT-----LSDEEDLE-QRRKYICK 177
           S+ + PE G+      N  A++    ++ ++   PR++     L DE+  E  + +++C 
Sbjct: 98  SMTRTPEGGM--EWKLNAGAHAGTPTQSNEEPLSPRSSSSAAQLKDEDGDELSKERFVCH 155

Query: 178 ICARGFTTSGHLARHNRIHTGEKNHCCPYKG----------CTQRFSRHDNCLQHYRTHL 227
            C   F   G+L RH + H  EK + CP+             T  FSR D     Y+THL
Sbjct: 156 YCDAEFRIRGYLTRHIKKHAVEKAYHCPFFNSHVPPETRCHTTGGFSRRDT----YKTHL 211

Query: 228 K 228
           +
Sbjct: 212 R 212

>Sklu_2389.2 YJL056C, Contig c2389 3525-5828
          Length = 767

 Score = 41.6 bits (96), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 29/48 (60%), Gaps = 2/48 (4%)

Query: 179 CARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTH 226
           C++ FT    L RH ++H+G K   CP+  CT++FS  D   QH RTH
Sbjct: 635 CSKSFTQRQKLLRHLKVHSGYKPFKCPH--CTKKFSTEDILQQHIRTH 680

 Score = 40.4 bits (93), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 29/55 (52%), Gaps = 2/55 (3%)

Query: 172 RKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTH 226
           R + C  C + F TS  L  H R HTGEK   C  K C +RF+   N  +H +TH
Sbjct: 684 RPFKCTYCTKQFATSSSLRIHIRTHTGEKPLKC--KICGKRFNESSNLSKHMKTH 736

 Score = 36.2 bits (82), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 30/55 (54%), Gaps = 2/55 (3%)

Query: 172 RKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTH 226
           + + C  C + F+T   L +H R H+GE+   C Y  CT++F+   +   H RTH
Sbjct: 656 KPFKCPHCTKKFSTEDILQQHIRTHSGERPFKCTY--CTKQFATSSSLRIHIRTH 708

>Sklu_2244.3 , Contig c2244 4100-4915 reverse complement
          Length = 271

 Score = 40.8 bits (94), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 26/53 (49%)

Query: 174 YICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTH 226
           Y C  C + F     L  H  IH G     C +  C+++F+   N L+HYR+H
Sbjct: 216 YCCPKCKKEFKRPSGLRTHMVIHYGRNPFFCKWPNCSKKFNVKSNLLRHYRSH 268

>CAGL0E06116g complement(604708..606549) some similarities with
           tr|Q12132 Saccharomyces cerevisiae YPL230w USV1,
           hypothetical start
          Length = 613

 Score = 41.2 bits (95), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 23/47 (48%), Positives = 26/47 (55%), Gaps = 2/47 (4%)

Query: 179 CARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRT 225
           C   F+ + HLARH R HTGEK   C    C + FSR DN  QH  T
Sbjct: 33  CEMSFSRAEHLARHIRRHTGEKPFKCDI--CLKYFSRIDNLKQHKDT 77

>Scas_719.68
          Length = 1350

 Score = 40.8 bits (94), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 33/59 (55%), Gaps = 7/59 (11%)

Query: 169 EQRRKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTHL 227
           ++ R ++C IC R    + HL RH R HT EK   C +  C + F+R D  L+ Y+T L
Sbjct: 36  DKPRPFLCPICTR----TEHLKRHQRSHTREKPFVCVF--CGRCFARRDLVLR-YQTKL 87

>Scas_378.1
          Length = 208

 Score = 40.0 bits (92), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 26/51 (50%), Gaps = 2/51 (3%)

Query: 174 YICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYR 224
           Y C +C + F     L RH   H+ ++++ CP   C  +  R DN LQH +
Sbjct: 84  YQCHMCVKSFRRHSWLKRHLLAHSSQRHYSCP--KCVSKHKRKDNLLQHLK 132

>CAGL0K04631g complement(440721..443762) some similarities with
           sp|P53243 Saccharomyces cerevisiae YGR067c, hypothetical
           start
          Length = 1013

 Score = 40.8 bits (94), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 27/54 (50%), Gaps = 2/54 (3%)

Query: 172 RKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRT 225
           +++ C  C + F+ S H  RH R H G K   C  + C+  F R D   +H RT
Sbjct: 10  KRHFCSFCNKAFSRSEHKTRHERSHAGVKPFEC--QVCSHSFVRRDLLQRHIRT 61

>CAGL0E04312g 412563..414629 some similarities with sp|Q00947
           Saccharomyces cerevisiae YDR463w STP1 or sp|P38704
           Saccharomyces cerevisiae YHR006w SPT2, hypothetical
           start
          Length = 688

 Score = 40.4 bits (93), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 38/78 (48%), Gaps = 19/78 (24%)

Query: 161 TLSDEEDLEQRRKYICKICARGFTTSGHLARHNRIHTGEKNHCCPY--------KGC--T 210
           TL D+E     ++++C  C   F   G+L RH + H  EK + CP+        K C  +
Sbjct: 190 TLDDDE-----KEFVCHYCDAKFRIRGYLTRHIKKHAIEKAYHCPFYNGQEVPSKRCHNS 244

Query: 211 QRFSRHDNCLQHYRTHLK 228
             FSR D     Y+TH+K
Sbjct: 245 GGFSRRDT----YKTHMK 258

>AFL136W [3059] [Homologous to ScYPL230W - SH; ScYMR182C (RGM1) -
           SH] complement(178780..180009) [1230 bp, 409 aa]
          Length = 409

 Score = 40.0 bits (92), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 30/56 (53%), Gaps = 5/56 (8%)

Query: 170 QRRKYICKI---CARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQH 222
           Q R + C     C R FT + HLARH R  TGEK   C  + C + FSR DN  QH
Sbjct: 16  QPRSFKCTGYGNCDRSFTRAEHLARHIRKQTGEKPSQC--EVCNRFFSRIDNLKQH 69

>CAGL0J01595g 151584..152618 some similarities with tr|Q12531
           Saccharomyces cerevisiae YPR015c or tr|Q12145
           Saccharomyces cerevisiae YPR013c, hypothetical start
          Length = 344

 Score = 39.7 bits (91), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 27/53 (50%)

Query: 176 CKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTHLK 228
           C +C +  +    L  H  IHTG+    C +K C + F+   N L+H ++H K
Sbjct: 286 CPVCGKICSRPSTLKTHILIHTGDTPFKCTWKDCRKAFNVKSNLLRHLKSHEK 338

>YMR070W (MOT3) [4029] chr13 (409153..410625) Transcription factor
           that represses a variety of genes, including ANB1, FUS1,
           and ergosterol biosynthetic genes ERG2, ERG6, and ERG9,
           and activates other genes, including CYC1, LEU2, and
           SUC2, contains two tandem C2H2-type zinc fingers [1473
           bp, 490 aa]
          Length = 490

 Score = 39.7 bits (91), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 28/54 (51%), Gaps = 4/54 (7%)

Query: 173 KYI--CKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYR 224
           KYI  C+ C + F     L RH   H+ +++  CP+  C  R  R DN LQH +
Sbjct: 343 KYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPW--CLSRQKRKDNLLQHMK 394

>KLLA0B03454g complement(314015..315433) some similarities with
           sp|P39933 Saccharomyces cerevisiae YPR186c TFC2 TFIIIA
           (transcription initiation factor), hypothetical start
          Length = 472

 Score = 39.7 bits (91), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 25/45 (55%), Gaps = 2/45 (4%)

Query: 172 RKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRH 216
           + + C IC +G TT   L RH   HT  K+  C Y+GC + F +H
Sbjct: 163 KPFTCSICGKGVTTRQQLKRHEITHT--KSFHCSYEGCNESFYKH 205

 Score = 28.5 bits (62), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 23/50 (46%), Gaps = 4/50 (8%)

Query: 172 RKYICKICARGFTTSGHLARHNRIHTGEKNHCCPY--KGCT--QRFSRHD 217
           + + C  C + F    HL RH   HT +K   C    KG T  Q+  RH+
Sbjct: 135 KPFKCDTCGKEFAKKSHLNRHMFSHTDDKPFTCSICGKGVTTRQQLKRHE 184

>Scas_641.24
          Length = 532

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 36/85 (42%), Gaps = 14/85 (16%)

Query: 154 QRTDPRNTLSDEEDLEQRRKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGC---- 209
           Q  D +    +E++      +IC  C   F   G+L RH + H  EK + CP+       
Sbjct: 163 QLKDSQTPTKEEDEETDDGPFICHYCDAKFRIRGYLTRHIKKHAVEKAYHCPFFNSDILS 222

Query: 210 ------TQRFSRHDNCLQHYRTHLK 228
                 T  FSR D     Y+THLK
Sbjct: 223 ESRCHNTGGFSRRDT----YKTHLK 243

>Scas_602.4d
          Length = 256

 Score = 38.9 bits (89), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 24/51 (47%)

Query: 176 CKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTH 226
           C +C +  +    L  H  IHTG+    C Y GC + F+   N  +H + H
Sbjct: 197 CPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCH 247

>Scas_693.31
          Length = 635

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 29/53 (54%), Gaps = 6/53 (11%)

Query: 172 RKYICKI--CARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQH 222
           R Y C    C + F  +  L RH ++H+ EK++ CP   C ++F+R D  + H
Sbjct: 517 RPYACDFPNCDKAFVRNHDLVRHKKVHS-EKSYACP---CGKKFNREDALIVH 565

 Score = 28.1 bits (61), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 10/48 (20%), Positives = 23/48 (47%)

Query: 179 CARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTH 226
           C + F    +   H + H  ++ + C +  C + F R+ + ++H + H
Sbjct: 496 CGKHFKRRYNTRSHIQTHLEDRPYACDFPNCDKAFVRNHDLVRHKKVH 543

>AGL246W [4066] [Homologous to ScYDR253C (MET32) - SH; ScYPL038W
           (MET31) - SH] complement(240857..241540) [684 bp, 227
           aa]
          Length = 227

 Score = 38.5 bits (88), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 47/104 (45%), Gaps = 10/104 (9%)

Query: 126 IQQPENGIVSNDAYNKMANSRYSLKTRKQRTDPRNTL----SDEEDLEQRRKYICKICAR 181
           + +PE    ++ AY     S   L T+K++T P   L      EE +   +++ C  C  
Sbjct: 99  VARPERAREASLAYL----SEDELLTKKRKTSPGAALEVSGGPEETVNDGKRFHCTKCEL 154

Query: 182 GFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRT 225
            F  SG L RH ++H     + C    C + F+R D   +H+ T
Sbjct: 155 VFRRSGDLRRHEKVHLPILPNICSL--CGKGFARKDALKRHFGT 196

>Kwal_23.5400
          Length = 429

 Score = 38.9 bits (89), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 30/58 (51%), Gaps = 6/58 (10%)

Query: 159 RNTLSDEEDLEQRRKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRH 216
           R+  S  ED    + + C  C +G TT   L RH   HT  ++  CP++GC + F +H
Sbjct: 98  RHMFSHSED----KPFKCSYCGKGVTTKQQLRRHEITHT--RSFVCPHEGCEESFYKH 149

 Score = 32.3 bits (72), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 27/50 (54%), Gaps = 4/50 (8%)

Query: 172 RKYICKICARGFTTSGHLARHNRIHTGEKNHCCPY--KGCT--QRFSRHD 217
           + + C +CAR F+   HL RH   H+ +K   C Y  KG T  Q+  RH+
Sbjct: 79  KPFQCTVCARQFSRKTHLERHMFSHSEDKPFKCSYCGKGVTTKQQLRRHE 128

>CAGL0J05060g 478650..480791 similar to sp|P47043 Saccharomyces
           cerevisiae YJL056c ZAP1 metalloregulatory protein,
           hypothetical start
          Length = 713

 Score = 38.9 bits (89), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 36/74 (48%), Gaps = 9/74 (12%)

Query: 162 LSDEEDLEQRRK-------YICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFS 214
            S E+ L Q ++       Y C IC + F  S  L  H R HTGEK   C  K C + F+
Sbjct: 606 FSTEDTLNQHKRVHSGEKPYECHICHKRFAISNSLKIHIRTHTGEKPLKC--KVCGRCFN 663

Query: 215 RHDNCLQHYRTHLK 228
              N  +H +TH+K
Sbjct: 664 ESSNLSKHMKTHMK 677

 Score = 36.6 bits (83), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 32/57 (56%), Gaps = 6/57 (10%)

Query: 172 RKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKG--CTQRFSRHDNCLQHYRTH 226
           + Y C  C + F+T   L +H R+H+GEK    PY+   C +RF+  ++   H RTH
Sbjct: 595 KPYQCPQCQKCFSTEDTLNQHKRVHSGEK----PYECHICHKRFAISNSLKIHIRTH 647

 Score = 30.0 bits (66), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 29/58 (50%), Gaps = 4/58 (6%)

Query: 171 RRKYICKI--CARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTH 226
           + +Y C+   C + F+    L RH ++H+  K + CP   C + FS  D   QH R H
Sbjct: 564 KSQYTCEWEGCNKTFSQRQKLVRHLKVHSKYKPYQCPQ--CQKCFSTEDTLNQHKRVH 619

 Score = 30.0 bits (66), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 25/101 (24%), Positives = 47/101 (46%), Gaps = 6/101 (5%)

Query: 133 IVSNDAYNKMANSRYSLKTRKQRTDPRNTLSDEEDLEQRRKYICKI--CARGFTTSGHLA 190
           ++  +  N + NS  S +TR ++   R+    E       ++ CK   C   F ++G L 
Sbjct: 494 MIKAEQENDLNNSN-STRTRARQRVSRSKKLPEPTKPDETEFCCKWAGCNERFKSAGDLN 552

Query: 191 RH-NRIHT--GEKNHCCPYKGCTQRFSRHDNCLQHYRTHLK 228
            H   +H   G+  + C ++GC + FS+    ++H + H K
Sbjct: 553 DHLEEMHLTKGKSQYTCEWEGCNKTFSQRQKLVRHLKVHSK 593

>CAGL0K03003g 276756..278699 weakly similar to sp|P54785
           Saccharomyces cerevisiae YMR070w MOT3, hypothetical
           start
          Length = 647

 Score = 38.5 bits (88), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 25/49 (51%), Gaps = 2/49 (4%)

Query: 176 CKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYR 224
           C +C + F     L RH   H+ +++  CP+  C  R  R DN LQH +
Sbjct: 536 CHLCPKLFKRKSWLKRHLLSHSQQRHFLCPW--CNSRHKRRDNLLQHMK 582

>Kwal_47.18337
          Length = 536

 Score = 38.5 bits (88), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 39/86 (45%), Gaps = 19/86 (22%)

Query: 158 PRNTLSDEEDLEQ-----RRKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGC--- 209
           P +  S  ED E+     +++++C  C   F   G+L RH + H  EK + CP+      
Sbjct: 136 PESNGSKTEDEEKDAHKGQKRFVCHYCNAEFYIRGYLTRHIKKHAVEKAYYCPFFNADAP 195

Query: 210 -------TQRFSRHDNCLQHYRTHLK 228
                  T  FSR D     Y+THL+
Sbjct: 196 KDARCHTTGGFSRRDT----YKTHLR 217

>ADL040W [1701] [Homologous to ScYPR013C - SH]
           complement(618855..619847) [993 bp, 330 aa]
          Length = 330

 Score = 38.1 bits (87), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 26/51 (50%)

Query: 176 CKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTH 226
           C +C R  T    L  H  IHTGE    C + GC++RF+   N  +H  +H
Sbjct: 260 CLVCGRRCTRPSTLKTHMLIHTGELPFQCSWPGCSKRFNVRSNMNRHVNSH 310

>CAGL0G10021g complement(959154..960338) similar to sp|P39933
           Saccharomyces cerevisiae YPR186c TFC2, hypothetical
           start
          Length = 394

 Score = 38.1 bits (87), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 22/45 (48%), Gaps = 2/45 (4%)

Query: 172 RKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRH 216
           R + C  C +G  T   L RH   HT   N  C Y+GC + F +H
Sbjct: 93  RPFYCSFCGKGLITRQQLKRHEVTHTKSFN--CEYEGCNESFYKH 135

 Score = 29.3 bits (64), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 23/51 (45%), Gaps = 4/51 (7%)

Query: 171 RRKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKG----CTQRFSRHD 217
           R+ + C  C   FT   HL RH   HT E+   C + G      Q+  RH+
Sbjct: 64  RKPWKCNQCESSFTKKIHLERHLYTHTDERPFYCSFCGKGLITRQQLKRHE 114

>YPR186C (PZF1) [5600] chr16 complement(909727..911016) RNA
           polymerase III transcription initiation factor TFIIIA,
           has nine C2H2-type zinc fingers [1290 bp, 429 aa]
          Length = 429

 Score = 38.1 bits (87), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 24/45 (53%), Gaps = 2/45 (4%)

Query: 172 RKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRH 216
           + + C  C +G TT   L RH   HT  K+  CP +GC  RF +H
Sbjct: 106 KPFQCSYCGKGVTTRQQLKRHEVTHT--KSFICPEEGCNLRFYKH 148

 Score = 31.6 bits (70), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 24/50 (48%), Gaps = 4/50 (8%)

Query: 172 RKYICKICARGFTTSGHLARHNRIHTGEKNHCCPY--KGCT--QRFSRHD 217
           R + C  CA+ F    HL RH   H+  K   C Y  KG T  Q+  RH+
Sbjct: 78  RAFQCDKCAKSFVKKSHLERHLYTHSDTKPFQCSYCGKGVTTRQQLKRHE 127

>CAGL0L00583g 69547..70713 similar to tr|Q12132 Saccharomyces
           cerevisiae YPL230w USV1, hypothetical start
          Length = 388

 Score = 37.7 bits (86), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 23/41 (56%), Gaps = 2/41 (4%)

Query: 182 GFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQH 222
            FT + H ARH R HTGEK   C    C + FSR DN  QH
Sbjct: 2   AFTRAEHHARHIRKHTGEKPFQCDI--CMKFFSRIDNLKQH 40

>AEL278W [2227] [Homologous to ScYPR186C (PZF1) - SH]
           complement(117043..118473) [1431 bp, 476 aa]
          Length = 476

 Score = 37.7 bits (86), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 26/45 (57%), Gaps = 2/45 (4%)

Query: 172 RKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRH 216
           + + C +C +G TT   L RH   HT  K+  CP++GC + F +H
Sbjct: 176 KPFSCTVCGKGVTTRQQLRRHEITHT--KSFKCPHEGCGEAFYKH 218

>KLLA0A10373g complement(907244..907864) some similarities with
           ca|CA1157|CaPZF1 Candida albicans TFIIIA (transcription
           initiation factor) (by homology), hypothetical start
          Length = 206

 Score = 37.0 bits (84), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 34/64 (53%), Gaps = 3/64 (4%)

Query: 168 LEQR-RKYICKI--CARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYR 224
           +E+R ++Y+C I  C + ++    L +H R HT EK   CP  GC + F R  +   H  
Sbjct: 1   MEKRPKRYVCPIESCGKKYSRPCLLRQHVRSHTNEKPFHCPEPGCDKAFLRPSHLRVHML 60

Query: 225 THLK 228
           +H K
Sbjct: 61  SHSK 64

 Score = 32.0 bits (71), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 21/42 (50%), Gaps = 4/42 (9%)

Query: 172 RKYICKICARGFTTSGHLARHNRIHTGEKN----HCCPYKGC 209
           + Y C +C +GF T     RH + HT  ++    + C Y GC
Sbjct: 66  KPYNCSVCGKGFATKQQFQRHQQTHTQNQDDTSTYQCGYYGC 107

>Sklu_1527.1 YPL038W, Contig c1527 389-1006
          Length = 205

 Score = 37.0 bits (84), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 31/66 (46%), Gaps = 2/66 (3%)

Query: 160 NTLSDEEDLEQRRKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNC 219
           +++ D + L + +KY C  C   F  S  L RH R H     + C    C + F+R D  
Sbjct: 111 DSVEDVQQLNEDKKYQCDKCELVFRRSSDLRRHERAHLPILPNICSL--CGKGFARKDAL 168

Query: 220 LQHYRT 225
            +HY T
Sbjct: 169 KRHYDT 174

>KLLA0C16005g 1397274..1398269 some similarities with sgd|S0006151
           Saccharomyces cerevisiae YPL230w USV1, hypothetical
           start
          Length = 331

 Score = 37.4 bits (85), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 22/47 (46%), Positives = 25/47 (53%), Gaps = 2/47 (4%)

Query: 179 CARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRT 225
           C   FT   HLARH R HTGE+   C    C + FSR DN  QH  +
Sbjct: 28  CRMEFTRQEHLARHIRKHTGEQPFQC--HLCLRFFSRLDNLKQHVES 72

>Scas_660.12
          Length = 367

 Score = 37.4 bits (85), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 30/66 (45%), Gaps = 14/66 (21%)

Query: 173 KYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGC----------TQRFSRHDNCLQH 222
           +Y+C  C   F   G+L RH + H  EK + CP+             +  FSR D     
Sbjct: 95  EYVCHYCQAKFRIKGYLTRHIKKHAVEKAYHCPFFSTESPPELRCHNSGGFSRRDT---- 150

Query: 223 YRTHLK 228
           Y+THLK
Sbjct: 151 YKTHLK 156

>YPL038W (MET31) [5401] chr16 (480530..481063) Zinc-finger protein
           involved in transcriptional regulation of methionine
           metabolism, has two tandem C2H2-type zinc fingers [534
           bp, 177 aa]
          Length = 177

 Score = 36.6 bits (83), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 47/104 (45%), Gaps = 9/104 (8%)

Query: 123 SSIIQQPENGIVSNDAYNKMANSRYSL-KTRKQRTDPRNTLSDEEDLEQRRKYICKICAR 181
           S++I  PEN + + +  N MA     + +T+ +RT   N   +   L     Y C  C  
Sbjct: 49  SAVIPAPENVLKAGEPEN-MARGLIRIPETQTKRTGGNNHSKEGAQL-----YSCAKCQL 102

Query: 182 GFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRT 225
            F+ S  L RH ++H+    H C    C + F+R D   +H  T
Sbjct: 103 KFSRSSDLRRHEKVHSLVLPHIC--SNCGKGFARKDALKRHSNT 144

>Sklu_2154.3 , Contig c2154 4677-5249 reverse complement
          Length = 190

 Score = 36.6 bits (83), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 32/73 (43%), Gaps = 10/73 (13%)

Query: 162 LSDEEDLEQRRKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKG------CTQRFSR 215
           LS E     R  + C  C   F   G+L RH + H   K++ CPY         T  FSR
Sbjct: 66  LSPELGAVHREIFQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSR 125

Query: 216 HDNCLQHYRTHLK 228
            D     ++THLK
Sbjct: 126 KDT----FKTHLK 134

>Scas_627.6
          Length = 1207

 Score = 37.4 bits (85), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 31/69 (44%), Gaps = 8/69 (11%)

Query: 168 LEQRRKYICK--ICARGFTTSGHLARHNRIHTGEKNHCCPY------KGCTQRFSRHDNC 219
           L    +YIC    C + FT   HL+RH   H  ++   CP+        C + F R D  
Sbjct: 36  LAVTERYICPHPDCNKSFTRQEHLSRHKLNHWPKEIFVCPFIFPNTNITCNKTFVRKDLL 95

Query: 220 LQHYRTHLK 228
           ++H + H K
Sbjct: 96  IRHQKRHTK 104

>CAGL0I02816g complement(247817..248692) similar to sp|P41696
           Saccharomyces cerevisiae YOR113w AZF1 asparagine-rich
           zinc finger protein, hypothetical start
          Length = 291

 Score = 36.6 bits (83), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 23/51 (45%)

Query: 172 RKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQH 222
           + Y C IC + F+  G+LA H   H   +   C    C + FS+  N   H
Sbjct: 9   KPYECDICKKRFSRKGNLAAHKMTHGKIRPFICKLDNCNKSFSQLGNMKSH 59

 Score = 28.5 bits (62), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 17/32 (53%), Gaps = 2/32 (6%)

Query: 197 TGEKNHCCPYKGCTQRFSRHDNCLQHYRTHLK 228
           TGEK + C    C +RFSR  N   H  TH K
Sbjct: 6   TGEKPYECDI--CKKRFSRKGNLAAHKMTHGK 35

>YHR006W (STP2) [2292] chr8 (117808..119433) Transcription factor
           involved in regulating transcription of amino acid
           permease genes, functions redundantly with Stp1p, which
           is involved in tRNA splicing and branched-chain amino
           acid uptake [1626 bp, 541 aa]
          Length = 541

 Score = 37.0 bits (84), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 34/129 (26%), Positives = 53/129 (41%), Gaps = 29/129 (22%)

Query: 125 IIQQP--ENGIVSNDAYNKMANSRY--------SLKTRKQRTDPRNTLSDE-----EDLE 169
           +I  P  E   ++ND Y  +  S +         +    +++   + LSDE     ++  
Sbjct: 140 LISSPPLEESYINNDQYKALFPSNFLPITPVSSVITPASKKSIDESPLSDEVQGIADESS 199

Query: 170 QRRKYICKICARGFTTSGHLARHNRIHTGEKNHCCPY--KGCTQR--------FSRHDNC 219
           +   YIC  C   F   G+L RH + H   K + CP+     +Q         FSR D  
Sbjct: 200 ETLPYICHYCDARFRIRGYLTRHIKKHAKRKAYHCPFFDNSISQELRCHTSGGFSRRDT- 258

Query: 220 LQHYRTHLK 228
              Y+THLK
Sbjct: 259 ---YKTHLK 264

>Kwal_26.8021
          Length = 507

 Score = 37.0 bits (84), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 24/52 (46%), Gaps = 2/52 (3%)

Query: 174 YICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRT 225
           Y C +C + F       RH   H+  K + CP+  C  R  R DN  QH +T
Sbjct: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPW--CQSRHKRRDNLFQHMKT 438

>Scas_602.4
          Length = 266

 Score = 36.2 bits (82), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 26/52 (50%), Gaps = 4/52 (7%)

Query: 177 KICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTHLK 228
           KIC+R  T    L  H  IHTG+    C +  C + F+   N L+H + H K
Sbjct: 207 KICSRPST----LKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHEK 254

>KLLA0E18645g complement(1648263..1649558) some similarities with
           sp|P54785 Saccharomyces cerevisiae YMR070w HMS1
           high-copy suppressor of MOT1-SPT3 synthetic lethality
           singleton, hypothetical start
          Length = 431

 Score = 36.6 bits (83), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 25/56 (44%), Gaps = 2/56 (3%)

Query: 169 EQRRKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYR 224
           E    Y C +C + F     L RH   H+  K   CP+  C+    R DN LQH +
Sbjct: 301 ESHHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPW--CSSTHKRKDNLLQHLK 354

>YDR463W (STP1) [1281] chr4 (1386804..1388363) Transcription factor
           involved in regulating transcription of amino acid
           permease genes and involved in pre-tRNA splicing of
           specific tRNA species, has three C2H2-type zinc fingers
           [1560 bp, 519 aa]
          Length = 519

 Score = 36.6 bits (83), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 30/66 (45%), Gaps = 14/66 (21%)

Query: 173 KYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGC----------TQRFSRHDNCLQH 222
           ++IC  C   F   G+L RH + H  EK + CP+             +  FSR D     
Sbjct: 159 EFICHYCDATFRIRGYLTRHIKKHAIEKAYHCPFFNSATPPDLRCHNSGGFSRRDT---- 214

Query: 223 YRTHLK 228
           Y+THLK
Sbjct: 215 YKTHLK 220

>AEL174W [2332] [Homologous to ScYJL056C (ZAP1) - SH]
           complement(310950..312935) [1986 bp, 661 aa]
          Length = 661

 Score = 36.6 bits (83), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 28/55 (50%), Gaps = 2/55 (3%)

Query: 172 RKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTH 226
           R + C  C + F+TS  L  H R HTGEK   C    C +RF+   N  +H + H
Sbjct: 570 RPFHCHYCRKQFSTSSSLRVHIRTHTGEKPLSCTV--CGKRFNESSNLSKHMKIH 622

 Score = 34.3 bits (77), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 28/51 (54%), Gaps = 2/51 (3%)

Query: 176 CKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTH 226
           C  C + F+T   LA+H R H+GE+   C Y  C ++FS   +   H RTH
Sbjct: 546 CPHCPKTFSTDDILAQHIRTHSGERPFHCHY--CRKQFSTSSSLRVHIRTH 594

>Scas_712.2
          Length = 327

 Score = 36.2 bits (82), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 31/61 (50%), Gaps = 2/61 (3%)

Query: 170 QRRKYICKI--CARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTHL 227
           +++ Y C+   C R FT    L +H   HT E+ + C  +GC +RF R  +   H  TH 
Sbjct: 9   KKKVYKCQFEGCHREFTRPCLLQQHRYSHTNERPYICDVEGCGKRFMRPCHLKVHKWTHS 68

Query: 228 K 228
           K
Sbjct: 69  K 69

>AFR531W [3723] [Homologous to ScAFR531W]
           complement(1389487..1390311) [825 bp, 274 aa]
          Length = 274

 Score = 35.8 bits (81), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 29/61 (47%), Gaps = 10/61 (16%)

Query: 174 YICKICARGFTTSGHLARHNRIHTGEKNHCCPY--KGC----TQRFSRHDNCLQHYRTHL 227
           Y C  C   F   G+L RH + H   K+  CPY  + C    +  FSR D     +RTHL
Sbjct: 156 YRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDT----FRTHL 211

Query: 228 K 228
           K
Sbjct: 212 K 212

>CAGL0M04323g complement(474158..476269) similar to sp|P21192
           Saccharomyces cerevisiae YLR131c ACE2 or sp|P08153
           Saccharomyces cerevisiae YDR146c SWI5, hypothetical
           start
          Length = 703

 Score = 35.8 bits (81), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 28/50 (56%)

Query: 179 CARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTHLK 228
           C + F    ++  H + H  +K + C ++GCT+ F R+ +  +H +TH K
Sbjct: 530 CGKFFRRRYNIKSHIQTHLEDKPYKCDFEGCTKAFVRNHDLARHKKTHDK 579

>CAGL0E01331g 124362..126431 weakly similar to sp|P08153
           Saccharomyces cerevisiae YDR146c transcription factor,
           hypothetical start
          Length = 689

 Score = 35.8 bits (81), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 37/78 (47%), Gaps = 2/78 (2%)

Query: 151 TRKQRTDPRNTLSDEEDLEQRRKYIC--KICARGFTTSGHLARHNRIHTGEKNHCCPYKG 208
           TRK  T PR ++         R Y C    C + F    ++  H + H  ++ + C Y G
Sbjct: 533 TRKLTTLPRGSIDVYVKELPDRMYECLYPQCGKTFKRRYNIRSHIQTHLEDRPYRCDYDG 592

Query: 209 CTQRFSRHDNCLQHYRTH 226
           C + F R+ + ++H +TH
Sbjct: 593 CDKAFVRNHDLVRHKKTH 610

>Scas_604.4
          Length = 585

 Score = 35.0 bits (79), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 22/40 (55%), Gaps = 2/40 (5%)

Query: 188 HLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTHL 227
           H+  H R+H   K   C  K CT++F R  +  +H RTHL
Sbjct: 233 HITSHLRVHVPLKPFAC--KKCTKKFKRPQDLKKHLRTHL 270

>Kwal_34.15946
          Length = 279

 Score = 34.7 bits (78), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 27/61 (44%), Gaps = 10/61 (16%)

Query: 174 YICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQR------FSRHDNCLQHYRTHL 227
           + C  C   F   G+L RH + H   K+  CP+     R      FSR D     Y+THL
Sbjct: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDT----YKTHL 228

Query: 228 K 228
           K
Sbjct: 229 K 229

>AGL197W [4115] [Homologous to ScYDR146C (SWI5) - SH; ScYLR131C
           (ACE2) - SH] complement(325717..328251) [2535 bp, 844
           aa]
          Length = 844

 Score = 34.7 bits (78), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 41/90 (45%), Gaps = 19/90 (21%)

Query: 140 NKMANSRYSLKTRKQRTDPRNTLSDEEDLEQRRKYIC--KICARGFTTSGHLARHNRIHT 197
            K+ N RY++++  Q       L D       R + C  + C + F  +  L RH + H 
Sbjct: 682 GKLFNRRYNIRSHIQ-----THLED-------RPFRCDHEGCTKAFVRNHDLIRHKKTHA 729

Query: 198 GEKNHCCPYKGCTQRFSRHDNCLQHYRTHL 227
            EK   CP   C ++FSR D  L H RT +
Sbjct: 730 -EKTFTCP---CGKKFSREDALLTH-RTRM 754

 Score = 31.6 bits (70), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 13/48 (27%), Positives = 27/48 (56%)

Query: 179 CARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTH 226
           C + F    ++  H + H  ++   C ++GCT+ F R+ + ++H +TH
Sbjct: 681 CGKLFNRRYNIRSHIQTHLEDRPFRCDHEGCTKAFVRNHDLIRHKKTH 728

>CAGL0K06413g 627811..628890 some similarities with sp|Q00947
           Saccharomyces cerevisiae YDR463w STP1, hypothetical
           start
          Length = 359

 Score = 34.3 bits (77), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 26/49 (53%), Gaps = 4/49 (8%)

Query: 162 LSDEEDLEQRR----KYICKICARGFTTSGHLARHNRIHTGEKNHCCPY 206
           L  EE++ + R    +++C  C   F   G+L RH + H  +K + CPY
Sbjct: 25  LVKEEEVSKTRHEQEEFVCHYCDARFKIRGYLTRHIKKHALQKAYYCPY 73

>YDR253C (MET32) [1086] chr4 complement(963982..964557) Zinc-finger
           protein involved in transcriptional regulation of
           methionine metabolism, has two tandem C2H2-type zinc
           fingers [576 bp, 191 aa]
          Length = 191

 Score = 33.9 bits (76), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 27/54 (50%), Gaps = 2/54 (3%)

Query: 172 RKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRT 225
           +++ C  C+  F+ S  L RH + H     + CP   C + F+R D   +HY T
Sbjct: 96  KRFKCAKCSLEFSRSSDLRRHEKTHFAILPNICPQ--CGKGFARKDALKRHYDT 147

>ADL050W [1691] [Homologous to NOHBY] complement(597229..597669)
           [441 bp, 146 aa]
          Length = 146

 Score = 33.5 bits (75), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 23/51 (45%)

Query: 176 CKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTH 226
           C +C + FT    L  H  IH   + + C Y  C + F+   N  +H R H
Sbjct: 78  CPVCLKEFTRKTSLNTHLLIHADIRPYLCDYANCNKSFNVKSNLNRHLRIH 128

>AGL071C [4240] [Homologous to ScYMR070W (MOT3) - SH]
           (574723..575913) [1191 bp, 396 aa]
          Length = 396

 Score = 34.3 bits (77), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 26/63 (41%), Gaps = 4/63 (6%)

Query: 162 LSDEEDLEQRRKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQ 221
           L D    E   K  C  C + F     L RH   H+  K + CP+  C  R  R DN  Q
Sbjct: 175 LMDLNSFENIHK--CHFCEKAFKRKSWLKRHLLSHSTMKPYSCPW--CHSRHKRKDNLSQ 230

Query: 222 HYR 224
           H +
Sbjct: 231 HLK 233

>Scas_631.7
          Length = 433

 Score = 34.3 bits (77), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 23/43 (53%), Gaps = 2/43 (4%)

Query: 174 YICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRH 216
           + C  C +G TT   L RH   HT  K+  CPY+ C + + +H
Sbjct: 116 FCCLHCGKGVTTRQQLKRHEVTHT--KSFKCPYENCDEAYYKH 156

 Score = 28.9 bits (63), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 25/48 (52%), Gaps = 4/48 (8%)

Query: 174 YICKICARGFTTSGHLARHNRIHTGEKNHCCPY--KGCT--QRFSRHD 217
           + C+ C + F+   HL RH   H+  K  CC +  KG T  Q+  RH+
Sbjct: 88  FKCEQCDKQFSRKTHLERHLISHSDSKPFCCLHCGKGVTTRQQLKRHE 135

>YLR131C (ACE2) [3541] chr12 complement(404511..406823)
           Metallothionein expression activator with similarity to
           Swi5p, has three tandem C2H2-type zinc fingers [2313 bp,
           770 aa]
          Length = 770

 Score = 34.3 bits (77), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 26/55 (47%), Gaps = 6/55 (10%)

Query: 170 QRRKYICKI--CARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQH 222
           Q R Y C    C + F  +  L RH   H  +K + CP   C +RF+R D  + H
Sbjct: 629 QDRPYSCDFPGCTKAFVRNHDLIRHKISHNAKK-YICP---CGKRFNREDALMVH 679

 Score = 31.6 bits (70), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 12/48 (25%), Positives = 26/48 (54%)

Query: 179 CARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTH 226
           C + F    ++  H + H  ++ + C + GCT+ F R+ + ++H  +H
Sbjct: 610 CNKVFKRRYNIRSHIQTHLQDRPYSCDFPGCTKAFVRNHDLIRHKISH 657

>YDR146C (SWI5) [991] chr4 complement(748607..750736) Transcription
           factor that controls cell cycle-specific transcription
           of HO, has three tandem C2H2-type zinc fingers [2130 bp,
           709 aa]
          Length = 709

 Score = 33.9 bits (76), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 18/78 (23%), Positives = 37/78 (47%), Gaps = 2/78 (2%)

Query: 151 TRKQRTDPRNTLSDEEDLEQRRKYICKI--CARGFTTSGHLARHNRIHTGEKNHCCPYKG 208
           TRK  T PR ++         + + C    C + F    ++  H + H  ++ + C + G
Sbjct: 527 TRKLTTLPRGSIDKYVKEMPDKTFECLFPGCTKTFKRRYNIRSHIQTHLEDRPYSCDHPG 586

Query: 209 CTQRFSRHDNCLQHYRTH 226
           C + F R+ + ++H ++H
Sbjct: 587 CDKAFVRNHDLIRHKKSH 604

 Score = 29.3 bits (64), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 17/30 (56%)

Query: 199 EKNHCCPYKGCTQRFSRHDNCLQHYRTHLK 228
           +K   C + GCT+ F R  N   H +THL+
Sbjct: 547 DKTFECLFPGCTKTFKRRYNIRSHIQTHLE 576

>Sklu_2289.1 YGL254W, Contig c2289 150-1025 reverse complement
          Length = 291

 Score = 33.1 bits (74), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 28/57 (49%), Gaps = 2/57 (3%)

Query: 172 RKYICKI--CARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTH 226
           +KY+C +  C + ++    L +H R HT E+   C   GC + F R  +   H  +H
Sbjct: 6   KKYLCSVDGCGKMYSRPCLLEQHRRSHTNERPFVCEEPGCGKGFLRASHLKVHKWSH 62

 Score = 33.1 bits (74), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 27/69 (39%), Gaps = 25/69 (36%)

Query: 170 QRRKYICKICARGFTTSGHLARHNRIH-------------------TGEKNHC------C 204
           Q +   C +C++GFTT+  L+RH + H                    G    C      C
Sbjct: 64  QVKPLACPVCSKGFTTNQQLSRHKKTHKDLPSPPQEQLNDKDTAGGDGRVEDCNPNTVAC 123

Query: 205 PYKGCTQRF 213
            Y GCT+ F
Sbjct: 124 TYSGCTESF 132

 Score = 32.3 bits (72), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 29/57 (50%), Gaps = 4/57 (7%)

Query: 172 RKYICK--ICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTH 226
           R ++C+   C +GF  + HL  H   H+  K   CP   C++ F+ +    +H +TH
Sbjct: 36  RPFVCEEPGCGKGFLRASHLKVHKWSHSQVKPLACPV--CSKGFTTNQQLSRHKKTH 90

>Scas_713.52
          Length = 620

 Score = 33.5 bits (75), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 12/48 (25%), Positives = 26/48 (54%)

Query: 179 CARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTH 226
           C + F    ++  H + H  +K + C + GC + F R+ + ++H ++H
Sbjct: 487 CGKIFKRRYNVRSHIQTHLEDKPYACDFPGCEKAFVRNHDLVRHKKSH 534

>KLLA0D16456g complement(1387846..1390410) weakly similar to
           sp|P21192 Saccharomyces cerevisiae YLR131c ACE2
           metallothionein expression activator, hypothetical start
          Length = 854

 Score = 33.5 bits (75), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 34/71 (47%), Gaps = 11/71 (15%)

Query: 169 EQRRKYICKI-----------CARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHD 217
           EQ  KYI +I           C + F    +   H + H  ++ + C + GC + F R+ 
Sbjct: 679 EQIDKYILEIGPKQFQCKFKDCQKRFNRRYNARTHIQTHLCDRPYKCDFPGCQKAFVRNH 738

Query: 218 NCLQHYRTHLK 228
           + L+H ++HL+
Sbjct: 739 DLLRHKKSHLE 749

>KLLA0F07073g 675221..676897 some similarities with sgd|S0004367
           Saccharomyces cerevisiae YLR375w STP3 involved in
           pre-tRNA splicing and in uptake of branched-chain amino
           acids, hypothetical start
          Length = 558

 Score = 33.1 bits (74), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 18/27 (66%)

Query: 170 QRRKYICKICARGFTTSGHLARHNRIH 196
           + R + C++C+RGF  S  L RH ++H
Sbjct: 407 ETRPFKCEVCSRGFARSNDLIRHKKLH 433

>Kwal_27.11824
          Length = 199

 Score = 32.0 bits (71), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 26/60 (43%), Gaps = 2/60 (3%)

Query: 166 EDLEQRRKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRT 225
           ED    +K+ C  C   F  S  L RH R H     + C    C + F+R D   +H+ T
Sbjct: 111 EDDAGAKKFPCAKCELVFRRSSDLRRHERAHLPILPNICSL--CGKGFARKDALKRHFDT 168

>Kwal_56.23925
          Length = 745

 Score = 32.7 bits (73), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 12/48 (25%), Positives = 27/48 (56%)

Query: 179 CARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTH 226
           C + F    ++  H + H  ++ + C ++GC + F R+ + ++H +TH
Sbjct: 592 CGKTFRRRYNIRSHIQTHLEDRPYFCDFEGCHKAFVRNHDLIRHKKTH 639

>Scas_717.60d
          Length = 167

 Score = 31.6 bits (70), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 26/58 (44%), Gaps = 1/58 (1%)

Query: 166 EDLEQRRKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHY 223
           E L     + CK C++ F TS  L +H +    ++   C Y  C + F R D    HY
Sbjct: 91  EILTSNELFNCKECSKAFVTSQKLKKHTKDAHSKRMFPCEY-NCGKAFKRKDQRKSHY 147

>Kwal_26.9300
          Length = 304

 Score = 31.6 bits (70), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 33/67 (49%), Gaps = 3/67 (4%)

Query: 162 LSDEEDLEQRRKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQ 221
           +S +   + RRK  C IC   F  +    R + +    K H CP   C + F+RH++ L+
Sbjct: 134 VSSKPASKPRRKKECPIC-HNFYANLSTHRSSHLQPENKPHKCPV--CGRGFTRHNDLLR 190

Query: 222 HYRTHLK 228
           H + H K
Sbjct: 191 HRKRHWK 197

 Score = 28.9 bits (63), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 22/50 (44%), Gaps = 12/50 (24%)

Query: 170 QRRKYICKICARGFTTSGHLARHNRIH-TGEKNHC-----------CPYK 207
           + + + C +C RGFT    L RH + H   E N C           CPYK
Sbjct: 169 ENKPHKCPVCGRGFTRHNDLLRHRKRHWKDEDNSCSSYNPNQGTFRCPYK 218

>AGR186C [4497] [Homologous to NOHBY] (1099513..1100376) [864 bp,
           287 aa]
          Length = 287

 Score = 31.2 bits (69), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 24/52 (46%), Gaps = 2/52 (3%)

Query: 175 ICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTH 226
           IC +C + FT    L  H  IHT  K   C +  C + F+   N  +H R H
Sbjct: 168 ICPLCGKSFTRRSTLQIHLLIHTNLKPFKCSF--CDKEFNVKSNLNRHERIH 217

>Sklu_2359.5 YPR022C, Contig c2359 10655-12818
          Length = 722

 Score = 31.6 bits (70), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 30/64 (46%), Gaps = 8/64 (12%)

Query: 171 RRKYICKI--CARGFTTSGHLARHNRIHTGEKNHCCPY------KGCTQRFSRHDNCLQH 222
           + +Y+C    C++ FT   HL+RH   H  ++   C Y        C + F R D  ++H
Sbjct: 13  KPRYVCPHPNCSKSFTRQEHLSRHKLNHWPKEIFRCHYVYPEDGVACNRTFVRRDLLVRH 72

Query: 223 YRTH 226
            + H
Sbjct: 73  EKRH 76

>CAGL0E03762g complement(351003..352757) weakly similar to sp|P33400
           Saccharomyces cerevisiae YHL027w RIM101 meiotic
           regulatory protein, hypothetical start
          Length = 584

 Score = 31.2 bits (69), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 21/49 (42%), Gaps = 2/49 (4%)

Query: 179 CARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTHL 227
           C        H+  H R+H   K   C    C++RF R  +  +H + HL
Sbjct: 196 CTSKTEKRDHMTSHLRVHVPLKPFAC--STCSKRFKRPQDLKKHLKIHL 242

 Score = 30.4 bits (67), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 29/120 (24%), Positives = 48/120 (40%), Gaps = 15/120 (12%)

Query: 120 TCNSSIIQQPENGIVSNDAYNKMANSRYSLKTRKQR---TDP-RNTLSDEEDLEQRRKYI 175
           T   S++ +P       D Y+    + Y +  +K+    T+P + T  D      +   I
Sbjct: 98  TSIKSLVNEPN---TPTDMYHPKIKTEYDMTIKKESPTSTEPLKETTKDTSKDTPKETLI 154

Query: 176 CKI--CARGFTTSGHLARHN-RIHTGEKNHC-----CPYKGCTQRFSRHDNCLQHYRTHL 227
           CK   C R F  +  L  H  + H G K+       C +  CT +  + D+   H R H+
Sbjct: 155 CKWSHCYREFQQAELLYHHLCQEHVGRKSQKNLQLKCQWDNCTSKTEKRDHMTSHLRVHV 214

>Scas_568.5
          Length = 199

 Score = 30.4 bits (67), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 24/54 (44%), Gaps = 2/54 (3%)

Query: 172 RKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRT 225
           ++Y C  C   F  S  L RH + H     H C    C + F+R D   +H+ T
Sbjct: 116 KRYPCSKCELIFLRSSDLRRHEKAHLLVLPHICSQ--CGKGFARKDALKRHFNT 167

>CAGL0H04873g complement(465069..466424) some similarities with
           tr|Q05937 Saccharomyces cerevisiae YLR375w STP3 or
           tr|Q07351 Saccharomyces cerevisiae YDL048c STP4,
           hypothetical start
          Length = 451

 Score = 30.8 bits (68), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 9/29 (31%), Positives = 17/29 (58%)

Query: 172 RKYICKICARGFTTSGHLARHNRIHTGEK 200
           + ++C +C RGF     + RH ++H  +K
Sbjct: 289 KPFVCSVCQRGFVRQNDVMRHEKMHWKDK 317

>YPR022C (YPR022C) [5456] chr16 complement(603906..607307) Predicted
           transcription factor with two tandem C2H2-type zinc
           fingers, contains Q/N-rich regions which may mediate
           prion-like aggregation [3402 bp, 1133 aa]
          Length = 1133

 Score = 30.8 bits (68), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 39/95 (41%), Gaps = 10/95 (10%)

Query: 142 MANSRYSLKTRKQRTDPRNTLSDEEDLEQRRKYICK--ICARGFTTSGHLARHNRIHTGE 199
           M     + + RK+  D  N LS         ++ C    C + F+   HL+RH   H  +
Sbjct: 1   MHGKELAGRLRKREND--NDLSPNSSSSPAERFRCPHPECNKTFSRQEHLSRHKLNHWPK 58

Query: 200 KNHCCPY------KGCTQRFSRHDNCLQHYRTHLK 228
           + + C Y        C + F R D  ++H + H K
Sbjct: 59  EIYVCSYVLPTTNAPCNKTFVRKDLLIRHEKRHSK 93

>Scas_670.2
          Length = 435

 Score = 30.0 bits (66), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 31/61 (50%), Gaps = 7/61 (11%)

Query: 170 QRRKYICKICARGFTTSGHLARHNRIH--TGEKNHCCPYKGCTQRFSRHDNCLQHYRTHL 227
           +RRK  C IC+  +    +L  H   H    ++ H CP   C + F R+++ ++H + H 
Sbjct: 248 KRRKKQCPICSGYY---ANLTTHKATHLVPEDRPHKCPI--CQRGFGRNNDLIRHQKRHW 302

Query: 228 K 228
           K
Sbjct: 303 K 303

>AFR588W [3780] [Homologous to ScYLR375W (STP3) - SH; ScYDL048C
           (STP4) - SH] complement(1496510..1497469) [960 bp, 319
           aa]
          Length = 319

 Score = 29.6 bits (65), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 16/27 (59%)

Query: 170 QRRKYICKICARGFTTSGHLARHNRIH 196
           + R + C IC+RGF  S  L RH + H
Sbjct: 150 EARPHKCDICSRGFARSNDLQRHKKRH 176

>Sklu_2206.2 YLR375W, Contig c2206 7136-8212
          Length = 358

 Score = 29.6 bits (65), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 16/27 (59%)

Query: 170 QRRKYICKICARGFTTSGHLARHNRIH 196
           + R + C +C+RGF  S  L RH + H
Sbjct: 184 EDRPHKCSVCSRGFARSNDLLRHKKRH 210

>CAGL0I02838g complement(248704..250671) similar to sp|P41696
           Saccharomyces cerevisiae YOR113w AZF1 asparagine-rich
           zinc finger protein, hypothetical start
          Length = 655

 Score = 29.6 bits (65), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 20/37 (54%)

Query: 172 RKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKG 208
           +++ C+ C R F    HL  H R H G+K + C Y G
Sbjct: 612 KQFECQYCHRCFAQVTHLDVHIRSHLGKKPYQCEYCG 648

>Kwal_55.20634
          Length = 419

 Score = 29.6 bits (65), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 14/50 (28%), Positives = 21/50 (42%), Gaps = 2/50 (4%)

Query: 179 CARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTHLK 228
           C        H+  H R+H   K   C    CT+ F R  +  +H + HL+
Sbjct: 99  CTAKTVKRDHITSHLRVHVPLKPFAC--STCTKTFKRPQDLKKHLKVHLE 146

>CAGL0L12562g complement(1350878..1351549) similar to sp|Q12041
           Saccharomyces cerevisiae YDR253c MET32 or tr|Q03081
           Saccharomyces cerevisiae YPL038w MET31, hypothetical
           start
          Length = 223

 Score = 29.3 bits (64), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 31/74 (41%), Gaps = 5/74 (6%)

Query: 152 RKQRTDPRNTLSDEEDLEQRRKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQ 211
           +K  T P++    EED      + C  C+  F  S  L RH R H     + C    C +
Sbjct: 123 KKTSTKPKDKSKSEEDTVY---HYCSQCSLKFNRSSDLRRHERAHLLVLPYICTQ--CGK 177

Query: 212 RFSRHDNCLQHYRT 225
            F+R D   +H  T
Sbjct: 178 GFARKDALKRHSGT 191

>Kwal_27.10167
          Length = 285

 Score = 29.3 bits (64), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 31/75 (41%), Gaps = 4/75 (5%)

Query: 156 TDPRNTLSDEEDLEQRRKYICKI--CARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRF 213
           T P  T S   + +  +KYIC I  C + +     L  H   H   +   CP   C +RF
Sbjct: 19  TIPSTTWSMSRECD--KKYICPITSCNKRYRKPSSLREHVNSHNNNRPFACPEPNCGKRF 76

Query: 214 SRHDNCLQHYRTHLK 228
            R  +   H  TH K
Sbjct: 77  LRVCHMNVHRWTHSK 91

>YDL048C (STP4) [816] chr4 complement(366739..368211) Protein with
           strong similarity to Stp1p, which is involved in tRNA
           splicing and branched-chain amino acid uptake [1473 bp,
           490 aa]
          Length = 490

 Score = 29.6 bits (65), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 38/72 (52%), Gaps = 8/72 (11%)

Query: 160 NTLSDEEDL-EQRRKYICKICARGFTTSGHLARHNRIHTG--EKNHCCPYKGCTQRFSRH 216
           ++L D   + +QR+K  C IC   +    +L+ H   H    ++ H CP   C + F+R+
Sbjct: 262 SSLKDSAKITKQRKKKECPICHNFY---ANLSTHKSTHLTPEDRPHKCPI--CQRGFARN 316

Query: 217 DNCLQHYRTHLK 228
           ++ ++H + H K
Sbjct: 317 NDLIRHKKRHWK 328

>Scas_646.7*
          Length = 543

 Score = 29.6 bits (65), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 30/65 (46%), Gaps = 10/65 (15%)

Query: 8   SNLNVSTMPALPGISAFDGMQDE----------ENVEISPERKYQTLLPVLTNSHVVENE 57
           SN+ V ++P L GI A+DG  D+          E + +  E+K Q  +        +E  
Sbjct: 376 SNVGVVSIPTLTGIDAYDGELDDATLSDLRELKEEMALQAEKKKQEFIKDEERKLAMEES 435

Query: 58  LKHKL 62
            ++KL
Sbjct: 436 FQNKL 440

>Sklu_2169.3 YIL128W, Contig c2169 4441-7500 reverse complement
          Length = 1019

 Score = 29.6 bits (65), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 27/65 (41%), Gaps = 5/65 (7%)

Query: 27  MQDEENVEISPERKYQTLLPVLTNSHVVENELKHKLNKTAFDFRYQTKSENGSEKWEPKY 86
           ++  EN+       Y  LL VL+N  V E ELK        DFR  TK       W  K 
Sbjct: 734 LKSNENMSDFERLGYFELLSVLSNKWVSERELKE-----VIDFRDVTKINLEISAWVTKG 788

Query: 87  LITPN 91
           L+  N
Sbjct: 789 LVVKN 793

>Sklu_2126.5 YHL027W, Contig c2126 7763-9109
          Length = 448

 Score = 29.3 bits (64), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 19/40 (47%), Gaps = 2/40 (5%)

Query: 188 HLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTHL 227
           H+  H R+H   K   C    C ++F R  +  +H R HL
Sbjct: 104 HITSHLRVHVPLKPFGC--STCGKKFKRPQDLKKHLRVHL 141

>CAGL0K04697g 458366..459913 some similarities with tr|Q07351
           Saccharomyces cerevisiae YDL048c STP4 or tr|Q05937
           Saccharomyces cerevisiae YLR375w STP3, hypothetical
           start
          Length = 515

 Score = 29.3 bits (64), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 46/119 (38%), Gaps = 9/119 (7%)

Query: 86  YLITPNLQTRSVSFDNSSVQYNXXXXXXXXXXQLTCNSSIIQQPENGIVSNDAYNKMANS 145
           YL + N   RSVSF N +V  +            +  ++ +    N  +      K   +
Sbjct: 256 YLPSNNTSFRSVSFTNKNVNTSNESLTEINTLAGSIPNTTLPSSNNMTLQEINLKKALLA 315

Query: 146 RYSLKTRKQRTDP--------RNTLSDEEDLEQRRKYICKICARGFTTSGHLARHNRIH 196
            YS KT+K+R  P         +T        Q R + C IC  GF  +  L RH + H
Sbjct: 316 DYS-KTKKKRQCPICHKYFANLSTHKSTHLTSQDRPHKCIICQSGFARNNDLIRHRKRH 373

>CAGL0K04257g complement(391287..392930) some similarities with
           sp|P32338 Saccharomyces cerevisiae YGR044c, hypothetical
           start
          Length = 547

 Score = 28.9 bits (63), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 19/45 (42%)

Query: 169 EQRRKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRF 213
           ++R  Y C  C   F      A H   +  E+ H CP+K C  R 
Sbjct: 401 QKRGLYRCAHCPSTFNNIFEYASHLDEYEVERKHKCPFKNCAWRI 445

>Sklu_1682.2 YJL049W, Contig c1682 738-2018
          Length = 426

 Score = 28.9 bits (63), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 33/58 (56%), Gaps = 12/58 (20%)

Query: 49  TNSHVVENELKHKLNKTAFDFRYQTKSENGSE-----------KWEPKY-LITPNLQT 94
           +N+HV+++ L+  ++KT  D  +++++ N S+           + E KY LI  NLQ+
Sbjct: 96  SNAHVIKSMLRWTISKTLMDLSFKSRANNSSKYLKEVTFVIKTRLEDKYCLIQQNLQS 153

>Scas_683.30
          Length = 478

 Score = 28.5 bits (62), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 15/27 (55%)

Query: 170 QRRKYICKICARGFTTSGHLARHNRIH 196
           + R + C IC RGF  +  L RH + H
Sbjct: 310 EDRPHKCPICERGFARNNDLIRHKKRH 336

 Score = 28.1 bits (61), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 30/60 (50%), Gaps = 7/60 (11%)

Query: 171 RRKYICKICARGFTTSGHLARHNRIHTG--EKNHCCPYKGCTQRFSRHDNCLQHYRTHLK 228
           RRK  C  C   +    +L+ H   H    ++ H CP   C + F+R+++ ++H + H K
Sbjct: 284 RRKKQCPTCLNYY---ANLSTHKSTHLTPEDRPHKCPI--CERGFARNNDLIRHKKRHWK 338

>Scas_636.14d
          Length = 275

 Score = 28.1 bits (61), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 13/46 (28%), Positives = 21/46 (45%), Gaps = 7/46 (15%)

Query: 167 DLEQRRKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQR 212
           D+   RK++C  C+R F    H+ +H    +       P KG  Q+
Sbjct: 236 DVHVERKHMCLFCSRWFKRKDHMIKHQEGGS-------PCKGANQK 274

>Scas_627.17d
          Length = 275

 Score = 27.7 bits (60), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 13/46 (28%), Positives = 21/46 (45%), Gaps = 7/46 (15%)

Query: 167 DLEQRRKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQR 212
           D+   RK++C  C+R F    H+ +H    +       P KG  Q+
Sbjct: 236 DVHVERKHMCLFCSRWFKRKDHMIKHQEGGS-------PCKGANQK 274

>YHL027W (RIM101) [2259] chr8 (51109..52986) Transcription factor
           involved in induction of IME1, IME2, DIT1, and DIT2
           transcription, has three C2H2-type zinc fingers [1878
           bp, 625 aa]
          Length = 625

 Score = 27.7 bits (60), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 12/41 (29%), Positives = 21/41 (51%), Gaps = 2/41 (4%)

Query: 188 HLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTHLK 228
           H+  H R+H   K   C    C+++F R  +  +H + HL+
Sbjct: 198 HITSHLRVHVPLKPFGC--STCSKKFKRPQDLKKHLKIHLE 236

>AFR190C [3382] [Homologous to ScYHL027W (RIM101) - SH]
           (783110..784408) [1299 bp, 432 aa]
          Length = 432

 Score = 27.7 bits (60), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 12/50 (24%), Positives = 22/50 (44%), Gaps = 2/50 (4%)

Query: 179 CARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTHLK 228
           C        H+  H R+H   K   C    C+++F R  +  +H + H++
Sbjct: 113 CTTKTVKRDHITSHLRVHVPLKPFSC--STCSRKFKRPQDLKKHLKVHME 160

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.130    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 7,995,763
Number of extensions: 331204
Number of successful extensions: 1537
Number of sequences better than 10.0: 218
Number of HSP's gapped: 1413
Number of HSP's successfully gapped: 292
Length of query: 228
Length of database: 16,596,109
Length adjustment: 98
Effective length of query: 130
Effective length of database: 13,203,545
Effective search space: 1716460850
Effective search space used: 1716460850
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 60 (27.7 bits)