Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YDR041W (RSM10)20320010701e-151
Sklu_2357.42042016636e-89
CAGL0K12056g2351826466e-86
Kwal_27.105452022026402e-85
Scas_569.12411886302e-83
AGR035C2071816081e-80
KLLA0F18436g2072086012e-79
Scas_550.742150633.0
Kwal_33.1303333261633.1
YML023C55668624.6
CAGL0G01760g85547616.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YDR041W
         (200 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YDR041W (RSM10) [894] chr4 (539798..540409) Component of the mit...   416   e-151
Sklu_2357.4 YDR041W, Contig c2357 5034-5648                           259   6e-89
CAGL0K12056g 1166627..1167334 similar to tr|Q03201 Saccharomyces...   253   6e-86
Kwal_27.10545                                                         251   2e-85
Scas_569.1                                                            247   2e-83
AGR035C [4345] [Homologous to ScYDR041W (RSM10) - SH] (773294..7...   238   1e-80
KLLA0F18436g 1697109..1697732 similar to sgd|S0002448 Saccharomy...   236   2e-79
Scas_550.7                                                             29   3.0  
Kwal_33.13033                                                          29   3.1  
YML023C (YML023C) [3942] chr13 complement(226994..228664) Protei...    28   4.6  
CAGL0G01760g 158546..161113 similar to sp|Q06096 Saccharomyces c...    28   6.4  

>YDR041W (RSM10) [894] chr4 (539798..540409) Component of the
           mitochondrial ribosomal small subunit [612 bp, 203 aa]
          Length = 203

 Score =  416 bits (1070), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 200/200 (100%), Positives = 200/200 (100%)

Query: 1   MLRNTIALRSFIRTQSTRPYPVNVEAVYYAPLKLPIKYGDLVADIQLRSYDNENLDFYSD 60
           MLRNTIALRSFIRTQSTRPYPVNVEAVYYAPLKLPIKYGDLVADIQLRSYDNENLDFYSD
Sbjct: 1   MLRNTIALRSFIRTQSTRPYPVNVEAVYYAPLKLPIKYGDLVADIQLRSYDNENLDFYSD 60

Query: 61  FILRTGYYLGIPLTGPKPLPTRRERWTVIKSPFVHAKSKENFERHTHKRLIRAWDTNPEV 120
           FILRTGYYLGIPLTGPKPLPTRRERWTVIKSPFVHAKSKENFERHTHKRLIRAWDTNPEV
Sbjct: 61  FILRTGYYLGIPLTGPKPLPTRRERWTVIKSPFVHAKSKENFERHTHKRLIRAWDTNPEV 120

Query: 121 LQMLIAYITKHSMAGVGMKCNFFQRSEISLDLGSDANGLEKSLSNIDELYSLRNDDKAQT 180
           LQMLIAYITKHSMAGVGMKCNFFQRSEISLDLGSDANGLEKSLSNIDELYSLRNDDKAQT
Sbjct: 121 LQMLIAYITKHSMAGVGMKCNFFQRSEISLDLGSDANGLEKSLSNIDELYSLRNDDKAQT 180

Query: 181 SAVGQKVLELLDSPDFKKHL 200
           SAVGQKVLELLDSPDFKKHL
Sbjct: 181 SAVGQKVLELLDSPDFKKHL 200

>Sklu_2357.4 YDR041W, Contig c2357 5034-5648
          Length = 204

 Score =  259 bits (663), Expect = 6e-89,   Method: Compositional matrix adjust.
 Identities = 124/201 (61%), Positives = 152/201 (75%), Gaps = 14/201 (6%)

Query: 4   NTIALRSFIRTQST----RPYPVNVEAVYYAPLKLPIKYGDLVADIQLRSYDNENLDFYS 59
            T  LR F R QST      +P+NV AVY+APLKLPI +GDLVAD+QLRSYDNENLDF+S
Sbjct: 14  GTPLLRQFTRFQSTVAPPNAFPINVTAVYHAPLKLPITHGDLVADLQLRSYDNENLDFFS 73

Query: 60  DFILRTGYYLGIPLTGPKPLPTRRERWTVIKSPFVHAKSKENFERHTHKRLIRAWDTNPE 119
           DFILR G+YLG+PLTGPKPLPTRRERWTVI+SPF  AKSKENFERHTHKRLIR WDTNPE
Sbjct: 74  DFILRAGFYLGMPLTGPKPLPTRRERWTVIRSPFAQAKSKENFERHTHKRLIRVWDTNPE 133

Query: 120 VLQMLIAYITKHSMAGVGMKCNFFQRSEISLDLGSDANGLEKSLSNIDELYSLRNDDKAQ 179
           V+++ ++Y+TKHS+ GVG+KCN +QR  + L    D + L +          L  + K  
Sbjct: 134 VIELWLSYLTKHSIPGVGIKCNVYQREGVRLSDSIDTSVLPE----------LEGNTKTL 183

Query: 180 TSAVGQKVLELLDSPDFKKHL 200
             AVG++V+ELL+ P+FKKH+
Sbjct: 184 DEAVGERVVELLNDPEFKKHI 204

>CAGL0K12056g 1166627..1167334 similar to tr|Q03201 Saccharomyces
           cerevisiae YDR041w RSM10, hypothetical start
          Length = 235

 Score =  253 bits (646), Expect = 6e-86,   Method: Compositional matrix adjust.
 Identities = 118/182 (64%), Positives = 150/182 (82%), Gaps = 9/182 (4%)

Query: 21  PVNVEAVYYAPLKLPIKYGDLVADIQLRSYDNENLDFYSDFILRTGYYLGIPLTGPKPLP 80
           PVNVEA+YYAPLK P+ +G LVAD+QLR+YDNENLDF+ DFILR GYYLG+P+TGPKPLP
Sbjct: 58  PVNVEALYYAPLKNPVTHGHLVADLQLRAYDNENLDFFCDFILRAGYYLGLPMTGPKPLP 117

Query: 81  TRRERWTVIKSPFVHAKSKENFERHTHKRLIRAWDTNPEVLQMLIAYITKHSMAGVGMKC 140
           TRRERWTVI+SPFVHAKSKENFERHTHKRLIR WD+NPEV+QML+ YITK+S+AGVG+KC
Sbjct: 118 TRRERWTVIRSPFVHAKSKENFERHTHKRLIRVWDSNPEVVQMLVDYITKNSIAGVGLKC 177

Query: 141 NFFQRSEISLDLGSDANGLEK--SLSNIDELYSLRNDDKAQTSAVGQKVLELLDSPDFKK 198
             +QR+ +    G  ++ +E+  S  NI+   SL+ +++     +G KV+ELL++P FKK
Sbjct: 178 TTYQRTTVDAKSGKISDAIEEINSTHNINP--SLKENEE-----IGAKVVELLNTPTFKK 230

Query: 199 HL 200
           +L
Sbjct: 231 YL 232

>Kwal_27.10545
          Length = 202

 Score =  251 bits (640), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 120/202 (59%), Positives = 150/202 (74%), Gaps = 20/202 (9%)

Query: 8   LRSFIRTQST----------RPYPVNVEAVYYAPLKLPIKYGDLVADIQLRSYDNENLDF 57
           LR F R QST          +  P+NVEAVYYAPL++PI +GDL+AD+QLRSYD+ENLDF
Sbjct: 10  LRHFARFQSTSVASEAPNVAKKLPINVEAVYYAPLRIPITHGDLIADLQLRSYDHENLDF 69

Query: 58  YSDFILRTGYYLGIPLTGPKPLPTRRERWTVIKSPFVHAKSKENFERHTHKRLIRAWDTN 117
           ++DFILR G+YLG+PLTGPKPLPTRRERWTVI+SPF  AKSKENFERHTHKRLIR WDTN
Sbjct: 70  FADFILRAGFYLGMPLTGPKPLPTRRERWTVIRSPFAQAKSKENFERHTHKRLIRVWDTN 129

Query: 118 PEVLQMLIAYITKHSMAGVGMKCNFFQRSEISLDLGSDANGLEKSLSNIDELYSLRNDDK 177
           PEV+++ ++YI+KHS+ GVG+KCN FQ+  + L    + N L +S    + L        
Sbjct: 130 PEVVELWLSYISKHSIPGVGIKCNLFQKEGLQLSQNLEQNSLLQSPGKSNSL-------- 181

Query: 178 AQTSAVGQKVLELLDSPDFKKH 199
               AVG++VLELL+S +FKK 
Sbjct: 182 --DEAVGERVLELLNSENFKKQ 201

>Scas_569.1
          Length = 241

 Score =  247 bits (630), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 120/188 (63%), Positives = 147/188 (78%), Gaps = 14/188 (7%)

Query: 21  PVNVEAVYYAPLKLPIKYGDLVADIQLRSYDNENLDFYSDFILRTGYYLGIPLTGPKPLP 80
           P+N++AVY+APL+ PIKYGDLVA+IQLRSYDNENLDFYSDF LR G+YLGIPLTGPKPLP
Sbjct: 60  PINIKAVYHAPLRNPIKYGDLVAEIQLRSYDNENLDFYSDFALRVGFYLGIPLTGPKPLP 119

Query: 81  TRRERWTVIKSPFVHAKSKENFERHTHKRLIRAWDTNPEVLQMLIAYITKHSMAGVGMKC 140
           TRRERWTVIKSPFVHAKSKENFERHTHKR+I+ WDTN E+++M I+YITKH+MAGVGMKC
Sbjct: 120 TRRERWTVIKSPFVHAKSKENFERHTHKRIIKVWDTNSELIEMWISYITKHAMAGVGMKC 179

Query: 141 NFFQRSEISLDLGSDANGLE--------KSLSNIDELYSLRNDDKAQTSAVGQKVLELLD 192
             FQRS I+    +  NG+         KS+ N  +   L ++D      V +K++ELL 
Sbjct: 180 TVFQRSPIASKEDA-TNGVSSSDSSSVLKSIVNQKDDVKLTDND-----LVNEKIVELLG 233

Query: 193 SPDFKKHL 200
             +FKK++
Sbjct: 234 REEFKKYI 241

>AGR035C [4345] [Homologous to ScYDR041W (RSM10) - SH]
           (773294..773917) [624 bp, 207 aa]
          Length = 207

 Score =  238 bits (608), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 110/181 (60%), Positives = 137/181 (75%), Gaps = 14/181 (7%)

Query: 21  PVNVEAVYYAPLKLPIKYGDLVADIQLRSYDNENLDFYSDFILRTGYYLGIPLTGPKPLP 80
           P +V A+Y+ PLKLP+K+ DLVAD+QLR++DN++LDF+++F LR GYYLGIP+TGPKPLP
Sbjct: 40  PKSVHALYFQPLKLPVKHHDLVADLQLRAFDNQSLDFFANFALRVGYYLGIPMTGPKPLP 99

Query: 81  TRRERWTVIKSPFVHAKSKENFERHTHKRLIRAWDTNPEVLQMLIAYITKHSMAGVGMKC 140
           TRRERWTVI++PF HAKSKENFERHTHKRL+R WD NPEV++M ++YITKHSMAGVGMKC
Sbjct: 100 TRRERWTVIRAPFAHAKSKENFERHTHKRLLRLWDANPEVVEMFLSYITKHSMAGVGMKC 159

Query: 141 NFFQRSEISLDLG-SDANGLEKSLSNIDELYSLRNDDKAQTSAVGQKVLELLDSPDFKKH 199
           N FQR  + L    +D      +    DE+             VG KV EL+ SP+FKKH
Sbjct: 160 NMFQRESVQLAQELADVPLAPGAPQTADEV-------------VGAKVAELMQSPEFKKH 206

Query: 200 L 200
           L
Sbjct: 207 L 207

>KLLA0F18436g 1697109..1697732 similar to sgd|S0002448 Saccharomyces
           cerevisiae YDR041w RSM10 component of the mitochondrial
           ribosomal small subunit, hypothetical start
          Length = 207

 Score =  236 bits (601), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 119/208 (57%), Positives = 148/208 (71%), Gaps = 22/208 (10%)

Query: 7   ALRSFIRTQSTR--------------PYPVNVEAVYYAPLKLPIKYGDLVADIQLRSYDN 52
           A+RSF+R QST               P P  VEAVY+APLK+   + DL+ADIQLRSYDN
Sbjct: 7   AVRSFVRYQSTTSLNPKILPFNAKETPIPKCVEAVYHAPLKIEPTHRDLIADIQLRSYDN 66

Query: 53  ENLDFYSDFILRTGYYLGIPLTGPKPLPTRRERWTVIKSPFVHAKSKENFERHTHKRLIR 112
           ENLDF+S F+LR GYYLGIP+ GPKPLPT+R+RWTVI++PFV AKSKENFERHTH RLIR
Sbjct: 67  ENLDFFSSFVLRAGYYLGIPMKGPKPLPTKRKRWTVIRAPFVMAKSKENFERHTHARLIR 126

Query: 113 AWDTNPEVLQMLIAYITKHSMAGVGMKCNFFQRSEISLDLGSDANGLEKSLSNIDELYSL 172
            +D N E+++ L++YI+KH ++GVG+KCN +QR  I LD   D   LE    NID    L
Sbjct: 127 LYDCNTELVETLLSYISKHGISGVGIKCNLYQREPIDLDSKKDGPELE----NIDISSQL 182

Query: 173 RNDDKAQTSAVGQKVLELLDSPDFKKHL 200
           +  D      VG KV+ELL++P+FKKHL
Sbjct: 183 QGLD----DVVGAKVVELLNNPEFKKHL 206

>Scas_550.7
          Length = 421

 Score = 28.9 bits (63), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 6/50 (12%)

Query: 24  VEAVYYAPLKLPIKYGDLVADIQLRSYDNENLDFYSDFILRTGYYLGIPL 73
           ++ + YAP ++   Y      I   SYD+ +L+ YSD     G +LGIPL
Sbjct: 170 LQMILYAPYQIFFSY-----VITGTSYDH-HLNIYSDVAKSVGVFLGIPL 213

>Kwal_33.13033
          Length = 332

 Score = 28.9 bits (63), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 32/61 (52%), Gaps = 7/61 (11%)

Query: 78  PLPTRRERWTVIKSPFVHAKSKENFERHT------HKRLIRAWDTNPEVLQMLIAYITKH 131
           P  T R R +V +SPFV AKS  + E  T       K+ +  + +NP V   L+  ++K+
Sbjct: 32  PSCTSRRR-SVPRSPFVLAKSSGSAEEDTACDSDFAKKPVVHFKSNPAVSATLLEAVSKY 90

Query: 132 S 132
           S
Sbjct: 91  S 91

>YML023C (YML023C) [3942] chr13 complement(226994..228664) Protein
           of unknown function [1671 bp, 556 aa]
          Length = 556

 Score = 28.5 bits (62), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 32/68 (47%), Gaps = 10/68 (14%)

Query: 19  PYPVNVEAVYYAPLKLPIKYGDLVADIQLRSYDNENLDFYSDFILRTGYYLGIPLTGPKP 78
           PY  + E +    LKL  KY  +     L+ +D+E  + Y   +LR  ++L I    PK 
Sbjct: 92  PYNTSRETLSRRALKLLQKYLAI-----LKEFDSEQYNLYDLELLRCQFFLAIDTLTPK- 145

Query: 79  LPTRRERW 86
               +++W
Sbjct: 146 ----KQKW 149

>CAGL0G01760g 158546..161113 similar to sp|Q06096 Saccharomyces
           cerevisiae YPR105c, hypothetical start
          Length = 855

 Score = 28.1 bits (61), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 25/47 (53%), Gaps = 6/47 (12%)

Query: 118 PEVLQMLIAYITKHSMAGVGMKCNFFQRSEISLDLGSDANGLEKSLS 164
           P+V   L+AYI ++ +  V  K N  Q +E    LGS    LEK LS
Sbjct: 745 PDVYTELLAYIVEYCVQSVEQKFNLLQVNE----LGS--TKLEKELS 785

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.136    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 6,797,489
Number of extensions: 291982
Number of successful extensions: 765
Number of sequences better than 10.0: 16
Number of HSP's gapped: 759
Number of HSP's successfully gapped: 16
Length of query: 200
Length of database: 16,596,109
Length adjustment: 96
Effective length of query: 104
Effective length of database: 13,272,781
Effective search space: 1380369224
Effective search space used: 1380369224
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 59 (27.3 bits)