Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YDR040C (ENA1)1091107256900.0
YDR039C (ENA2)1091107256350.0
YDR038C (ENA5)1091107255990.0
CAGL0K12034g1087106241310.0
Kwal_23.31601100106537460.0
AGL097C1096106336650.0
KLLA0F20658g1082106236490.0
KLLA0E14630g1082106236220.0
Scas_569.0d46837216370.0
CAGL0J01870g94610029031e-105
YGL167C (PMR1)9509208961e-104
AEL301W9579598921e-103
CAGL0I04312g9519278811e-102
Kwal_14.14989398968741e-101
Scas_707.48*7417308159e-95
KLLA0A03157g9388928182e-93
Kwal_47.17547124010136038e-64
CAGL0A00517g11228865733e-60
KLLA0A08910g12808515398e-56
YGL006W (PMC1)11733914612e-46
AFL011W12424004246e-42
Scas_297.18002373413e-32
CAGL0A00495g9023663324e-31
YGL008C (PMA1)9183543316e-31
KLLA0A09031g8993553182e-29
YPL036W (PMA2)9473463173e-29
Scas_710.419043493092e-28
CAGL0M11308g14527793068e-28
Kwal_47.175228993573031e-27
Scas_688.19133463002e-27
AGL085C9093572932e-26
YIL048W (NEO1)11517632744e-24
Scas_665.3014398022735e-24
YOR291W14727922593e-22
Scas_704.3811617742451e-20
AFR567W14497742352e-19
KLLA0C08393g11488022352e-19
Kwal_26.920714697882352e-19
Sklu_2193.111437052271e-18
CAGL0L00715g11447222262e-18
ADL079C11666042218e-18
Kwal_23.578911337632047e-16
Kwal_26.707013159231832e-13
YEL031W (SPF1)12152971814e-13
KLLA0B08217g14393211781e-12
ADR350W13118811743e-12
KLLA0A04015g13437951725e-12
Scas_583.14*8753111691e-11
YBR295W (PCA1)12162941627e-11
AFR354C12102991611e-10
CAGL0G06270g13288051554e-10
CAGL0L01419g12142781547e-10
YAL026C (DRS2)13558061457e-09
Scas_89.12711781344e-08
Scas_615.99421741368e-08
KLLA0E22352g12062961368e-08
YDR270W (CCC2)10041911341e-07
Kwal_55.215759892951294e-07
KLLA0F07447g9752841295e-07
CAGL0M08602g10123071286e-07
CAGL0L11814g15768911286e-07
KLLA0D04092g11521491252e-06
CAGL0H04477g16262451252e-06
AGR120C15479321232e-06
KLLA0E01650g15503221214e-06
YMR162C (DNF3)16563531162e-05
AGL041C12331501134e-05
Scas_576.815918961126e-05
AFL191W15752181109e-05
Kwal_23.355615972141044e-04
YER166W (DNF1)15716691044e-04
CAGL0G08085g15786781028e-04
ACR086C810178940.006
Scas_636.161554669940.008
YDR093W (DNF2)1612648930.009
Scas_669.31638377930.011
Scas_227.0d30780800.21
KLLA0C17644g1576897800.28
Scas_505.41025251800.28
YOR273C (TPO4)65981770.55
AER339C57389770.58
YGR208W (SER2)309116731.3
CAGL0K00825g295114721.7
Scas_536.7105149722.4
Scas_463.331546703.1
YLR057W849100713.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YDR040C
         (1072 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YDR040C (ENA1) [893] chr4 complement(535187..538462) P-type ATPa...  2196   0.0  
YDR039C (ENA2) [892] chr4 complement(531302..534577) Member of t...  2175   0.0  
YDR038C (ENA5) [891] chr4 complement(527417..530692) Member of t...  2161   0.0  
CAGL0K12034g complement(1161299..1164562) highly similar to sp|P...  1595   0.0  
Kwal_23.3160                                                         1447   0.0  
AGL097C [4215] [Homologous to ScYDR039C (ENA2 ) - NSH] (520915.....  1416   0.0  
KLLA0F20658g 1919851..1923099 similar to sp|Q12691 Saccharomyces...  1410   0.0  
KLLA0E14630g complement(1297636..1300884) similar to sp|Q01896 S...  1399   0.0  
Scas_569.0d                                                           635   0.0  
CAGL0J01870g 181666..184506 highly similar to sp|P13586 Saccharo...   352   e-105
YGL167C (PMR1) [1823] chr7 complement(187620..190472) Ca2+-trans...   349   e-104
AEL301W [2204] [Homologous to ScYGL167C (PMR1) - SH] complement(...   348   e-103
CAGL0I04312g complement(382354..385209) highly similar to sp|P13...   343   e-102
Kwal_14.1498                                                          341   e-101
Scas_707.48*                                                          318   9e-95
KLLA0A03157g complement(281313..284129) gi|3288523|emb|CAA04476....   319   2e-93
Kwal_47.17547                                                         236   8e-64
CAGL0A00517g 58830..62198 similar to sp|P38929 Saccharomyces cer...   225   3e-60
KLLA0A08910g complement(779526..783368) similar to sp|P38929 Sac...   212   8e-56
YGL006W (PMC1) [1966] chr7 (485923..489444) Vacuolar Ca2+-transp...   182   2e-46
AFL011W [3182] [Homologous to ScYGL006W (PMC1) - SH] complement(...   167   6e-42
Scas_297.1                                                            135   3e-32
CAGL0A00495g complement(55014..57722) highly similar to sp|P0503...   132   4e-31
YGL008C (PMA1) [1965] chr7 complement(479913..482669) H+-transpo...   132   6e-31
KLLA0A09031g 787768..790467 gi|1346734|sp|P49380|PMA1_KLULA Kluy...   127   2e-29
YPL036W (PMA2) [5403] chr16 (482839..485682) H[+]-transporting P...   126   3e-29
Scas_710.41                                                           123   2e-28
CAGL0M11308g 1110211..1114569 similar to sp|Q12697 Saccharomyces...   122   8e-28
Kwal_47.17522                                                         121   1e-27
Scas_688.1                                                            120   2e-27
AGL085C [4226] [Homologous to ScYGL008C (PMA1) - SH; ScYPL036W (...   117   2e-26
YIL048W (NEO1) [2619] chr9 (261436..264891) Member of the Drs2p-...   110   4e-24
Scas_665.30                                                           109   5e-24
YOR291W (YOR291W) [5075] chr15 (861172..865590) Member of the ca...   104   3e-22
Scas_704.38                                                            99   1e-20
AFR567W [3759] [Homologous to ScYOR291W - SH] complement(1455295...    95   2e-19
KLLA0C08393g 734655..738101 highly similar to sp|P40527 Saccharo...    95   2e-19
Kwal_26.9207                                                           95   2e-19
Sklu_2193.1 YIL048W, Contig c2193 334-3765 reverse complement          92   1e-18
CAGL0L00715g 86810..90244 highly similar to sp|P40527 Saccharomy...    92   2e-18
ADL079C [1662] [Homologous to ScYIL048W (NEO1) - SH] (544854..54...    90   8e-18
Kwal_23.5789                                                           83   7e-16
Kwal_26.7070                                                           75   2e-13
YEL031W (SPF1) [1394] chr5 (90258..93905) Putative Ca2+-transpor...    74   4e-13
KLLA0B08217g complement(724364..728683) similar to sp|Q12697 Sac...    73   1e-12
ADR350W [2091] [Homologous to ScYAL026C (DRS2) - SH] complement(...    72   3e-12
KLLA0A04015g complement(355624..359655) similar to sp|P39524 Sac...    71   5e-12
Scas_583.14*                                                           70   1e-11
YBR295W (PCA1) [472] chr2 (792805..796455) P-type copper-transpo...    67   7e-11
AFR354C [3546] [Homologous to ScYEL031W (SPF1) - SH] (1078275..1...    67   1e-10
CAGL0G06270g 598357..602343 highly similar to sp|P39524 Saccharo...    64   4e-10
CAGL0L01419g 156123..159767 highly similar to sp|P39986 Saccharo...    64   7e-10
YAL026C (DRS2) [42] chr1 complement(95633..99700) Membrane-spann...    60   7e-09
Scas_89.1                                                              56   4e-08
Scas_615.9                                                             57   8e-08
KLLA0E22352g 1984522..1988142 highly similar to sp|P39986 Saccha...    57   8e-08
YDR270W (CCC2) [1102] chr4 (1005667..1008681) Copper-transportin...    56   1e-07
Kwal_55.21575                                                          54   4e-07
KLLA0F07447g 700685..703612 similar to sp|P38995 Saccharomyces c...    54   5e-07
CAGL0M08602g complement(856349..859387) similar to sp|P38995 Sac...    54   6e-07
CAGL0L11814g 1262124..1266854 highly similar to sp|P32660 Saccha...    54   6e-07
KLLA0D04092g complement(344666..348124) some similarities with s...    53   2e-06
CAGL0H04477g 421857..426737 similar to sp|Q12674 Saccharomyces c...    53   2e-06
AGR120C [4431] [Homologous to ScYER166W (DNF1) - SH; ScYDR093W (...    52   2e-06
KLLA0E01650g complement(155975..160627) similar to sp|Q12674 Sac...    51   4e-06
YMR162C (DNF3) [4117] chr13 complement(578950..583920) Member of...    49   2e-05
AGL041C [4270] [Homologous to ScYDR270W - NSH] (628428..632129) ...    48   4e-05
Scas_576.8                                                             48   6e-05
AFL191W [3004] [Homologous to ScYMR162C (DNF3) - SH] complement(...    47   9e-05
Kwal_23.3556                                                           45   4e-04
YER166W (DNF1) [1594] chr5 (512739..517454) Member of the haloac...    45   4e-04
CAGL0G08085g 763185..767921 highly similar to sp|Q12675 Saccharo...    44   8e-04
ACR086C [1133] [Homologous to ScYDR270W (CCC2) - SH] (511968..51...    41   0.006
Scas_636.16                                                            41   0.008
YDR093W (DNF2) [945] chr4 (631276..636114) Member of the haloaci...    40   0.009
Scas_669.3                                                             40   0.011
Scas_227.0d                                                            35   0.21 
KLLA0C17644g 1557138..1561868 similar to sp|P32660 Saccharomyces...    35   0.28 
Scas_505.4                                                             35   0.28 
YOR273C (TPO4) [5059] chr15 complement(834449..836428) Polyamine...    34   0.55 
AER339C [2840] [Homologous to ScYOR273C (TPO4) - SH] (1259842..1...    34   0.58 
YGR208W (SER2) [2158] chr7 (911886..912815) Phosphoserine phosph...    33   1.3  
CAGL0K00825g complement(86502..87389) similar to sp|P42941 Sacch...    32   1.7  
Scas_536.7                                                             32   2.4  
Scas_463.3                                                             32   3.1  
YLR057W (YLR057W) [3474] chr12 (255307..257856) Member of the gl...    32   3.1  

>YDR040C (ENA1) [893] chr4 complement(535187..538462) P-type ATPase
            involved in Na+ and Li+ efflux, required for Na+
            tolerance [3276 bp, 1091 aa]
          Length = 1091

 Score = 2196 bits (5690), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1060/1072 (98%), Positives = 1060/1072 (98%)

Query: 1    MGEGTTKENNNAEFNAYHTLTAEEAAEFIGTSLTEGLTQDEFVHRLKTVGENTLGDDTKI 60
            MGEGTTKENNNAEFNAYHTLTAEEAAEFIGTSLTEGLTQDEFVHRLKTVGENTLGDDTKI
Sbjct: 1    MGEGTTKENNNAEFNAYHTLTAEEAAEFIGTSLTEGLTQDEFVHRLKTVGENTLGDDTKI 60

Query: 61   DYKAMVLHQVCNAXXXXXXXXXXXXFAMHDWITGGVISFVIAVNVLIGLVQEYKATKTMN 120
            DYKAMVLHQVCNA            FAMHDWITGGVISFVIAVNVLIGLVQEYKATKTMN
Sbjct: 61   DYKAMVLHQVCNAMIMVLLISMIISFAMHDWITGGVISFVIAVNVLIGLVQEYKATKTMN 120

Query: 121  SLKNLSSPNAHVIRNGKSETINSKDVVPGDICLVKVGDTIPADLRLIETKNFDTDESLLT 180
            SLKNLSSPNAHVIRNGKSETINSKDVVPGDICLVKVGDTIPADLRLIETKNFDTDESLLT
Sbjct: 121  SLKNLSSPNAHVIRNGKSETINSKDVVPGDICLVKVGDTIPADLRLIETKNFDTDESLLT 180

Query: 181  GESLPVSKDANLVFGKEEETSVGDRLNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSL 240
            GESLPVSKDANLVFGKEEETSVGDRLNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSL
Sbjct: 181  GESLPVSKDANLVFGKEEETSVGDRLNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSL 240

Query: 241  QGDSGLISRDPSKSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAII 300
            QGDSGLISRDPSKSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAII
Sbjct: 241  QGDSGLISRDPSKSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAII 300

Query: 301  VMASQKFDVDKRVAIYAICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEAL 360
            VMASQKFDVDKRVAIYAICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEAL
Sbjct: 301  VMASQKFDVDKRVAIYAICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEAL 360

Query: 361  GAVNDICSDKTGTLTQGKMLARQIWIPRFGTITISNSDDPFNPNEGNVSLIPRFSPYEYS 420
            GAVNDICSDKTGTLTQGKMLARQIWIPRFGTITISNSDDPFNPNEGNVSLIPRFSPYEYS
Sbjct: 361  GAVNDICSDKTGTLTQGKMLARQIWIPRFGTITISNSDDPFNPNEGNVSLIPRFSPYEYS 420

Query: 421  HNEDGDVGILQNFKDRLYEKDLPEDIDMDLFQKWLETATLANIATVFKDDATDCWKAHGD 480
            HNEDGDVGILQNFKDRLYEKDLPEDIDMDLFQKWLETATLANIATVFKDDATDCWKAHGD
Sbjct: 421  HNEDGDVGILQNFKDRLYEKDLPEDIDMDLFQKWLETATLANIATVFKDDATDCWKAHGD 480

Query: 481  PTEIAIQVFATKMDLPHNALTGEKSTNQSNENDQSSLSQHNEKPGSAQFEHIAEFPFDST 540
            PTEIAIQVFATKMDLPHNALTGEKSTNQSNENDQSSLSQHNEKPGSAQFEHIAEFPFDST
Sbjct: 481  PTEIAIQVFATKMDLPHNALTGEKSTNQSNENDQSSLSQHNEKPGSAQFEHIAEFPFDST 540

Query: 541  VKRMSSVYYNNHNETYNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDVETIRKNVYSL 600
            VKRMSSVYYNNHNETYNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDVETIRKNVYSL
Sbjct: 541  VKRMSSVYYNNHNETYNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDVETIRKNVYSL 600

Query: 601  SNEGLRVLGFASKSFTKDQVNDDQLKNITSNRATAESDLVFLGLIGIYDPPRNETAGAVK 660
            SNEGLRVLGFASKSFTKDQVNDDQLKNITSNRATAESDLVFLGLIGIYDPPRNETAGAVK
Sbjct: 601  SNEGLRVLGFASKSFTKDQVNDDQLKNITSNRATAESDLVFLGLIGIYDPPRNETAGAVK 660

Query: 661  KFHQAGINVHMLTGDFVGTAKAIAQEVGILPTNLYHYSQEIVDSMVMTGSQFDGLSEEEV 720
            KFHQAGINVHMLTGDFVGTAKAIAQEVGILPTNLYHYSQEIVDSMVMTGSQFDGLSEEEV
Sbjct: 661  KFHQAGINVHMLTGDFVGTAKAIAQEVGILPTNLYHYSQEIVDSMVMTGSQFDGLSEEEV 720

Query: 721  DDLPVLPLVIARCSPQTKVRMIEALHRRKKFCTMTGDGVNDSPSLKMANVGIAMGINGSD 780
            DDLPVLPLVIARCSPQTKVRMIEALHRRKKFCTMTGDGVNDSPSLKMANVGIAMGINGSD
Sbjct: 721  DDLPVLPLVIARCSPQTKVRMIEALHRRKKFCTMTGDGVNDSPSLKMANVGIAMGINGSD 780

Query: 781  VSKEASDIVLSDDNFASILNAVEEGRRMTDNIQKFVLQLLAENVAQALYLIIGLVFRDEN 840
            VSKEASDIVLSDDNFASILNAVEEGRRMTDNIQKFVLQLLAENVAQALYLIIGLVFRDEN
Sbjct: 781  VSKEASDIVLSDDNFASILNAVEEGRRMTDNIQKFVLQLLAENVAQALYLIIGLVFRDEN 840

Query: 841  GKSVFPLSPVEVLWIIVVTSCFPAMGLGLEKAAPDLMDRPPHDSEVGIFTWEVIIDTFAY 900
            GKSVFPLSPVEVLWIIVVTSCFPAMGLGLEKAAPDLMDRPPHDSEVGIFTWEVIIDTFAY
Sbjct: 841  GKSVFPLSPVEVLWIIVVTSCFPAMGLGLEKAAPDLMDRPPHDSEVGIFTWEVIIDTFAY 900

Query: 901  GIIMTGSCMASFTGSLYGINSGRLGHDCDGTYNSSCRDVYRSRSAAFATMTWCALILAWE 960
            GIIMTGSCMASFTGSLYGINSGRLGHDCDGTYNSSCRDVYRSRSAAFATMTWCALILAWE
Sbjct: 901  GIIMTGSCMASFTGSLYGINSGRLGHDCDGTYNSSCRDVYRSRSAAFATMTWCALILAWE 960

Query: 961  VVDMRRSFFRMHPDTDSPVKEFFRSIWGNQFLFWSIIFGFVSAFPVVYIPVINDKVFLHK 1020
            VVDMRRSFFRMHPDTDSPVKEFFRSIWGNQFLFWSIIFGFVSAFPVVYIPVINDKVFLHK
Sbjct: 961  VVDMRRSFFRMHPDTDSPVKEFFRSIWGNQFLFWSIIFGFVSAFPVVYIPVINDKVFLHK 1020

Query: 1021 PIGAEWGLAIAFTIAFWIGAELYKCGKRRYFKTQRAHNPENDLESNNKRDPF 1072
            PIGAEWGLAIAFTIAFWIGAELYKCGKRRYFKTQRAHNPENDLESNNKRDPF
Sbjct: 1021 PIGAEWGLAIAFTIAFWIGAELYKCGKRRYFKTQRAHNPENDLESNNKRDPF 1072

>YDR039C (ENA2) [892] chr4 complement(531302..534577) Member of the
            Na[+]-transporting ATPases family in the superfamily of
            P-type ATPases [3276 bp, 1091 aa]
          Length = 1091

 Score = 2175 bits (5635), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1049/1072 (97%), Positives = 1051/1072 (98%)

Query: 1    MGEGTTKENNNAEFNAYHTLTAEEAAEFIGTSLTEGLTQDEFVHRLKTVGENTLGDDTKI 60
            M EGT KENNN EFNAYHTLT EEAAEFIGTSLTEGLTQDE + RLK VGENTLGDDTKI
Sbjct: 1    MSEGTVKENNNEEFNAYHTLTTEEAAEFIGTSLTEGLTQDESLRRLKAVGENTLGDDTKI 60

Query: 61   DYKAMVLHQVCNAXXXXXXXXXXXXFAMHDWITGGVISFVIAVNVLIGLVQEYKATKTMN 120
            DYKAMVLHQVCNA            FA+ DWITGGVISFVIAVNVLIGLVQEYKATKTMN
Sbjct: 61   DYKAMVLHQVCNAMIMVLVISMAISFAVRDWITGGVISFVIAVNVLIGLVQEYKATKTMN 120

Query: 121  SLKNLSSPNAHVIRNGKSETINSKDVVPGDICLVKVGDTIPADLRLIETKNFDTDESLLT 180
            SLKNLSSPNAHVIRNGKSETINSKDVVPGDICLVKVGDTIPADLRLIETKNFDTDESLLT
Sbjct: 121  SLKNLSSPNAHVIRNGKSETINSKDVVPGDICLVKVGDTIPADLRLIETKNFDTDESLLT 180

Query: 181  GESLPVSKDANLVFGKEEETSVGDRLNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSL 240
            GESLPVSKDANLVFGKEEETSVGDRLNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSL
Sbjct: 181  GESLPVSKDANLVFGKEEETSVGDRLNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSL 240

Query: 241  QGDSGLISRDPSKSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAII 300
            QGDSGLISRDPSKSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAII
Sbjct: 241  QGDSGLISRDPSKSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAII 300

Query: 301  VMASQKFDVDKRVAIYAICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEAL 360
            VMASQKFDVDKRVAIYAICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEAL
Sbjct: 301  VMASQKFDVDKRVAIYAICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEAL 360

Query: 361  GAVNDICSDKTGTLTQGKMLARQIWIPRFGTITISNSDDPFNPNEGNVSLIPRFSPYEYS 420
            GAVNDICSDKTGTLTQGKMLARQIWIPRFGTITISNSDDPFNPNEGNVSLIPRFSPYEYS
Sbjct: 361  GAVNDICSDKTGTLTQGKMLARQIWIPRFGTITISNSDDPFNPNEGNVSLIPRFSPYEYS 420

Query: 421  HNEDGDVGILQNFKDRLYEKDLPEDIDMDLFQKWLETATLANIATVFKDDATDCWKAHGD 480
            HNEDGDVGILQNFKDRLYEKDLPEDIDMDLFQKWLETATLANIATVFKDDATDCWKAHGD
Sbjct: 421  HNEDGDVGILQNFKDRLYEKDLPEDIDMDLFQKWLETATLANIATVFKDDATDCWKAHGD 480

Query: 481  PTEIAIQVFATKMDLPHNALTGEKSTNQSNENDQSSLSQHNEKPGSAQFEHIAEFPFDST 540
            PTEIAIQVFATKMDLPHNALTGEKSTNQSNENDQSSLSQHNEKPGSAQFEHIAEFPFDST
Sbjct: 481  PTEIAIQVFATKMDLPHNALTGEKSTNQSNENDQSSLSQHNEKPGSAQFEHIAEFPFDST 540

Query: 541  VKRMSSVYYNNHNETYNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDVETIRKNVYSL 600
            VKRMSSVYYNNHNETYNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDVETIRKNVYSL
Sbjct: 541  VKRMSSVYYNNHNETYNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDVETIRKNVYSL 600

Query: 601  SNEGLRVLGFASKSFTKDQVNDDQLKNITSNRATAESDLVFLGLIGIYDPPRNETAGAVK 660
            SNEGLRVLGFASKSFTKDQVNDDQLKNITSNRATAESDLVFLGLIGIYDPPRNETAGAVK
Sbjct: 601  SNEGLRVLGFASKSFTKDQVNDDQLKNITSNRATAESDLVFLGLIGIYDPPRNETAGAVK 660

Query: 661  KFHQAGINVHMLTGDFVGTAKAIAQEVGILPTNLYHYSQEIVDSMVMTGSQFDGLSEEEV 720
            KFHQAGINVHMLTGDFVGTAKAIAQEVGILPTNLYHYSQEIVDSMVMTGSQFDGLSEEEV
Sbjct: 661  KFHQAGINVHMLTGDFVGTAKAIAQEVGILPTNLYHYSQEIVDSMVMTGSQFDGLSEEEV 720

Query: 721  DDLPVLPLVIARCSPQTKVRMIEALHRRKKFCTMTGDGVNDSPSLKMANVGIAMGINGSD 780
            DDLPVLPLVIARCSPQTKVRMIEALHRRKKFC MTGDGVNDSPSLKMANVGIAMGINGSD
Sbjct: 721  DDLPVLPLVIARCSPQTKVRMIEALHRRKKFCAMTGDGVNDSPSLKMANVGIAMGINGSD 780

Query: 781  VSKEASDIVLSDDNFASILNAVEEGRRMTDNIQKFVLQLLAENVAQALYLIIGLVFRDEN 840
            VSKEASDIVLSDDNFASILNAVEEGRRMTDNIQKFVLQLLAENVAQALYLIIGLVFRDEN
Sbjct: 781  VSKEASDIVLSDDNFASILNAVEEGRRMTDNIQKFVLQLLAENVAQALYLIIGLVFRDEN 840

Query: 841  GKSVFPLSPVEVLWIIVVTSCFPAMGLGLEKAAPDLMDRPPHDSEVGIFTWEVIIDTFAY 900
            GKSVFPLSPVEVLWIIVVTSCFPAMGLGLEKAAPDLMDRPPHDSEVGIFTWEVIIDTFAY
Sbjct: 841  GKSVFPLSPVEVLWIIVVTSCFPAMGLGLEKAAPDLMDRPPHDSEVGIFTWEVIIDTFAY 900

Query: 901  GIIMTGSCMASFTGSLYGINSGRLGHDCDGTYNSSCRDVYRSRSAAFATMTWCALILAWE 960
            GIIMTGSCMASFTGSLYGINSGRLGHDCDGTYNSSCRDVYRSRSAAFATMTWCALILAWE
Sbjct: 901  GIIMTGSCMASFTGSLYGINSGRLGHDCDGTYNSSCRDVYRSRSAAFATMTWCALILAWE 960

Query: 961  VVDMRRSFFRMHPDTDSPVKEFFRSIWGNQFLFWSIIFGFVSAFPVVYIPVINDKVFLHK 1020
            VVDMRRSFFRMHPDTDSPVKEFFRSIWGNQFLFWSIIFGFVSAFPVVYIPVINDKVFLHK
Sbjct: 961  VVDMRRSFFRMHPDTDSPVKEFFRSIWGNQFLFWSIIFGFVSAFPVVYIPVINDKVFLHK 1020

Query: 1021 PIGAEWGLAIAFTIAFWIGAELYKCGKRRYFKTQRAHNPENDLESNNKRDPF 1072
            PIGAEWGLAIAFTIAFWIGAELYKCGKRRYFKTQRAHNPENDLESNNKRDPF
Sbjct: 1021 PIGAEWGLAIAFTIAFWIGAELYKCGKRRYFKTQRAHNPENDLESNNKRDPF 1072

>YDR038C (ENA5) [891] chr4 complement(527417..530692) Member of the
            Na[+]-transporting ATPases family in the superfamily of
            P-type ATPases [3276 bp, 1091 aa]
          Length = 1091

 Score = 2161 bits (5599), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1043/1072 (97%), Positives = 1048/1072 (97%)

Query: 1    MGEGTTKENNNAEFNAYHTLTAEEAAEFIGTSLTEGLTQDEFVHRLKTVGENTLGDDTKI 60
            M EGT KENNN EFNAYHTLT EEAAEFIGTSLTEGLTQDE + RLK VGENTLGDDTKI
Sbjct: 1    MSEGTVKENNNEEFNAYHTLTTEEAAEFIGTSLTEGLTQDESLRRLKAVGENTLGDDTKI 60

Query: 61   DYKAMVLHQVCNAXXXXXXXXXXXXFAMHDWITGGVISFVIAVNVLIGLVQEYKATKTMN 120
            DYKAMVLHQVCNA            FA+ DWITGGVISFVIAVNVLIGLVQEYKATKTMN
Sbjct: 61   DYKAMVLHQVCNAMIMVLVISMAISFAVRDWITGGVISFVIAVNVLIGLVQEYKATKTMN 120

Query: 121  SLKNLSSPNAHVIRNGKSETINSKDVVPGDICLVKVGDTIPADLRLIETKNFDTDESLLT 180
            SLKNLSSPNAHVIRNGKSETINSKDVVPGDICLVKVGDTIPADLRLIETKNFDTDESLLT
Sbjct: 121  SLKNLSSPNAHVIRNGKSETINSKDVVPGDICLVKVGDTIPADLRLIETKNFDTDESLLT 180

Query: 181  GESLPVSKDANLVFGKEEETSVGDRLNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSL 240
            GESLPVSKDANLVFGKEEETSVGDRLNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSL
Sbjct: 181  GESLPVSKDANLVFGKEEETSVGDRLNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSL 240

Query: 241  QGDSGLISRDPSKSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAII 300
            QGDSGLISRDPSKSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAII
Sbjct: 241  QGDSGLISRDPSKSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAII 300

Query: 301  VMASQKFDVDKRVAIYAICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEAL 360
            VMASQKFDVDKRVAIYAICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEAL
Sbjct: 301  VMASQKFDVDKRVAIYAICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEAL 360

Query: 361  GAVNDICSDKTGTLTQGKMLARQIWIPRFGTITISNSDDPFNPNEGNVSLIPRFSPYEYS 420
            GAVNDICSDKTGTLTQGKMLARQIWIPRFGTITISNSDDPFNPNEGNVSLIPRFSPYEYS
Sbjct: 361  GAVNDICSDKTGTLTQGKMLARQIWIPRFGTITISNSDDPFNPNEGNVSLIPRFSPYEYS 420

Query: 421  HNEDGDVGILQNFKDRLYEKDLPEDIDMDLFQKWLETATLANIATVFKDDATDCWKAHGD 480
            HNEDGDVGILQNFKDRLYEKDLPEDIDMDLFQKWLETATLANIATVFKDDATDCWKAHGD
Sbjct: 421  HNEDGDVGILQNFKDRLYEKDLPEDIDMDLFQKWLETATLANIATVFKDDATDCWKAHGD 480

Query: 481  PTEIAIQVFATKMDLPHNALTGEKSTNQSNENDQSSLSQHNEKPGSAQFEHIAEFPFDST 540
            PTEIAIQVFATKMDLPHNALTGEKSTNQSNENDQSSLSQHNEKPGSAQFEHIAEFPFDST
Sbjct: 481  PTEIAIQVFATKMDLPHNALTGEKSTNQSNENDQSSLSQHNEKPGSAQFEHIAEFPFDST 540

Query: 541  VKRMSSVYYNNHNETYNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDVETIRKNVYSL 600
            VKRMSSVYYNNHNETYNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDVETIRKNVYSL
Sbjct: 541  VKRMSSVYYNNHNETYNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDVETIRKNVYSL 600

Query: 601  SNEGLRVLGFASKSFTKDQVNDDQLKNITSNRATAESDLVFLGLIGIYDPPRNETAGAVK 660
            SNEGLRVLGFASKSFTKDQVNDDQLKNITSNRATAESDLVFLGLIGIYDPPRNETAGAVK
Sbjct: 601  SNEGLRVLGFASKSFTKDQVNDDQLKNITSNRATAESDLVFLGLIGIYDPPRNETAGAVK 660

Query: 661  KFHQAGINVHMLTGDFVGTAKAIAQEVGILPTNLYHYSQEIVDSMVMTGSQFDGLSEEEV 720
            KFHQAGINVHMLTGDFVGTAKAIAQEVGILPTNLYHYSQEIVDSMVMTGSQFDGLSEEEV
Sbjct: 661  KFHQAGINVHMLTGDFVGTAKAIAQEVGILPTNLYHYSQEIVDSMVMTGSQFDGLSEEEV 720

Query: 721  DDLPVLPLVIARCSPQTKVRMIEALHRRKKFCTMTGDGVNDSPSLKMANVGIAMGINGSD 780
            DDLPVLPLVIARCSPQTKVRMIEALHRRKKFC MTGDGVNDSPSLKMANVGIAMGINGSD
Sbjct: 721  DDLPVLPLVIARCSPQTKVRMIEALHRRKKFCAMTGDGVNDSPSLKMANVGIAMGINGSD 780

Query: 781  VSKEASDIVLSDDNFASILNAVEEGRRMTDNIQKFVLQLLAENVAQALYLIIGLVFRDEN 840
            VSKEASDIVLSDDNFASILNAVEEGRRMTDNIQKFVLQLLAENVAQALYLIIGLVFRDEN
Sbjct: 781  VSKEASDIVLSDDNFASILNAVEEGRRMTDNIQKFVLQLLAENVAQALYLIIGLVFRDEN 840

Query: 841  GKSVFPLSPVEVLWIIVVTSCFPAMGLGLEKAAPDLMDRPPHDSEVGIFTWEVIIDTFAY 900
            GKSVFPLSPVEVLWIIVVTSCFPAMGLGLEKAAPDLMDRPP+DSEVGIFTWEVIIDTFAY
Sbjct: 841  GKSVFPLSPVEVLWIIVVTSCFPAMGLGLEKAAPDLMDRPPNDSEVGIFTWEVIIDTFAY 900

Query: 901  GIIMTGSCMASFTGSLYGINSGRLGHDCDGTYNSSCRDVYRSRSAAFATMTWCALILAWE 960
            GIIMTGSCMASFTGSLYGINSGRLGHDCDGTYNSSCRDVYRSRSAAFATMTWCALILAWE
Sbjct: 901  GIIMTGSCMASFTGSLYGINSGRLGHDCDGTYNSSCRDVYRSRSAAFATMTWCALILAWE 960

Query: 961  VVDMRRSFFRMHPDTDSPVKEFFRSIWGNQFLFWSIIFGFVSAFPVVYIPVINDKVFLHK 1020
            VVDMRRSFFRMHPDTDSPVKEFFRSIWGNQFLFWSIIFGFVSAFPVVYIPVINDKVFLHK
Sbjct: 961  VVDMRRSFFRMHPDTDSPVKEFFRSIWGNQFLFWSIIFGFVSAFPVVYIPVINDKVFLHK 1020

Query: 1021 PIGAEWGLAIAFTIAFWIGAELYKCGKRRYFKTQRAHNPENDLESNNKRDPF 1072
            PIGAEWGLAIAFTIAFWIGAELYKCGKRRYFKTQRAHN ENDLE ++K DPF
Sbjct: 1021 PIGAEWGLAIAFTIAFWIGAELYKCGKRRYFKTQRAHNSENDLERSSKHDPF 1072

>CAGL0K12034g complement(1161299..1164562) highly similar to sp|P13587
            Saccharomyces cerevisiae YDR040c ENA1 or sp|Q01896
            Saccharomyces cerevisiae YDR039c ENA2 or sp|Q12691
            Saccharomyces cerevisiae YDR038c ENA5, hypothetical start
          Length = 1087

 Score = 1595 bits (4131), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 755/1062 (71%), Positives = 891/1062 (83%), Gaps = 4/1062 (0%)

Query: 13   EFNAYHTLTAEEAAEFIGTSLTEGLTQDEFVHRLKTVGENTLGDDTKIDYKAMVLHQVCN 72
            EF+ YH L+ E+    + T  ++G++ +EF  RL   GEN+LGDD KIDYKAM++HQ+CN
Sbjct: 9    EFSDYHALSVEDTCARLVTDSSKGISPEEFQARLAQCGENSLGDDAKIDYKAMLIHQICN 68

Query: 73   AXXXXXXXXXXXXFAMHDWITGGVISFVIAVNVLIGLVQEYKATKTMNSLKNLSSPNAHV 132
            A            FA+ DWITGGVI FVI +NV+IGL+QEYKA+KTMN+L+ LSSPNAHV
Sbjct: 69   AMILVLIISMIISFAIRDWITGGVICFVIGINVIIGLIQEYKASKTMNALRALSSPNAHV 128

Query: 133  IRNGKSETINSKDVVPGDICLVKVGDTIPADLRLIETKNFDTDESLLTGESLPVSKDANL 192
            IRNG SE ++S DVVPGD+ +VKVGDTIPADLRL+  +NF+TDE+LLTGESLPVSKDAN 
Sbjct: 129  IRNGNSEVVDSTDVVPGDLVVVKVGDTIPADLRLVSQQNFETDEALLTGESLPVSKDANE 188

Query: 193  VFGKEEETSVGDRLNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLISRDPS 252
            +F  ++ET VGDR+NLAFSSS VVKGRA+GI IKT LN+EIGKIAKSL+G + LISRDP+
Sbjct: 189  IF--DDETPVGDRINLAFSSSTVVKGRAQGIAIKTGLNTEIGKIAKSLRGGNELISRDPA 246

Query: 253  KSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAIIVMASQKFDVDKR 312
            K+W QN WISTK+  GAFLGT  GTPLHRKLSKLAVLLFWIAV+FAI+VMASQKFDVD+ 
Sbjct: 247  KTWYQNAWISTKRTVGAFLGTTQGTPLHRKLSKLAVLLFWIAVVFAIVVMASQKFDVDRG 306

Query: 313  VAIYAICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSDKTG 372
            VAIYA+CVALSMIPSSLVVVLTITMSVGAAVM SRNVI+RKLDSLEALGAVNDICSDKTG
Sbjct: 307  VAIYAVCVALSMIPSSLVVVLTITMSVGAAVMASRNVIIRKLDSLEALGAVNDICSDKTG 366

Query: 373  TLTQGKMLARQIWIPRFGTITISNSDDPFNPNEGNVSLIPRFSPYEYSHNEDGDVGILQN 432
            TLTQGKM+A+QIW+P+FGT+ +  S++P NP +G+++ IP  SPYEYSHNE  DVGI+QN
Sbjct: 367  TLTQGKMIAKQIWVPKFGTLQVVGSNEPLNPEKGDINFIPNLSPYEYSHNETEDVGIMQN 426

Query: 433  FKDRLYEKDLPEDIDMDLFQKWLETATLANIATVFKDDATDCWKAHGDPTEIAIQVFATK 492
            FKD+   K +P +    LF KWLETA+LANIA+VF D  T  WKAHGDPTEIAIQVFAT+
Sbjct: 427  FKDKYEGKSIPGNCQYQLFDKWLETASLANIASVFTDPETKEWKAHGDPTEIAIQVFATR 486

Query: 493  MDLPHNALTGEKSTNQSNENDQS-SLSQHNEKPGSAQFEHIAEFPFDSTVKRMSSVYYNN 551
            MDLP + LTGE+     +E   S SLS+ +    +A+F H AEFPFDST+KRMSSVY + 
Sbjct: 487  MDLPRHVLTGERDDMDEDEIMSSVSLSEKDATAANAKFRHAAEFPFDSTIKRMSSVYESR 546

Query: 552  HNETYNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDVETIRKNVYSLSNEGLRVLGFA 611
              +TY IY KGAFES+++CC+ WYG+D    T +TD DV+TI++N+ S+S+EGLRVL FA
Sbjct: 547  DYKTYEIYTKGAFESVLNCCTHWYGRDPNTATVMTDADVDTIKENIDSMSSEGLRVLAFA 606

Query: 612  SKSFTKDQVNDDQLKNITSNRATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHM 671
            +KS+ K  VN+++L+ I   R  AE+ L FLGLIGIYDPPR ETAGAVKKFHQAGINV M
Sbjct: 607  NKSYPKSDVNEEKLQKILKERDYAETGLTFLGLIGIYDPPREETAGAVKKFHQAGINVRM 666

Query: 672  LTGDFVGTAKAIAQEVGILPTNLYHYSQEIVDSMVMTGSQFDGLSEEEVDDLPVLPLVIA 731
            LTGDF GTAKAIAQEVGILPTNLYHYS+E+VD MVMTG QFD LSE+E+D+LPVLPLVIA
Sbjct: 667  LTGDFPGTAKAIAQEVGILPTNLYHYSKEVVDIMVMTGKQFDNLSEDEIDNLPVLPLVIA 726

Query: 732  RCSPQTKVRMIEALHRRKKFCTMTGDGVNDSPSLKMANVGIAMGINGSDVSKEASDIVLS 791
            RCSPQTKVRMIEALHRR+KFC MTGDGVNDSPSLKMANVGIAMGINGSDV+K+ASDIVLS
Sbjct: 727  RCSPQTKVRMIEALHRREKFCAMTGDGVNDSPSLKMANVGIAMGINGSDVAKDASDIVLS 786

Query: 792  DDNFASILNAVEEGRRMTDNIQKFVLQLLAENVAQALYLIIGLVFRDENGKSVFPLSPVE 851
            DDNFASILNAVEEGRRM+DNIQKFVLQLLAENVAQALYLI+GL F+D+ GKSVFPL+PVE
Sbjct: 787  DDNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYLIVGLAFQDKEGKSVFPLAPVE 846

Query: 852  VLWIIVVTSCFPAMGLGLEKAAPDLMDRPPHDSEVGIFTWEVIIDTFAYGIIMTGSCMAS 911
            VLWIIVVTSCFPAMGLGLEKAA DLMDRPP+DS+ GIFTWE+I+D F YG+ M  SCMA+
Sbjct: 847  VLWIIVVTSCFPAMGLGLEKAAHDLMDRPPNDSKAGIFTWEIIVDMFVYGVWMAASCMAT 906

Query: 912  FTGSLYGINSGRLGHDCDGTYNSSCRDVYRSRSAAFATMTWCALILAWEVVDMRRSFFRM 971
            F   +YG + G LG +C+  Y+ SC DV+R+RSAAFATMTWCALILAWEV+D+RRSFFRM
Sbjct: 907  FVTIIYGRDHGNLGQNCNRDYSESCHDVFRARSAAFATMTWCALILAWEVIDLRRSFFRM 966

Query: 972  HPDTDSPVKEFFRSIWGNQFLFWSIIFGFVSAFPVVYIPVINDKVFLHKPIGAEWGLAIA 1031
            HPDTD+PVK+FF+ I+GN+FLF+S++FGF S FPVVYIPVIN  VFLHKPIG EWG+AIA
Sbjct: 967  HPDTDAPVKQFFKDIYGNKFLFYSVVFGFASVFPVVYIPVINTDVFLHKPIGWEWGIAIA 1026

Query: 1032 FTIAFWIGAELYKCGKRRYFKTQ-RAHNPENDLESNNKRDPF 1072
            F++ FWIG EL+K  KR Y++ + RA NPENDLE+     PF
Sbjct: 1027 FSVCFWIGCELHKYFKRIYYRNKSRAINPENDLENKAGTHPF 1068

>Kwal_23.3160
          Length = 1100

 Score = 1447 bits (3746), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 694/1065 (65%), Positives = 852/1065 (80%), Gaps = 15/1065 (1%)

Query: 16   AYHTLTAEEAAEFIGTSLTEGLTQDEFVHRLKTVGENTLGDDTKIDYKAMVLHQVCNAXX 75
            A+HT++A + A  + T L  GL   E   R+   GEN+LGDD+KID+K+++LHQ+CNA  
Sbjct: 22   AFHTVSARDTAHVLETDLQAGLRSAEATARVSQYGENSLGDDSKIDFKSILLHQICNAMI 81

Query: 76   XXXXXXXXXXFAMHDWITGGVISFVIAVNVLIGLVQEYKATKTMNSLKNLSSPNAHVIRN 135
                       A+ DWI+GGVI+FV+ +NV IG  QEYKA+KTMNSLK+LS+P+AHVIR+
Sbjct: 82   LVLFISMVITLAIRDWISGGVIAFVVFINVAIGSYQEYKASKTMNSLKSLSTPSAHVIRD 141

Query: 136  GKSETINSKDVVPGDICLVKVGDTIPADLRLIETKNFDTDESLLTGESLPVSKDANLVFG 195
            G  ETI SK +VPGD+C+VK GDT+PADLRLIE  NF+TDE+LLTGESLP++K+A+ V+ 
Sbjct: 142  GNDETIPSKQLVPGDLCVVKAGDTVPADLRLIECVNFETDEALLTGESLPIAKEASQVYP 201

Query: 196  KEEETSVGDRLNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLISRDPSKSW 255
              E+T VGDRLNLAF+SS V KGRA GIV+KT LN+EIGKIA+SL+GD+ LIS+D +K++
Sbjct: 202  ATEDTPVGDRLNLAFASSTVSKGRATGIVVKTGLNTEIGKIAQSLKGDNSLISKDENKTF 261

Query: 256  LQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAIIVMASQKFDVDKRVAI 315
              N  I+     G+FLGT  GTPLHRKLSKLAVLLF+IAV+FAI+VMA+QKF V+K VAI
Sbjct: 262  WANAGITLAATIGSFLGTTTGTPLHRKLSKLAVLLFFIAVVFAIVVMATQKFVVNKEVAI 321

Query: 316  YAICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSDKTGTLT 375
            YAICVA+SMIPSSLVVVLTITMSVGA +M +RNV+VRKLDSLEALGAVND+CSDKTGTLT
Sbjct: 322  YAICVAVSMIPSSLVVVLTITMSVGAKIMATRNVVVRKLDSLEALGAVNDVCSDKTGTLT 381

Query: 376  QGKMLARQIWIPRFGTITISNSDDPFNPNEGNVSLIPRFSPYEYSHNEDGDVGILQNFKD 435
            QGKM+ +Q W+P FGTIT+SNS +PF+P +G + LIPRFSP++Y H+   DVGI+ +FK+
Sbjct: 382  QGKMIVKQAWVPSFGTITVSNSSNPFDPTDGGIELIPRFSPHQYKHDSTEDVGIITSFKN 441

Query: 436  RLYEKDLPEDIDMDLFQKWLETATLANIATVFKDDATDCWKAHGDPTEIAIQVFATKMDL 495
            + Y   LP  ++  LF  WL+TA LANIA V++D  T+ WKAHGDPTEIAIQVFA K+D+
Sbjct: 442  KFYNDKLPAGLNSKLFLNWLKTAALANIAHVYQDPETEEWKAHGDPTEIAIQVFAHKLDM 501

Query: 496  PHNALTGE-KSTNQSNENDQSSLSQHNEKPGSAQFEHIAEFPFDSTVKRMSSVYYN-NHN 553
            P NALT E KS ++S+E+        + +P    ++HIAEFPFDS++KRMS+VY + + +
Sbjct: 502  PRNALTAEDKSDSESDEDAALGEKTSSVEP---HYKHIAEFPFDSSIKRMSAVYVSLDED 558

Query: 554  ETYNIYGKGAFESIISCCSSWY--GKDGVKITPLTDCDVETIRKNVYSLSNEGLRVLGFA 611
              + ++ KGAFE ++ CC+ W   G +     P+T+ D E + KNV +LS+EGLRVL FA
Sbjct: 559  NAHRVFTKGAFERVLDCCTKWLPDGCNESDAKPMTEEDKEEVFKNVETLSSEGLRVLAFA 618

Query: 612  SKSFTKDQ---VNDDQLKNITSNRATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGIN 668
            +KSFT+ Q   V++D  KN    R   ESDL+F GL+GIYDPPR ETAGAVK+FH+AGIN
Sbjct: 619  TKSFTESQALKVSEDLRKN----RDFVESDLIFQGLVGIYDPPRQETAGAVKQFHKAGIN 674

Query: 669  VHMLTGDFVGTAKAIAQEVGILPTNLYHYSQEIVDSMVMTGSQFDGLSEEEVDDLPVLPL 728
            VHMLTGDF GTAKAIAQEVGILP NLYHY +E+VDSMVMT +QFD L++EE+D+L +LPL
Sbjct: 675  VHMLTGDFPGTAKAIAQEVGILPRNLYHYPKEVVDSMVMTAAQFDQLTDEEIDNLLLLPL 734

Query: 729  VIARCSPQTKVRMIEALHRRKKFCTMTGDGVNDSPSLKMANVGIAMGINGSDVSKEASDI 788
            VIARC+PQTKVRMI+ALHRR+KFC MTGDGVNDSPSLK ANVGIAMGINGSDV+K+ASDI
Sbjct: 735  VIARCAPQTKVRMIDALHRREKFCAMTGDGVNDSPSLKKANVGIAMGINGSDVAKDASDI 794

Query: 789  VLSDDNFASILNAVEEGRRMTDNIQKFVLQLLAENVAQALYLIIGLVFRDENGKSVFPLS 848
            VLSDDNFASILNAVEEGRRM+DNIQKFVLQLLAENVAQALYL+IGL F DE+  SVFPLS
Sbjct: 795  VLSDDNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYLMIGLCFLDEDRLSVFPLS 854

Query: 849  PVEVLWIIVVTSCFPAMGLGLEKAAPDLMDRPPHDSEVGIFTWEVIIDTFAYGIIMTGSC 908
            PVEVLWIIVVTSCFPAMGLGLEK+APD+M++ P DS+ GIFTWE+I+D   YG  M   C
Sbjct: 855  PVEVLWIIVVTSCFPAMGLGLEKSAPDIMEKEPQDSKAGIFTWEIILDMLIYGTWMAACC 914

Query: 909  MASFTGSLYGINSGRLGHDCDGTYNSSCRDVYRSRSAAFATMTWCALILAWEVVDMRRSF 968
            +A F   +YG  +G LG +C+ +Y+ SC +VY  R+A FA+MTWCALILAWEV+DMRRSF
Sbjct: 915  LACFITVIYGKGNGELGINCNNSYSESCDNVYHGRAATFASMTWCALILAWEVIDMRRSF 974

Query: 969  FRMHPDTDSPVKEFFRSIWGNQFLFWSIIFGFVSAFPVVYIPVINDKVFLHKPIGAEWGL 1028
            F+M P+TD+P  ++ + IW NQFLFWS+IFGFVS FPVVYIPVIN  VF HK IG EWGL
Sbjct: 975  FKMQPETDTPYTQWMKDIWSNQFLFWSVIFGFVSVFPVVYIPVINKDVFKHKGIGYEWGL 1034

Query: 1029 AIAFTIAFWIGAELYKCGKRRYFKTQ-RAHNPENDLESNNKRDPF 1072
            A+A+TIAFWIGAELYK  KR YFK + RA NPE DLES    DPF
Sbjct: 1035 AVAYTIAFWIGAELYKYFKRCYFKNKGRAQNPEKDLESRRVHDPF 1079

>AGL097C [4215] [Homologous to ScYDR039C (ENA2 ) - NSH]
            (520915..524205) [3291 bp, 1096 aa]
          Length = 1096

 Score = 1416 bits (3665), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 687/1063 (64%), Positives = 838/1063 (78%), Gaps = 14/1063 (1%)

Query: 13   EFNAYHTLTAEEAAEFIGTSLTEGLTQDEFVHRLKTVGENTLGDDTKIDYKAMVLHQVCN 72
            E   +H L A E A  +GT L  GLT +E   RL+ VG+NTLG++  I+ +A++L Q+CN
Sbjct: 17   ERTDFHALPAHEVARLLGTDLRRGLTAEEARARLEVVGDNTLGEEEGINVRAILLKQMCN 76

Query: 73   AXXXXXXXXXXXXFAMHDWITGGVISFVIAVNVLIGLVQEYKATKTMNSLKNLSSPNAHV 132
            A             A+ DWI+GGVI+FV+A+NV IG  QEY A KTMNSLK+LS+P+A V
Sbjct: 77   AMILVLIISMVIALAIKDWISGGVIAFVVALNVSIGAYQEYNACKTMNSLKDLSTPSARV 136

Query: 133  IRNGKSETINSKDVVPGDICLVKVGDTIPADLRLIETKNFDTDESLLTGESLPVSKDANL 192
            IRNG+   + S  VVPGDI  V+VGDT+PADLRL+E  N +TDE+LLTGE+LPV+KD   
Sbjct: 137  IRNGEDVVMASAQVVPGDIVQVRVGDTVPADLRLVEALNLETDEALLTGEALPVAKDPAA 196

Query: 193  VFGKEEETSVGDRLNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLISRDPS 252
            VF  E++T VGDRLNLAF+SS V KGRA GIV++T L SEIGKIA+SLQG   LISRD +
Sbjct: 197  VF--EQDTPVGDRLNLAFASSTVSKGRATGIVVRTGLRSEIGKIAESLQGKQSLISRDEN 254

Query: 253  KSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAIIVMASQKFDVDKR 312
            KS LQNT ++ K   G+FLGTNVGTPLHRKL+KLA++LF IAVLFA+IVMA+QKF V++ 
Sbjct: 255  KSGLQNTVLTVKASVGSFLGTNVGTPLHRKLAKLALILFAIAVLFALIVMATQKFIVNRE 314

Query: 313  VAIYAICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSDKTG 372
            VAIYAICVALSMIPSSLVVVLTITMS GA VM +RNVIVR+LDSLEALGAVNDICSDKTG
Sbjct: 315  VAIYAICVALSMIPSSLVVVLTITMSAGAKVMSTRNVIVRRLDSLEALGAVNDICSDKTG 374

Query: 373  TLTQGKMLARQIWIPRFGTITISNSDDPFNPNEGNVSLIPRFSPYEYSHNEDGDVGILQN 432
            TLTQGKM+ +Q+W+P FGT+ ++ S+ PF+P  G+VSLIPRFSP+EY H+E+ DVGI+ N
Sbjct: 375  TLTQGKMILKQLWVPEFGTVVVNRSNVPFDPTVGDVSLIPRFSPWEYQHDEEEDVGIIAN 434

Query: 433  FKDRLYEKDLPEDIDMDLFQKWLETATLANIATVFKDDATDCWKAHGDPTEIAIQVFATK 492
            FK R     LP+ ++   F+ WL TATLANIATVFKD  +  W+AHGDPTEIAIQVFAT+
Sbjct: 435  FKQRWQSNSLPKGLNPRKFESWLHTATLANIATVFKDSDSKEWRAHGDPTEIAIQVFATR 494

Query: 493  MDLPHNALTGEKSTNQSNENDQSSLSQHNEKPGSAQFEHIAEFPFDSTVKRMSSVYYNNH 552
            MD PH+ALT E+     +E D  S SQ N+   +  +EH AEFPFDS++KRMS+VY N  
Sbjct: 495  MDHPHHALTTEQ-----DEEDSDS-SQQND--AARIYEHAAEFPFDSSIKRMSAVYINLR 546

Query: 553  NE-TYNIYGKGAFESIISCCSSWYGKDGVKIT-PLTDCDVETIRKNVYSLSNEGLRVLGF 610
            ++ T +++ KGAFE ++ CC+ W    G  +T PLT+ D+E I+KNV +LSNEGLRVL F
Sbjct: 547  DKNTRHVFTKGAFERVLKCCTRWKLDPGTGVTHPLTEDDLEIIQKNVDTLSNEGLRVLAF 606

Query: 611  ASKSFTKDQVNDDQLKNITSNRATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVH 670
            A+K+   ++  +   + +T +R   ESDL+F GL+GIYDPPR ETAGAVKK H+AGINVH
Sbjct: 607  ATKTIPAEEA-ESLGERLTKDRDFVESDLIFQGLVGIYDPPRVETAGAVKKCHRAGINVH 665

Query: 671  MLTGDFVGTAKAIAQEVGILPTNLYHYSQEIVDSMVMTGSQFDGLSEEEVDDLPVLPLVI 730
            MLTGDF GTAKAIAQEVGILP NLYHY +E+VD MVMT +QFD L++EE+D LPVLPLVI
Sbjct: 666  MLTGDFPGTAKAIAQEVGILPHNLYHYPKEVVDIMVMTATQFDSLTDEELDQLPVLPLVI 725

Query: 731  ARCSPQTKVRMIEALHRRKKFCTMTGDGVNDSPSLKMANVGIAMGINGSDVSKEASDIVL 790
            ARC+PQTKVRMI+ALHRR+KFC MTGDGVNDSPSLK ANVGIAMGINGSDV+K+ASDIVL
Sbjct: 726  ARCAPQTKVRMIDALHRREKFCAMTGDGVNDSPSLKKANVGIAMGINGSDVAKDASDIVL 785

Query: 791  SDDNFASILNAVEEGRRMTDNIQKFVLQLLAENVAQALYLIIGLVFRDENGKSVFPLSPV 850
            SDDNFASILNAVEEGRRM+DNIQKFVLQLLA NVAQA+YL++GL F DE+  SVFPLSPV
Sbjct: 786  SDDNFASILNAVEEGRRMSDNIQKFVLQLLAANVAQAIYLMLGLTFLDEDKLSVFPLSPV 845

Query: 851  EVLWIIVVTSCFPAMGLGLEKAAPDLMDRPPHDSEVGIFTWEVIIDTFAYGIIMTGSCMA 910
            EVLWIIVVTSC PAMGLGLEKAAPD+M++PP+DS+ GIFTWEVI+D   YG++M   C+ 
Sbjct: 846  EVLWIIVVTSCLPAMGLGLEKAAPDIMEKPPNDSKAGIFTWEVIVDMIVYGLVMAVCCLG 905

Query: 911  SFTGSLYGINSGRLGHDCDGTYNSSCRDVYRSRSAAFATMTWCALILAWEVVDMRRSFFR 970
             F   +Y    G LG +C+  Y+ SC+ V+  R+A FATMTWCALILAWEV+DMRRSFF 
Sbjct: 906  CFVSIIYKDGHGNLGTNCNVEYSDSCKSVFSGRAATFATMTWCALILAWEVIDMRRSFFA 965

Query: 971  MHPDTDSPVKEFFRSIWGNQFLFWSIIFGFVSAFPVVYIPVINDKVFLHKPIGAEWGLAI 1030
            M P+TD+P  + F+ IW N+FLFWS+IFGF S FPVVYIPVIN KVFLH  IG EWG+A 
Sbjct: 966  MKPETDTPYTQVFKDIWSNKFLFWSVIFGFTSVFPVVYIPVINTKVFLHIGIGYEWGIAF 1025

Query: 1031 AFTIAFWIGAELYKCGKRRYFKTQ-RAHNPENDLESNNKRDPF 1072
            AF++ FW+ AE +K  KRRY++ + RA NPE+DLE+    DPF
Sbjct: 1026 AFSLVFWLVAEFWKFAKRRYYRNKDRAINPESDLENRRLHDPF 1068

>KLLA0F20658g 1919851..1923099 similar to sp|Q12691 Saccharomyces
            cerevisiae YDR038c ENA5 P-type ATPase involved in Na+
            efflux, start by similarity
          Length = 1082

 Score = 1410 bits (3649), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 686/1062 (64%), Positives = 833/1062 (78%), Gaps = 20/1062 (1%)

Query: 15   NAYHTLTAEEAAEFIGTSLTEGLTQDEFVHRLKTVGENTLGDDTKIDYKAMVLHQVCNAX 74
            N +H LTA +  + + T + +GL   +   RL  VGENTLGDDTKI+ K +++ Q+CNA 
Sbjct: 17   NDFHVLTAPQVEKLLSTHINQGLNNTQIAERLSLVGENTLGDDTKINIKGILISQICNAM 76

Query: 75   XXXXXXXXXXXFAMHDWITGGVISFVIAVNVLIGLVQEYKATKTMNSLKNLSSPNAHVIR 134
                        A+ DWI+GGV++FV+ +NV+IG  QEY A+KTMNSLK+LS+P+AHVIR
Sbjct: 77   IMVLIISMVITLAIKDWISGGVLAFVVGINVVIGAYQEYNASKTMNSLKSLSTPSAHVIR 136

Query: 135  NGKSETINSKDVVPGDICLVKVGDTIPADLRLIETKNFDTDESLLTGESLPVSKDANLVF 194
            +G   TI SK++VPGDIC++KVGDT+PADLRL+E+ N +TDE+LLTGESLPV+K  + V+
Sbjct: 137  DGNDITIQSKELVPGDICIIKVGDTVPADLRLLESINLETDEALLTGESLPVAKSHSEVY 196

Query: 195  GKEEETSVGDRLNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLISRDPSKS 254
              E++T VGDRLNLAF++S V KGRA GIVIKTALN+EIGKIAKSL+ ++  IS+D +KS
Sbjct: 197  --EKDTPVGDRLNLAFAASTVTKGRATGIVIKTALNTEIGKIAKSLKSETSFISKDENKS 254

Query: 255  WLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAIIVMASQKFDVDKRVA 314
            + QN WI+ K+  G+FLGTNVGTPLHRKLS+LA+LLF +AV+FAI+VM +QK+ V+K+VA
Sbjct: 255  FGQNLWITLKETIGSFLGTNVGTPLHRKLSQLAILLFVVAVIFAIVVMGTQKYRVNKQVA 314

Query: 315  IYAICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSDKTGTL 374
            IYAICVA+SMIPSSLVVVLTITMS GA VM +RNVIVRKLDSLEALGAVNDICSDKTGTL
Sbjct: 315  IYAICVAISMIPSSLVVVLTITMSAGAKVMATRNVIVRKLDSLEALGAVNDICSDKTGTL 374

Query: 375  TQGKMLARQIWIPRFGTITISNSDDPFNPNEGNVSLIPRFSPYEYSHNEDGDVGILQNFK 434
            TQGKM+A+Q+WIP+FGTIT+  S++PFNP  G + LIP+FSPY+Y H+++ DVGI+ +FK
Sbjct: 375  TQGKMIAKQVWIPQFGTITVQESNEPFNPTIGEIHLIPKFSPYQYKHDDEEDVGIIPDFK 434

Query: 435  DRLYEKDLPEDIDMDLFQKWLETATLANIATVFKDDATDCWKAHGDPTEIAIQVFATKMD 494
             +    +L   +++ LF +WL TATLANIATVF+D  T  WKAHGDPTEIAIQVFAT+MD
Sbjct: 435  SKYLAGELGP-LNVSLFDQWLYTATLANIATVFQDSETQDWKAHGDPTEIAIQVFATRMD 493

Query: 495  LPHNALTGEKSTNQSNENDQSSLSQHNEKPGSAQFEHIAEFPFDSTVKRMSSVYYNNHNE 554
            LP + LTGE   ++ +    SS            FEH+AEFPFDS+VKRMS++Y N  + 
Sbjct: 494  LPRHVLTGEDKDDEKDARANSS------------FEHVAEFPFDSSVKRMSAIYKNTEDP 541

Query: 555  T---YNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDVETIRKNVYSLSNEGLRVLGFA 611
                Y ++ KGAFE ++ CC SWY     K +PL+  D+ETI+KNV +LS+EGLRVL FA
Sbjct: 542  ATPIYEVFTKGAFERVLQCCDSWYTTPDGKPSPLSKEDLETIQKNVDTLSSEGLRVLAFA 601

Query: 612  SKSFTKDQVNDDQLKNITSNRATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHM 671
             KSF + + N ++ K +   R   E  L FLGLIGIYDPPR E+  AVKK HQAGINVHM
Sbjct: 602  KKSFNESEFNANKDK-LLKERDFVECKLTFLGLIGIYDPPRQESLAAVKKCHQAGINVHM 660

Query: 672  LTGDFVGTAKAIAQEVGILPTNLYHYSQEIVDSMVMTGSQFDGLSEEEVDDLPVLPLVIA 731
            LTGDF GTAK+IAQEVGILP NLYHY +E+V+ MVM  + FD LS++E+DDL VLPLVIA
Sbjct: 661  LTGDFPGTAKSIAQEVGILPHNLYHYPKEVVNFMVMAATDFDALSDQEIDDLRVLPLVIA 720

Query: 732  RCSPQTKVRMIEALHRRKKFCTMTGDGVNDSPSLKMANVGIAMGINGSDVSKEASDIVLS 791
            RC+PQTKVRMIEALHRR KFC MTGDGVNDSPSLK+ANVGIAMGINGSDV+K+ASDIVLS
Sbjct: 721  RCAPQTKVRMIEALHRRSKFCAMTGDGVNDSPSLKIANVGIAMGINGSDVAKDASDIVLS 780

Query: 792  DDNFASILNAVEEGRRMTDNIQKFVLQLLAENVAQALYLIIGLVFRDENGKSVFPLSPVE 851
            DDNFASILNAVEEGRRM+DNIQKFVLQLLAENVAQALYL++GL F D+ G SVFPLSPVE
Sbjct: 781  DDNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYLMVGLCFVDKEGFSVFPLSPVE 840

Query: 852  VLWIIVVTSCFPAMGLGLEKAAPDLMDRPPHDSEVGIFTWEVIIDTFAYGIIMTGSCMAS 911
            VLWIIVVTSCFPAMGLGLEKA+ D+M++PP D++  +FTWEVIID   YG+IM   CMA 
Sbjct: 841  VLWIIVVTSCFPAMGLGLEKASVDVMEKPPKDAKAVVFTWEVIIDMLVYGVIMAACCMAC 900

Query: 912  FTGSLYGINSGRLGHDCDGTYNSSCRDVYRSRSAAFATMTWCALILAWEVVDMRRSFFRM 971
            F   LYG   G LG DC+     +C  V+R R+AAFATMTWCALILAWEVVDMRRSFF M
Sbjct: 901  FVTVLYGTGDGNLGSDCNDALGETCHLVFRGRAAAFATMTWCALILAWEVVDMRRSFFMM 960

Query: 972  HPDTDSPVKEFFRSIWGNQFLFWSIIFGFVSAFPVVYIPVINDKVFLHKPIGAEWGLAIA 1031
            +P++++P  + F+ IW NQFLFWSI+ GF S FPVVYIPVINDKVFLH  I  EWG AI 
Sbjct: 961  NPESETPYTQVFKDIWSNQFLFWSIVGGFCSVFPVVYIPVINDKVFLHYNISYEWGFAIG 1020

Query: 1032 FTIAFWIGAELYKCGKRRYFKTQ-RAHNPENDLESNNKRDPF 1072
            F+ AFW G ELYK GKR YF  + R  NPENDLE     DPF
Sbjct: 1021 FSFAFWAGVELYKYGKRHYFGIKDRVDNPENDLEKRAVHDPF 1062

>KLLA0E14630g complement(1297636..1300884) similar to sp|Q01896
            Saccharomyces cerevisiae YDR039c ENA2 P-type ATPase
            involved in Na+ efflux, hypothetical start
          Length = 1082

 Score = 1399 bits (3622), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 677/1062 (63%), Positives = 837/1062 (78%), Gaps = 24/1062 (2%)

Query: 17   YHTLTAEEAAEFIGTSLTEGLTQDEFVHRLKTVGENTLGDDTKIDYKAMVLHQVCNAXXX 76
            +H+L+       + T + +GL   +   RL  +GENTLGDD+KI+ K + + Q+CNA   
Sbjct: 19   FHSLSVSRVETLLSTHINQGLNTTQIAERLGLIGENTLGDDSKINIKGIFISQICNAMIM 78

Query: 77   XXXXXXXXXFAMHDWITGGVISFVIAVNVLIGLVQEYKATKTMNSLKNLSSPNAHVIRNG 136
                     FA+ DWI+GGVI+FV+ +NV+IG  QEY A+KTMNSLK+LS+P+AHVIR G
Sbjct: 79   VLIISMVISFAIKDWISGGVIAFVVFINVVIGAYQEYNASKTMNSLKSLSTPSAHVIRAG 138

Query: 137  KSETINSKDVVPGDICLVKVGDTIPADLRLIETKNFDTDESLLTGESLPVSKDANLVFGK 196
               TI SK++VPGDIC+++VGDT+PADLRL E  N +TDE+LLTGESLPV+K    V+  
Sbjct: 139  NDLTIESKELVPGDICIIRVGDTVPADLRLFEAINLETDEALLTGESLPVAKSHGEVY-- 196

Query: 197  EEETSVGDRLNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLISRDPSKSWL 256
            E++T VGDRLNLAF++S V KGRA GIVIKTALN+EIGKIAKSL+ ++ LISRD SKS+ 
Sbjct: 197  EQDTPVGDRLNLAFAASTVTKGRATGIVIKTALNTEIGKIAKSLKSEASLISRDKSKSFG 256

Query: 257  QNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAIIVMASQKFDVDKRVAIY 316
            +N WI+ ++  G FLGT+VGTPLHRKLS+LA+LLF +AV+FAI+VM +QKF V+K+VAIY
Sbjct: 257  RNLWITLRESIGTFLGTSVGTPLHRKLSQLAILLFVVAVIFAIVVMGTQKFKVNKQVAIY 316

Query: 317  AICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSDKTGTLTQ 376
            AICVALSMIPSSLVVVLTITMS GA VM +R+VI+RKLDSLEALGAVNDICSDKTGTLTQ
Sbjct: 317  AICVALSMIPSSLVVVLTITMSAGAKVMATRHVIIRKLDSLEALGAVNDICSDKTGTLTQ 376

Query: 377  GKMLARQIWIPRFGTITISNSDDPFNPNEGNVSLIPRFSPYEYSHNEDGDVGILQNFKDR 436
            GKM+A+Q+WIP+FGTI + NS++PFNP  G + LIP+FSPY+Y H+++ DVG++ +FK +
Sbjct: 377  GKMIAKQVWIPQFGTINVQNSNEPFNPTIGEIQLIPKFSPYQYKHDDEEDVGMITDFKSK 436

Query: 437  LYEKDLPEDIDMDLFQKWLETATLANIATVFKDDATDCWKAHGDPTEIAIQVFATKMDLP 496
             Y  +L   +++ LF +WL TATLANIATVF+D  T  WKAHGDPTEIAIQVFAT+MDLP
Sbjct: 437  YYADELGP-LNVSLFTQWLYTATLANIATVFRDPETQDWKAHGDPTEIAIQVFATRMDLP 495

Query: 497  HNALTGEKSTNQSNENDQSSLSQHNEKPGSAQFEHIAEFPFDSTVKRMSSVYYNNHNE-- 554
               LTGE + ++ N         HN+      FEH+AE+PFDS+VKRMS++Y N      
Sbjct: 496  RRVLTGEDNDDEKN--------IHND----ITFEHVAEYPFDSSVKRMSAIYKNVEEPKA 543

Query: 555  -TYNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDVETIRKNVYSLSNEGLRVLGFASK 613
              Y ++ KGAFE ++ CC+SWY        PLT+ D+ET++KNV +LS+EGLRVL FA K
Sbjct: 544  PIYEVFTKGAFERVLQCCNSWYTTPDGSPQPLTEEDLETVQKNVDTLSSEGLRVLAFAKK 603

Query: 614  SFTKDQ--VNDDQLKNITSNRATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHM 671
            +F + Q  +N D+L      R   E++L FLGL+GIYDPPR E+  AVKK H AGINVHM
Sbjct: 604  TFNESQFTINKDKL---LKERDFVENNLTFLGLVGIYDPPRRESLAAVKKCHLAGINVHM 660

Query: 672  LTGDFVGTAKAIAQEVGILPTNLYHYSQEIVDSMVMTGSQFDGLSEEEVDDLPVLPLVIA 731
            LTGDF GTAK+IAQEVGILP NLYHY +E+V+ MVMT + FD LS++E+D+LPVLPLVIA
Sbjct: 661  LTGDFPGTAKSIAQEVGILPHNLYHYPKEVVNFMVMTATDFDALSDKEIDELPVLPLVIA 720

Query: 732  RCSPQTKVRMIEALHRRKKFCTMTGDGVNDSPSLKMANVGIAMGINGSDVSKEASDIVLS 791
            RC+PQTKVRMIEALHRR +FC MTGDGVNDSPSLK+ANVGIAMGINGSDV+K+ASDIVLS
Sbjct: 721  RCAPQTKVRMIEALHRRNRFCAMTGDGVNDSPSLKIANVGIAMGINGSDVAKDASDIVLS 780

Query: 792  DDNFASILNAVEEGRRMTDNIQKFVLQLLAENVAQALYLIIGLVFRDENGKSVFPLSPVE 851
            DDNFASILNAVEEGRRM+DNIQKFVLQLLAENVAQALYL++GL F DE G SVFPLSPVE
Sbjct: 781  DDNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYLMVGLCFLDEEGFSVFPLSPVE 840

Query: 852  VLWIIVVTSCFPAMGLGLEKAAPDLMDRPPHDSEVGIFTWEVIIDTFAYGIIMTGSCMAS 911
            VLW+IVVTSCFPAMGLGLEKA  D+M++PP D++  IFTWEVI+D   YG+I+   CMA 
Sbjct: 841  VLWVIVVTSCFPAMGLGLEKANVDVMEKPPKDAKAVIFTWEVIVDMLVYGVIIAACCMAC 900

Query: 912  FTGSLYGINSGRLGHDCDGTYNSSCRDVYRSRSAAFATMTWCALILAWEVVDMRRSFFRM 971
            F   +YG   G LG  C+  ++ SCR V++ R+AAFATMTWCALILAWEVVDMRRSFF M
Sbjct: 901  FVTVIYGTGDGNLGRGCNNGFDDSCRLVFKGRAAAFATMTWCALILAWEVVDMRRSFFMM 960

Query: 972  HPDTDSPVKEFFRSIWGNQFLFWSIIFGFVSAFPVVYIPVINDKVFLHKPIGAEWGLAIA 1031
            +P+T++P  + F+ +W NQFLFWSI+ GF S FPVVYIPVINDKVFLH  I  EWG ++ 
Sbjct: 961  NPETETPYTQVFKDVWSNQFLFWSIVGGFCSVFPVVYIPVINDKVFLHYDITYEWGFSLG 1020

Query: 1032 FTIAFWIGAELYKCGKRRYFKTQ-RAHNPENDLESNNKRDPF 1072
            F++AFW GAELYK GKRRYF ++ R  NPE+DLE  + +DPF
Sbjct: 1021 FSLAFWAGAELYKYGKRRYFGSKDRVENPESDLEKRSVQDPF 1062

>Scas_569.0d
          Length = 468

 Score =  635 bits (1637), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/372 (77%), Positives = 328/372 (88%), Gaps = 2/372 (0%)

Query: 703  DSMVMTGSQFDGLSEEEVDDLPVLPLVIARCSPQTKVRMIEALHRRKKFCTMTGDGVNDS 762
            ++MVMTGSQFD L+ E++D+LPVLPLVIARCSPQTKVRMIEALHRR KFC MTGDGVNDS
Sbjct: 78   ENMVMTGSQFDELTPEQIDNLPVLPLVIARCSPQTKVRMIEALHRRDKFCAMTGDGVNDS 137

Query: 763  PSLKMANVGIAMGINGSDVSKEASDIVLSDDNFASILNAVEEGRRMTDNIQKFVLQLLAE 822
            PSLKMANVGIAMGINGSDV+K+ASDIVLSDDNFASILNA+EEGRRM+DNIQKFVLQLLAE
Sbjct: 138  PSLKMANVGIAMGINGSDVAKDASDIVLSDDNFASILNAIEEGRRMSDNIQKFVLQLLAE 197

Query: 823  NVAQALYLIIGLVFRDENGKSVFPLSPVEVLWIIVVTSCFPAMGLGLEKAAPDLMDRPPH 882
            NVAQALYLI GL F+D+ GKSVFPL+PVEVLWIIVVTSCFPAMGLGLEKAAPDLMDRPP+
Sbjct: 198  NVAQALYLICGLAFQDKEGKSVFPLAPVEVLWIIVVTSCFPAMGLGLEKAAPDLMDRPPN 257

Query: 883  DSEVGIFTWEVIIDTFAYGIIMTGSCMASFTGSLYGINSGRLGHDCDGTYNSSCRDVYRS 942
            DS+ GIFTWE+I+D F YGIIM G CM SFT  +YG + G LG +C+ +YN +C DV+R 
Sbjct: 258  DSKSGIFTWEIIVDMFVYGIIMAGCCMGSFTTVVYGKDGGNLGFNCNKSYNETCHDVFRG 317

Query: 943  RSAAFATMTWCALILAWEVVDMRRSFFRMHPDTDSPVKEFFRSIWGNQFLFWSIIFGFVS 1002
            RS+AFA MTWCALILAWEVVD+RRSFFRM P+TD+PV+EFFR IW N+FLFWS+IFGFVS
Sbjct: 318  RSSAFAVMTWCALILAWEVVDLRRSFFRMQPETDTPVREFFRDIWSNKFLFWSLIFGFVS 377

Query: 1003 AFPVVYIPVINDKVFLHKPIGAEWGLAIAFTIAFWIGAELYKCGKRRYFK--TQRAHNPE 1060
             FPV+YIPVINDKVFLHK I  EWG+A AFTI FW+G ELYK  KRRYF+    +A NPE
Sbjct: 378  TFPVIYIPVINDKVFLHKGITFEWGIAFAFTIIFWMGCELYKFMKRRYFRRMMNKAQNPE 437

Query: 1061 NDLESNNKRDPF 1072
            +DLE   +RDPF
Sbjct: 438  SDLEKRTRRDPF 449

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/47 (44%), Positives = 31/47 (65%)

Query: 13 EFNAYHTLTAEEAAEFIGTSLTEGLTQDEFVHRLKTVGENTLGDDTK 59
          E+N +HTL ++E A  + T  ++GL  ++F  R   VGEN+LGDD K
Sbjct: 27 EYNEFHTLQSQETANLLQTDASKGLDDEKFQARKSAVGENSLGDDMK 73

>CAGL0J01870g 181666..184506 highly similar to sp|P13586 Saccharomyces
            cerevisiae YGL167c PMR1, hypothetical start
          Length = 946

 Score =  352 bits (903), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 279/1002 (27%), Positives = 466/1002 (46%), Gaps = 162/1002 (16%)

Query: 17   YHTLTAEEAAEFIGTSLTEGLT-QDEFVHRLKTVGENTLG-DDTKIDYKAMVLHQVCNAX 74
            + TL+  E  E + T +  GL+ ++E V R +  G N    DD +   K  ++  V +  
Sbjct: 48   FCTLSVGETVENLETDVDNGLSSEEEVVKRREIHGRNDFEEDDDESMIKKFLMSFVEDRL 107

Query: 75   XXXXXXXXXXXFAMHDWITGGVISFVIAVNVLIGLVQEYKATKTMNSLKNLSSPNAHVIR 134
                       FA+        IS  I + V +G +QEY++ K++ +L  L     H+IR
Sbjct: 108  ILLLIGSAVLSFAIGQIDDAVSISLAILIVVTVGFIQEYRSEKSLEALNKLVPTKCHLIR 167

Query: 135  NGKSETINSKDVVPGDICLVKVGDTIPADLRLIETKNFDTDESLLTGESLPVSKDANLVF 194
             G+     + ++VPGD+   K+GD IPAD+R+IE  +   DES LTGE+ P+ KDA  + 
Sbjct: 168  YGRESNTLASELVPGDLVRFKIGDRIPADVRIIEAVDLSIDESNLTGETEPLHKDAQTID 227

Query: 195  GKE---EETSVGDRLNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLISRDP 251
             +E       V +R  +A+  + V +G  KGIVI T  N+  G I +             
Sbjct: 228  PEEYDNRNVPVSERSCIAYMGTLVKEGHGKGIVIGTGTNTSYGAIFE------------- 274

Query: 252  SKSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAIIVMASQKFDVDK 311
                + N+    K            TPL   + +L   L +I+     I+        + 
Sbjct: 275  ----MVNSIEKPK------------TPLQETMDRLGTELSYISFFIIAIISIVGIIRGNS 318

Query: 312  RVAIYAICVALSM--IPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSD 369
             + ++ + V+L++  IP  L +++T+T+++G   M  +N IVR+L S+E LG+VN IC+D
Sbjct: 319  LLMMFQVSVSLAVAAIPEGLPIIVTVTLALGVLRMTKQNAIVRRLPSVETLGSVNVICTD 378

Query: 370  KTGTLTQGKMLARQIWIPRFGTITISNSDDPFNPNEGNVSLIPRFSPYEYSHNEDGDVGI 429
            KTGTLT   M   +++     + T  N+  P   +E +V               D DV  
Sbjct: 379  KTGTLTTNHMTVSKLFCLD-SSGTYENAISPEEDSEFDV--------------HDNDVK- 422

Query: 430  LQNFKDRLYEKDLPEDIDMDLFQKWLETATLANIATVFKDDATDCWKAHGDPTEIAIQVF 489
                                      ET T+ANI    K          G+PT++A+   
Sbjct: 423  --------------------------ETLTIANICNNAKYSEEHNLYI-GNPTDVALIEV 455

Query: 490  ATKMDLPHNALTGEKSTNQSNENDQSSLSQHNEKPGSAQFEHIAEFPFDSTVKRMSSVYY 549
             TK  +P                DQ               E + E  F+S  K M+ +  
Sbjct: 456  LTKFGIP----------------DQRD-----------SHEKMEELSFNSKRKYMA-IKS 487

Query: 550  NNHNETYNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDVETIRKNVYSLSNEGLRVLG 609
            +  +  + +Y KGAFE I+   S +  K G ++    +     + +  +S +++GLR + 
Sbjct: 488  SKESGEHVLYIKGAFERILDKSSYYLDKAG-EVREFDEHSKVMVLEAAHSCASDGLRTIA 546

Query: 610  FASKSFTKDQV-NDDQLKNITSNRATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGIN 668
             A K    D V ++D +  +T           F GL G+ DPPR     +++K H+ G++
Sbjct: 547  CAFKPTDSDNVISEDDINGLT-----------FTGLFGLADPPRPNVKASIEKLHRGGVH 595

Query: 669  VHMLTGDFVGTAKAIAQEVGILPTNLYHYSQEIVDSMVMTGSQFDGLSEEEVDDLPVLPL 728
            + M+TGD V TA +IA+++G+        S +  +S VMTG +   L+E+E+  +     
Sbjct: 596  IIMITGDSVNTAVSIAEKIGL--------SVQDRESSVMTGDKVSELTEDELSKVIDKVN 647

Query: 729  VIARCSPQTKVRMIEALHRRKKFCTMTGDGVNDSPSLKMANVGIAMGINGSDVSKEASDI 788
            + AR +P+ K+ +++AL +R     MTGDGVND+P+LK+A++GIAMGI+G+DV+KE SD+
Sbjct: 648  IFARATPENKLNIVKALRKRGDIVAMTGDGVNDAPALKLADIGIAMGISGTDVAKEVSDM 707

Query: 789  VLSDDNFASILNAVEEGRRMTDNIQKFVLQLLAENVAQALYLIIGLVFRDENGKSVFPLS 848
            +L+DD+F+SIL A+EEG+ + +NI+ F+   L+ +VA    + I  +      K   PL+
Sbjct: 708  ILTDDDFSSILTAIEEGKGIFNNIRNFLTFQLSISVATLSLIAITTI-----AKLPAPLN 762

Query: 849  PVEVLWIIVVTSCFPAMGLGLEKAAPDLMDRPPHDSEVGIFTWEVIIDTFAYGIIMTGSC 908
            P+++LWI ++    PA  LG+E    D+MD+PP   E  I    +++      I     C
Sbjct: 763  PMQILWINIIMDGPPAQSLGVEPVDSDVMDKPPRSREERILNMNILLRLLYLAI-----C 817

Query: 909  MASFTGSLYGINSGRLGHDCDGTYNSSCRDVYRSRSAAFATMTWCALILAWEVVDMRRSF 968
            +    G+ Y    G      D    ++ +D+    +  F    + A+  A       +S 
Sbjct: 818  I--LVGTFYIFLKG-----MDENQQTTSKDI----TMTFTGFVFFAIFNAVACRHTTKSI 866

Query: 969  FRMHPDTDSPVKEFFRSIWGNQFLFWSIIFGFVSAFPVVYIP 1010
            F++              ++ N+    +I+         VYIP
Sbjct: 867  FQI-------------GLFSNRIFNIAILLSVCGQMCAVYIP 895

>YGL167C (PMR1) [1823] chr7 complement(187620..190472)
           Ca2+-transporting P-type ATPase of Golgi membrane
           involved in Ca2+ and Mn2+ import into Golgi [2853 bp,
           950 aa]
          Length = 950

 Score =  349 bits (896), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 262/920 (28%), Positives = 454/920 (49%), Gaps = 148/920 (16%)

Query: 17  YHTLTAEEAAEFIGTSLTEGL-TQDEFVHRLKTVGEN--TLGDDTKIDYKAMVLHQVCNA 73
           Y TL+ +EA E + T    GL + +E  +R    G N  T+ DD  + +K  + + + + 
Sbjct: 38  YCTLSVDEALEKLDTDKNGGLRSSNEANNRRSLYGPNEITVEDDESL-FKKFLSNFIEDR 96

Query: 74  XXXXXXXXXXXXFAMHDWITGGVISFVIAVNVLIGLVQEYKATKTMNSLKNLSSPNAHVI 133
                         M +      I+  I + V +G VQEY++ K++ +L  L     H++
Sbjct: 97  MILLLIGSAVVSLFMGNIDDAVSITLAIFIVVTVGFVQEYRSEKSLEALNKLVPAECHLM 156

Query: 134 RNGKSETINSKDVVPGDICLVKVGDTIPADLRLIETKNFDTDESLLTGESLPVSKDANLV 193
           R G+   + +  +VPGD+   ++GD IPAD+R+IE  +   DES LTGE+ PV K +  +
Sbjct: 157 RCGQESHVLASTLVPGDLVHFRIGDRIPADIRIIEAIDLSIDESNLTGENEPVHKTSQTI 216

Query: 194 FGKEEETSVGDRLN----------LAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGD 243
               E++S  D+ N          +A+  + V +G  KGIV+ T  N+  G + + +   
Sbjct: 217 ----EKSSFNDQPNSIVPISERSCIAYMGTLVKEGHGKGIVVGTGTNTSFGAVFEMMN-- 270

Query: 244 SGLISRDPSKSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAIIVMA 303
               + +  K+ LQ T                   L + LS ++ ++  +  L  II   
Sbjct: 271 ----NIEKPKTPLQLTM----------------DKLGKDLSLVSFIVIGMICLVGIIQGR 310

Query: 304 S--QKFDVDKRVAIYAICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALG 361
           S  + F +       ++ +A++ IP  L +++T+T+++G   M  R  IVR+L S+E LG
Sbjct: 311 SWLEMFQI-------SVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVETLG 363

Query: 362 AVNDICSDKTGTLTQGKMLARQIWIPRFGTITISNSDDPFNPNEGNVSLIPRFSPYEYSH 421
           +VN ICSDKTGTLT   M   ++W        + +  +  N        +      + + 
Sbjct: 364 SVNVICSDKTGTLTSNHMTVSKLW-------CLDSMSNKLN--------VLSLDKNKKTK 408

Query: 422 NEDGDVGILQNFKDRLYEKDLPEDIDMDLFQKWLETATLANIATVFKDDATDCWKAHGDP 481
           N +G+   L+N+        L ED+     ++ L    L N A+  ++ A       G+P
Sbjct: 409 NSNGN---LKNY--------LTEDV-----RETLTIGNLCNNASFSQEHAI----FLGNP 448

Query: 482 TEIAIQVFATKMDLPHNALTGEKSTNQSNENDQSSLSQHNEKPGSAQFEHIAEFPFDSTV 541
           T++A+       ++P    T +K                           + E PF+S  
Sbjct: 449 TDVALLEQLANFEMPDIRNTVQK---------------------------VQELPFNSKR 481

Query: 542 KRMSSVYYNNHNETYNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDVETIRKNVYSLS 601
           K M++   N  +    +Y KGAFE I+   +S+    G K   LT+    TI +   S++
Sbjct: 482 KLMATKILNPVDNKCTVYVKGAFERILEYSTSYLKSKGKKTEKLTEAQKATINECANSMA 541

Query: 602 NEGLRVLGFASKSFTKDQ--VNDDQLKNITSNRATAESDLVFLGLIGIYDPPRNETAGAV 659
           +EGLRV GFA  + +     + +D +K           DL F GLIG+ DPPR     A+
Sbjct: 542 SEGLRVFGFAKLTLSDSSTPLTEDLIK-----------DLTFTGLIGMNDPPRPNVKFAI 590

Query: 660 KKFHQAGINVHMLTGDFVGTAKAIAQEVGILPTNLYHYSQEIVDSM--VMTGSQFDGLSE 717
           ++  Q G+++ M+TGD   TA  IA+++GI           ++D    V++G + D +S+
Sbjct: 591 EQLLQGGVHIIMITGDSENTAVNIAKQIGI----------PVIDPKLSVLSGDKLDEMSD 640

Query: 718 EEVDDLPVLPLVIARCSPQTKVRMIEALHRRKKFCTMTGDGVNDSPSLKMANVGIAMGIN 777
           +++ ++     + AR +P+ K+ ++ AL +R     MTGDGVND+P+LK++++G++MG  
Sbjct: 641 DQLANVIDHVNIFARATPEHKLNIVRALRKRGDVVAMTGDGVNDAPALKLSDIGVSMGRI 700

Query: 778 GSDVSKEASDIVLSDDNFASILNAVEEGRRMTDNIQKFVLQLLAENVAQALYLIIGLVFR 837
           G+DV+KEASD+VL+DD+F++IL A+EEG+ + +NIQ F+   L+ +VA    + +   F+
Sbjct: 701 GTDVAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQNFLTFQLSTSVAALSLVALSTAFK 760

Query: 838 DENGKSVFPLSPVEVLWIIVVTSCFPAMGLGLEKAAPDLMDRPPHDSEVGIFTWEVIIDT 897
             N     PL+ +++LWI ++    PA  LG+E    ++M +PP      I T +V+   
Sbjct: 761 LPN-----PLNAMQILWINILMDGPPAQSLGVEPVDHEVMKKPPRKRTDKILTHDVM--- 812

Query: 898 FAYGIIMTGSCMASFTGSLY 917
               ++ T +C+    G++Y
Sbjct: 813 --KRLLTTAACI--IVGTVY 828

>AEL301W [2204] [Homologous to ScYGL167C (PMR1) - SH]
            complement(75104..77977) [2874 bp, 957 aa]
          Length = 957

 Score =  348 bits (892), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 278/959 (28%), Positives = 455/959 (47%), Gaps = 160/959 (16%)

Query: 111  QEYKATKTMNSLKNLSSPNAHVIRNGKSETINSKDVVPGDICLVKVGDTIPADLRLIETK 170
            QEY++ K++ +L  L   + H+IR G    + +  +VPGD+   KVGD IPAD+R+IE+ 
Sbjct: 140  QEYRSEKSLEALHKLVPASCHLIRFGAETHVLASCLVPGDLVYFKVGDRIPADVRIIEST 199

Query: 171  NFDTDESLLTGESLPVSKDANLVFGKEEE------TSVGDRLNLAFSSSAVVKGRAKGIV 224
            +   DES LTGE+ PV K    V              +G+R ++A+  + V +G  KGIV
Sbjct: 200  DLSLDESTLTGETEPVHKSCTPVNSATYSDVPGGIIPIGERTSIAYMGTLVREGHGKGIV 259

Query: 225  IKTALNSEIGKIAKSLQGDSGLISRDPSKSWLQNTWISTKKVTGAFLGTNVGTPLHRKLS 284
            + T  ++  G + + +       S +  K+ LQ    +                L R LS
Sbjct: 260  VATGKHTMFGAVFEMMN------SIEKPKTPLQMAMDT----------------LRRDLS 297

Query: 285  KLAVLLFWIAVLFAIIVMAS--QKFDVDKRVAIYAICVALSMIPSSLVVVLTITMSVGAA 342
             +  +L  I  L  +I   S  + F +       ++ +A++ IP  L +++T+T+++G  
Sbjct: 298  YVRFVLSGIIFLLGVIQGRSWLEMFQI-------SVSLAVAAIPEGLPIIVTVTLALGVL 350

Query: 343  VMVSRNVIVRKLDSLEALGAVNDICSDKTGTLTQGKMLARQIWIPRFGTITISNSDDPFN 402
             M +R  IVR+L S+E LG+VN ICSDKTGTLT   M A +IW    G++          
Sbjct: 351  RMANRKAIVRRLPSVETLGSVNVICSDKTGTLTANHMTASKIWC--LGSMA--------- 399

Query: 403  PNEGNVSLIPRFSPYEYSHNEDGDVGILQNFKDRLYEKDLPEDIDMDLFQKWLETATLAN 462
             N+ NV  +        + +  G  G L N K+ L           D  +  L   ++ N
Sbjct: 400  -NKNNVLSLE-------AKSSGGLPGKLPNLKNYLS----------DDVKATLRIGSICN 441

Query: 463  IATVFKDDATDCWKAHGDPTEIAIQVFATKMDLPHNALTGEKSTNQSNENDQSSLSQHNE 522
             A+   +      K  G+PT+IA+     K DL                         +E
Sbjct: 442  NASFSHEHG----KYLGNPTDIALLEVLQKFDLV------------------------DE 473

Query: 523  KPGSAQFEHIAEFPFDSTVKRMSSVYYNNHNE-TYNIYGKGAFESIISCCSSWYGKDGVK 581
            +P + + +   E  F+S  K M+    +  N   + IY KGAFE I+   +S+ G  G K
Sbjct: 474  RPTTTRVD---ELTFNSKRKYMAVKVDSPANSGKHIIYVKGAFERILERSASFIGGAG-K 529

Query: 582  ITPLTDCDVETIRKNVYSLSNEGLRVLGFAS-KSFTKDQVNDDQLKNITSNRATAESDLV 640
            +  L+D     I     SL++EGLR L FA  +  T   +ND  ++N+T           
Sbjct: 530  VEKLSDSHKSLINDCAKSLASEGLRTLAFAQLECSTNKPMNDSTIQNLT----------- 578

Query: 641  FLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPTNLYHYSQE 700
            F+GLIG+ DPPR+    A+++  Q G++V M+TGD   TA  IA+++GI   N      E
Sbjct: 579  FVGLIGMKDPPRSTVRPAIEELLQGGVHVIMITGDAENTAVNIARQIGIPVIN-----PE 633

Query: 701  IVDSMVMTGSQFDGLSEEEVDDLPVLPLVIARCSPQTKVRMIEALHRRKKFCTMTGDGVN 760
            I    V+TG + D ++++++  +     + AR +P+ K+ ++ AL +R     MTGDGVN
Sbjct: 634  I---SVLTGDRLDQMTDDQLAGVIDHVNIFARATPEHKLNIVRALQKRGDIVAMTGDGVN 690

Query: 761  DSPSLKMANVGIAMGINGSDVSKEASDIVLSDDNFASILNAVEEGRRMTDNIQKFVLQLL 820
            D+P+LK+A++G+AMG  G+DV+KEASD+VL+DD+F++IL A+EEG+ + +NIQ F+   L
Sbjct: 691  DAPALKLADIGVAMGHMGTDVAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQSFLTFQL 750

Query: 821  AENVAQALYLIIGLVFRDENGKSVFPLSPVEVLWIIVVTSCFPAMGLGLEKAAPDLMDRP 880
            + +VA    + I   F+ +N     PL+ +++LWI ++    PA  LG+E    ++M +P
Sbjct: 751  STSVAALSLVAIATAFKLQN-----PLNAMQILWINILMDGPPAQSLGVEPVDHEVMRKP 805

Query: 881  PHDSEVGIFTWEVIIDTFAYGIIMTGSCMASFTGSLYGINSGRLGHDCDGTYNSSCRDVY 940
            P      I T +V+         + G  +  F   +            DG    + RD  
Sbjct: 806  PRKRSDKILTPQVMRRLLINAAFIIGGTIYVFIKEMTE----------DGQV--TARD-- 851

Query: 941  RSRSAAFATMTWCALILAWEVVDMRRSFFRMHPDTDSPVKEFFR-SIWGNQFLFWSIIFG 999
                    TMT+   +      DM  +    H       K  F   I+ N+   +++ F 
Sbjct: 852  -------TTMTFTCFVF----FDMFSALACRH-----ATKSIFEIGIFNNKMFNYAVGFS 895

Query: 1000 FVSAFPVVYIPVINDKVFLHKPIGAEWGLAIAFTIAFWIGAELYKCGKRRYFKTQRAHN 1058
             +     +YIP   +     +    +    I  + + +I  E+     R+Y+  +  H 
Sbjct: 896  LLGQLCAIYIPFFQNIFKTERLSLGDLIYLIVISSSVFIADEV-----RKYYAKKNTHQ 949

>CAGL0I04312g complement(382354..385209) highly similar to sp|P13586
           Saccharomyces cerevisiae YGL167c PMR1 Ca2+-transporting
           P-type ATPase, start by similarity
          Length = 951

 Score =  343 bits (881), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 272/927 (29%), Positives = 449/927 (48%), Gaps = 150/927 (16%)

Query: 6   TKENNNAEFNAYHTLTAEEAAEFIGTSLTEGLTQ-DEFVHRLKTVGENTLG-DDTKIDYK 63
           TK N + E   Y TL+ EE    + T    GL+  +E   R +  G N +  DD +   K
Sbjct: 38  TKPNPSLE---YCTLSVEETLHKLDTDAKLGLSSVEEATKRRQYYGPNEISVDDDESLVK 94

Query: 64  AMVLHQVCNAXXXXXXXXXXXXFAMHDWITGGVISFVIAVNVLIGLVQEYKATKTMNSLK 123
             + + V +               + +      I+  I + V +G VQEY++ K++ +L 
Sbjct: 95  KFLSNFVEDRLILLLMGSAIISVFLGNIDDAISITMAIVIVVTVGFVQEYRSEKSLEALN 154

Query: 124 NLSSPNAHVIRNGKSETINSKDVVPGDICLVKVGDTIPADLRLIETKNFDTDESLLTGES 183
            L     H+IR G+   + + ++VPGD+   ++GD IPAD+R+IE  +   DES LTGE+
Sbjct: 155 KLVPQECHLIRGGRESNVLATNLVPGDLVRFRIGDRIPADIRIIECNDLTIDESNLTGET 214

Query: 184 LPVSKDANLV----FGKEEET--SVGDRLNLAFSSSAVVKGRAKGIVIKTALNSEIGKIA 237
            PV K    +    +  +  +   V +R N+A+  + V +G  +GIV+ T   +  G + 
Sbjct: 215 DPVHKSYKALSRDSYNDQPNSIVPVAERTNIAYMGTLVKEGNGRGIVVGTGRETSFGNVF 274

Query: 238 KSLQGDSGLISRDPSKSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLF 297
           + +                    I   K           TPL   + KL   L   + + 
Sbjct: 275 EMMSS------------------IEKPK-----------TPLQLTMDKLGKDLSLASFVV 305

Query: 298 AIIVMASQKFDVDKRVAIYAICVALSM--IPSSLVVVLTITMSVGAAVMVSRNVIVRKLD 355
             I+           + ++ I V+L++  IP  L +++T+T+++G   M  R  IVR+L 
Sbjct: 306 IGIICVVGIIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLP 365

Query: 356 SLEALGAVNDICSDKTGTLTQGKMLARQIWIPRFGTITISNSDDPFNPNEGNVSLIPRFS 415
           S+E LG+VN ICSDKTGTLT   M   +IW    G++           N+ NV       
Sbjct: 366 SVETLGSVNVICSDKTGTLTSNHMTVSKIWC--LGSMA----------NKLNV------- 406

Query: 416 PYEYSHNEDGDVGILQNFKDRLYEKDLPEDIDMDLFQKWLETATLANIATVFKDDATDCW 475
                 N+ G+   L+N+        L +D+   L         L N A+  ++ A    
Sbjct: 407 -LSLDKNKGGN---LKNY--------LTDDVKTTLL-----CGNLCNNASYSQEHA---- 445

Query: 476 KAHGDPTEIAIQVFATKMDLPHNALTGEKSTNQSNENDQSSLSQHNEKPGSAQFEHIAEF 535
           K  G+PT++A+     K +L                               +++  + E 
Sbjct: 446 KYLGNPTDVALLEQLQKFELAD---------------------------VRSEYTKVKEL 478

Query: 536 PFDSTVKRMSSVYYNNHNETYNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDVETIRK 595
            F+S  K M++   +N  +T  ++ KGAFE I+   SS+  + G KI  LT    ETI  
Sbjct: 479 SFNSKRKMMATKIQDNEKKT-TLFIKGAFERILDKSSSYLTEKG-KIEKLTAGHRETIID 536

Query: 596 NVYSLSNEGLRVLGFASKSFTKDQ---VNDDQLKNITSNRATAESDLVFLGLIGIYDPPR 652
              +L++EGLRVL FA ++ T      V DD             SDLVF GLIG+ DPPR
Sbjct: 537 CANTLASEGLRVLAFAKRAMTDSSSKLVEDDI------------SDLVFTGLIGMNDPPR 584

Query: 653 NETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPTNLYHYSQEIVDSM--VMTGS 710
           +    A+ +F Q GI++ M+TGD   TA  IA+++GI           ++D    V++G 
Sbjct: 585 SSVKFAIDQFLQGGIHIIMITGDSENTAVNIARQIGI----------PVIDPKLSVLSGD 634

Query: 711 QFDGLSEEEVDDLPVLPLVIARCSPQTKVRMIEALHRRKKFCTMTGDGVNDSPSLKMANV 770
           + + ++++++ ++     + AR +P+ K+ ++ AL RR     MTGDGVND+P+LK+A++
Sbjct: 635 KLNEMTDDQLANVIDHVNIFARATPEHKLNIVRALRRRGDVVAMTGDGVNDAPALKLADI 694

Query: 771 GIAMGINGSDVSKEASDIVLSDDNFASILNAVEEGRRMTDNIQKFVLQLLAENVAQALYL 830
           G++MG  G+DV+KEASD++L+DD+F++IL A+EEG+ + +NIQ F+   L+ ++A    +
Sbjct: 695 GVSMGRMGTDVAKEASDMILTDDDFSTILTAIEEGKGIFNNIQNFLSFQLSTSIAALSLV 754

Query: 831 IIGLVFRDENGKSVFPLSPVEVLWIIVVTSCFPAMGLGLEKAAPDLMDRPPHDSEVGIFT 890
            +   F   N     PL+ +++LWI ++    PA  LG+E    ++M +PP      I T
Sbjct: 755 ALSTAFMLPN-----PLNAMQILWINILMDGPPAQSLGVEPVDHEVMKKPPRKRTDKILT 809

Query: 891 WEVIIDTFAYGIIMTGSCMASFTGSLY 917
            E++       +I T SC+    G++Y
Sbjct: 810 AELL-----KRLIGTASCI--ILGTVY 829

>Kwal_14.1498
          Length = 939

 Score =  341 bits (874), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 264/896 (29%), Positives = 434/896 (48%), Gaps = 147/896 (16%)

Query: 17  YHTLTAEEAAEFIGTSLTEGL-TQDEFVHRLKTVGENTLG--DDTKIDYKAMVLHQVCNA 73
           + +L+ EE A+ +GT    GL T      R    G+N +   +D  + +K  V   V + 
Sbjct: 33  FCSLSVEETAQSLGTDTQNGLPTMSVVEERRAQYGKNEISSEEDEPLWWK-FVTTFVGDP 91

Query: 74  XXXXXXXXXXXXFAMHDWITGGVISFVIAVNVLIGLVQEYKATKTMNSLKNLSSPNAHVI 133
                       F M +      I+  I + V +G VQEY++ K++ +L  L     H+I
Sbjct: 92  LILLLIGSAVISFIMGNIDDAVSITLAIVIVVTVGFVQEYRSEKSLEALNRLVPDQCHLI 151

Query: 134 RNGKSETINSKDVVPGDICLVKVGDTIPADLRLIETKNFDTDESLLTGESLPVSKDANLV 193
           R G+   + +  +VPGD+   +VGD IPADLR+IE  +   +ES LTGE+ PV K    V
Sbjct: 152 RCGQESKLLASVLVPGDVVRFRVGDRIPADLRIIEAVDLSIEESNLTGENEPVHKSTATV 211

Query: 194 ---FGKEEETS---VGDRLNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLI 247
              F KE   S   V +R  +AF  + V +G  +GIVI TA N+  GK+ + +       
Sbjct: 212 NKEFYKENLGSIVPVSERSCIAFMGTLVREGHGRGIVIGTAKNTAFGKVFEMMN------ 265

Query: 248 SRDPSKSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAIIVMAS--Q 305
           + +  K+ LQ                     L + LS ++ ++  I  L  +I   S  +
Sbjct: 266 AIEKPKTPLQTAM----------------DKLGKDLSFMSFIVIGIICLIGVIQGRSWLE 309

Query: 306 KFDVDKRVAIYAICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVND 365
            F +       ++ +A++ IP  L +++T+T+++G   M  R  I+R+L S+E LG+VN 
Sbjct: 310 MFQI-------SVSLAVAAIPEGLPIIVTVTLALGVLRMAKRRAIIRRLPSVETLGSVNV 362

Query: 366 ICSDKTGTLTQGKMLARQIWIPRFGTITISNSDDPFNPNEGNVSLIPRFSPYEYSHNEDG 425
           ICSDKTGTLT   M   ++W    G+++          N+ N+  + + +          
Sbjct: 363 ICSDKTGTLTANHMSVNKVWC--LGSMS----------NKSNILKLDKATSGS------- 403

Query: 426 DVGILQNFKDRLYEKDLPEDIDMDLFQKWLETATLANIATVFKDDATDCWKAHGDPTEIA 485
                       ++K+L ED+     +  L T  L N +T   + A    K  G+PT+IA
Sbjct: 404 ------------FKKNLTEDL-----RATLRTGNLCNNSTYSHEHA----KYLGNPTDIA 442

Query: 486 IQVFATKMDLPHNALTGEKSTNQSNENDQSSLSQHNEKPGSAQFEHIAEFPFDSTVKRMS 545
           +     K  L                         +E+P   Q     E  F+S  K M 
Sbjct: 443 LLEVLHKFGL------------------------EDERP---QVTRSDEISFNSKRKFM- 474

Query: 546 SVYYNNHNETYNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDVETIRKNVYSLSNEGL 605
           +V     N  + ++ KGA+E I+   + +   +  K+  L     + I  +  +L+++GL
Sbjct: 475 AVKVKEANGKFVVHVKGAYEKILEKSTHFINAEN-KVVKLDSNLRQAITDSADALASDGL 533

Query: 606 RVLGFA--------SKSFTKDQVNDDQLKNITSNRATAESDLVFLGLIGIYDPPRNETAG 657
           R L FA        SK  T+D +N                 L F GL+G+ DPPR     
Sbjct: 534 RTLAFAQLELSNGNSKKLTEDDIN----------------GLTFAGLLGMNDPPRPSVKA 577

Query: 658 AVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPTNLYHYSQEIVDSMVMTGSQFDGLSE 717
           AV++  +  +++ M+TGD   TA +IA+++GI   N         ++ V+TG + D +SE
Sbjct: 578 AVERLSEGSVHIIMITGDAENTAVSIARQIGIPVVN--------PETAVLTGDKLDHMSE 629

Query: 718 EEVDDLPVLPLVIARCSPQTKVRMIEALHRRKKFCTMTGDGVNDSPSLKMANVGIAMGIN 777
           +++  +     + AR +P+ K+ ++ AL +R     MTGDGVND+P+LK+A++G++MG  
Sbjct: 630 DQLASIIDHVNIFARATPEHKLNIVRALQKRGDIVAMTGDGVNDAPALKLADIGVSMGKM 689

Query: 778 GSDVSKEASDIVLSDDNFASILNAVEEGRRMTDNIQKFVLQLLAENVAQALYLIIGLVFR 837
           G+DV+KEASD+VL+DD+F++IL A+EEG+ + +NIQ F+   L+ +VA    + I   F+
Sbjct: 690 GTDVAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQNFLTFQLSTSVAALSLVAIATAFK 749

Query: 838 DENGKSVFPLSPVEVLWIIVVTSCFPAMGLGLEKAAPDLMDRPPHDSEVGIFTWEV 893
             N     PL+ +++LWI ++    PA  LG+E    ++M +PP      I T  V
Sbjct: 750 LPN-----PLNAMQILWINILMDGPPAQSLGVEPVDHEVMKKPPRKRADKILTKAV 800

>Scas_707.48*
          Length = 741

 Score =  318 bits (815), Expect = 9e-95,   Method: Compositional matrix adjust.
 Identities = 231/730 (31%), Positives = 372/730 (50%), Gaps = 127/730 (17%)

Query: 97  ISFVIAVNVLIGLVQEYKATKTMNSLKNLSSPNAHVIRNGKSETINSKDVVPGDICLVKV 156
           I+  I + V +G VQEY++ K++ +L  L     H+IR G+   + +  +VPGD+   K+
Sbjct: 120 ITLAIVIVVSVGFVQEYRSEKSLEALNKLVPAECHLIRCGQESHVLASGLVPGDLVHFKI 179

Query: 157 GDTIPADLRLIETKNFDTDESLLTGESLPVSKDANLV----FGKEEET--SVGDRLNLAF 210
           GD IPADLR+IE  +   DES LTGE+ PV K A  V    F  +  +   + DR  +A+
Sbjct: 180 GDRIPADLRIIEAVDLSIDESNLTGENEPVHKSAKEVNKDSFNDQPNSIIPISDRTCVAY 239

Query: 211 SSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLISRDPSKSWLQNTWISTKKVTGAF 270
             + V +G  KGIV+    N+  G I + L       + +  K+ LQN            
Sbjct: 240 MGTLVKEGHGKGIVVGIGKNTSFGAIFEMLS------NIEKPKTPLQNAM---------- 283

Query: 271 LGTNVGTPLHRKLSKLAVLLFWIAVLFAIIVMAS--QKFDVDKRVAIYAICVALSMIPSS 328
                   L + LS  + ++  +  L  I+   S  + F +       ++ +A++ IP  
Sbjct: 284 ------DKLGKDLSLFSFIVIGLICLVGILQGRSWLEMFQI-------SVSLAVAAIPEG 330

Query: 329 LVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSDKTGTLTQGKMLARQIWIPR 388
           L +++T+T+++G   M  R  IVR+L S+E LG+VN ICSDKTGTLT   M A +IW   
Sbjct: 331 LPIIVTVTLALGVLRMAKRKAIVRRLPSVETLGSVNVICSDKTGTLTSNHMTASKIWC-- 388

Query: 389 FGTITISNSDDPFNPNEGNVSLIPRFSPYEYSHNEDGDVGILQNFKDRLYEKDLPEDIDM 448
             ++           N+ NV  +           E    G L+N+        L ED+  
Sbjct: 389 LDSMA----------NKANVLSL-----------EKSKSGSLKNY--------LTEDV-- 417

Query: 449 DLFQKWLETATLANIATVFKDDATDCWKAHGDPTEIAIQVFATKMDLPHNALTGEKSTNQ 508
              +  L    + N A+  ++      K  G+PT+IA+    +K DL             
Sbjct: 418 ---KSTLTIGNICNNASFSQEHG----KYLGNPTDIALLEQLSKFDL------------- 457

Query: 509 SNENDQSSLSQHNEKPGSAQFEHIAEFPFDSTVKRMSSVYYNNHNETYNIYGKGAFESII 568
                       + +P    F+ + E PF+S  K M+    N+  + Y++  KGAFE ++
Sbjct: 458 -----------SDIRP---TFKKVQEIPFNSKRKFMAVKIVNSEGK-YSLCVKGAFEKVL 502

Query: 569 SCCSSWYGKDGVKITPLTDCDVETIRKNVYSLSNEGLRVLGFASKSFTKDQVNDDQLKNI 628
           S CS +  + G K   LT    + I +   SL++EGLR+L FA  +              
Sbjct: 503 SQCSHYLNQKG-KTEKLTQGQRDVIIETANSLASEGLRMLAFAKTTLPD----------- 550

Query: 629 TSNRATAES--DLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQE 686
           +    T ES  DL+F GLIG+ DPPR     A+++  Q G+++ M+TGD   TA  IA++
Sbjct: 551 SPTLLTEESVGDLIFTGLIGMNDPPRPTVKPAIEQLLQGGVHIIMITGDSENTAVNIARQ 610

Query: 687 VGILPTNLYHYSQEIVDSMVMTGSQFDGLSEEEVDDLPVLPLVIARCSPQTKVRMIEALH 746
           +GI P      S       V++G + + +S++++ ++     + AR +P+ K+ ++ AL 
Sbjct: 611 IGI-PVLDPKLS-------VLSGDKLNEMSDDQLANVIDHVNIFARATPEHKLNIVRALR 662

Query: 747 RRKKFCTMTGDGVNDSPSLKMANVGIAMGINGSDVSKEASDIVLSDDNFASILNAVEEGR 806
           +R     MTGDGVND+P+LK+A++G++MG  G+DV+KEASD+VL+DD+F++IL A+EEG+
Sbjct: 663 KRGDVVAMTGDGVNDAPALKLADIGVSMGRMGTDVAKEASDMVLTDDDFSTILTAIEEGK 722

Query: 807 RMTDNIQKFV 816
            + +NIQ F+
Sbjct: 723 GIFNNIQNFL 732

>KLLA0A03157g complement(281313..284129) gi|3288523|emb|CAA04476.1
           Kluyveromyces lactis Ca++ ATPase, start by similarity
          Length = 938

 Score =  319 bits (818), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 264/892 (29%), Positives = 418/892 (46%), Gaps = 138/892 (15%)

Query: 17  YHTLTAEEAAEFIGTSLTEGLTQ-DEFVHRLKTVGENTLGDDTKID-YKAMVLHQVCNAX 74
           Y T++ E+    +GT    GL+   E  +R    G N +  D K+  +K  +   + +  
Sbjct: 33  YCTVSVEDTIAQLGTDFDNGLSNPSEIAYRKSIWGSNEVLPDEKVSLWKKFLSTFIEDPL 92

Query: 75  XXXXXXXXXXXFAMHDWITGGVISFVIAVNVLIGLVQEYKATKTMNSLKNLSSPNAHVIR 134
                      F M +      I+  I + V +G VQEYK+ K++ +L  L     H+ R
Sbjct: 93  ILLLIGSAVISFLMGNIDDSISIALAIIIVVTVGFVQEYKSEKSLEALNKLVPAECHLTR 152

Query: 135 NGKSETINSKDVVPGDICLVKVGDTIPADLRLIETKNFDTDESLLTGESLPVSKDANLVF 194
           +G+   + + ++VPGD+   KVGD IPADLR++E+ +   DES LTGE+ PV K +  V 
Sbjct: 153 SGQLSHVLASNLVPGDLVRFKVGDRIPADLRIVESIDLCVDESNLTGENEPVHKSSGAVD 212

Query: 195 GKEEE------TSVGDRLNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLIS 248
            K           VGDR  + F  + V +G  KGIVI T  ++  G + + + G      
Sbjct: 213 PKNYSHIPGSIIPVGDRNCIGFMGTLVREGHGKGIVIATGKHTVFGSVFEMMSG------ 266

Query: 249 RDPSKSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAIIVMASQKFD 308
                       I   K           TPL   + KL   L +++ +   I+       
Sbjct: 267 ------------IDKPK-----------TPLQTAMDKLGQDLSYMSFVLIGIICLIGIIQ 303

Query: 309 VDKRVAIYAICVALSM--IPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDI 366
               + ++ I V+L++  IP  L +++T+T+++G   M  R  IVR+L S+E LG+VN I
Sbjct: 304 GRSWLEMFQIAVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVETLGSVNVI 363

Query: 367 CSDKTGTLTQGKMLARQIWIPRFGTITISNSDDPFNPNEGNVSLIPRFSPYEYSHNEDGD 426
           CSDKT                  GT+T          N   VS I      E   N    
Sbjct: 364 CSDKT------------------GTLT---------ANHMTVSKIWCLGSMENKTN---- 392

Query: 427 VGILQNFKDRLYEKDLPEDIDMDLFQKWLETATLANIATVFKDDATDCWKAHGDPTEIAI 486
              L   K+R      P  ++ D+    L    + N  T  ++      K  G+PT+IAI
Sbjct: 393 CLALSKVKER------PIKMEQDV-ATTLRIGNICNNGTYSQEH----LKYLGNPTDIAI 441

Query: 487 QVFATKMDLPHNALTGEKSTNQSNENDQSSLSQHNEKPGSAQFEHIAEFPFDSTVKRMSS 546
                                        SL              I E PF+S  K M+ 
Sbjct: 442 L---------------------------ESLQHFGINDCRNSVNKINEIPFNSKRKFMA- 473

Query: 547 VYYNNHNETYNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDVETIRKNVYSLSNEGLR 606
           V   + N+   +Y KGAFE I+    ++ G+DG K+  L   D   I     +L++EGLR
Sbjct: 474 VKTIDANDKVVVYVKGAFEKIVEKSINYIGRDG-KVHKLKPNDKAIINDAAVALASEGLR 532

Query: 607 VLGFA----SKSFTKDQVNDDQLKNITSNRATAESDLVFLGLIGIYDPPRNETAGAVKKF 662
            L FA    S +    + N+D ++ +T           F GLI + DPPR     A+++ 
Sbjct: 533 TLAFAELEVSATHGDKEFNEDMVEGLT-----------FTGLIAMNDPPRPTVRSAIEEL 581

Query: 663 HQAGINVHMLTGDFVGTAKAIAQEVGILPTNLYHYSQEIVDSMVMTGSQFDGLSEEEVDD 722
            Q  ++V M+TGD   TA +IA+++GI P     YS       V++G + D ++++++  
Sbjct: 582 LQGSVHVIMITGDAENTAVSIARQIGI-PVINPEYS-------VLSGDKLDQMTDDQLAS 633

Query: 723 LPVLPLVIARCSPQTKVRMIEALHRRKKFCTMTGDGVNDSPSLKMANVGIAMGINGSDVS 782
           +     V AR +P+ K+ ++ AL +R     MTGDGVND+P+LK+A++G++MG  G+DV+
Sbjct: 634 VIDHVNVFARATPEHKLNIVRALQKRGDIVAMTGDGVNDAPALKLADIGVSMGKMGTDVA 693

Query: 783 KEASDIVLSDDNFASILNAVEEGRRMTDNIQKFVLQLLAENVAQALYLIIGLVFRDENGK 842
           KEASD+VL+DD+F++IL A+EEG+ + +NIQ F+   L+ +VA    + I    +  N  
Sbjct: 694 KEASDMVLTDDDFSTILTAIEEGKGIFNNIQNFLTFQLSTSVAALSLVAISTSLKLPN-- 751

Query: 843 SVFPLSPVEVLWIIVVTSCFPAMGLGLEKAAPDLMDRPPHDSEVGIFTWEVI 894
              PL+ +++LWI ++    PA  LG+E    ++M +PP      I T  V+
Sbjct: 752 ---PLNAMQILWINILMDGPPAQSLGVEPVDHEVMRKPPRKRTDKILTDAVL 800

>Kwal_47.17547
          Length = 1240

 Score =  236 bits (603), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 250/1013 (24%), Positives = 443/1013 (43%), Gaps = 141/1013 (13%)

Query: 90   DWITGGVISFVIAVNVLIGLVQEYKATKTMNSLKNLSSPN-AHVIRNGKSETINSKDVVP 148
            DW+ G  I   + V +L+G   +Y+     + L +  +     V+RNG    I+  D++ 
Sbjct: 147  DWVEGVAIMIAVLVVILVGSANDYQKELQFSKLNDKKNDREVIVLRNGDEHLISIHDILV 206

Query: 149  GDICLVKVGDTIPADLRLIETKNFDTDESLLTGESLPVSKDA-NLVFGKEEETSVGDRL- 206
            GDI  ++ GD +PAD  L++  + + DES LTGES  + K A ++ + K ++ S  D   
Sbjct: 207  GDILSLQTGDVVPADCILVKG-SCECDESALTGESATIKKAAIDVCYEKYKQLSATDAAI 265

Query: 207  ------------NLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLISRDPSKS 254
                         +  S S ++ G  + +V    +NS  G+   +L+ ++      P + 
Sbjct: 266  DIGTPGAEKVPDPMLISGSKLLSGLGRAVVTSVGVNSMHGRTLMALKVEA---ETTPLQE 322

Query: 255  WLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAII----------VMAS 304
             L ++  ++  V G               S  A+LLF+I  +  +           +  +
Sbjct: 323  RL-DSLANSISVYG---------------SAAALLLFFILFMRFLANLKKGGELHDLTPA 366

Query: 305  QKFDVDKRVAIYAICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVN 364
            QK      + I  I V +  +P  L + +T+ ++     M     +VR L + E +G+  
Sbjct: 367  QKGSRFMNIFIVGITVIVVAVPEGLPLAVTLALAFATTRMAKDGNLVRVLRACETMGSAT 426

Query: 365  DICSDKTGTLTQGKMLARQIWIPRFGTITISNSDDPFNPNEGNVSLIPRFSPYEYSHNED 424
             +CSDKTGTLT+ +M      +  F   T  +  +   P++                  D
Sbjct: 427  AVCSDKTGTLTENRMTV----VKGFLGSTFFDEAESVGPSDSET---------------D 467

Query: 425  GDVGILQNFKDRLYEKDLPEDIDMD---LFQKWLETATLANIATVFKDDATDC-WKAHGD 480
             D+ I     + L +KD+  +I ++      K  E   ++N     K   +   W  +  
Sbjct: 468  VDLAIANECSEEL-KKDVLTNITLNSTAFENKENEEDKVSNENPFHKPRKSLFPWSRNNK 526

Query: 481  ---PTEIAIQVFATKMDLPHNALTGEKSTN------QSNENDQSSLSQHNEKPGSAQFEH 531
               P      V     D P     G K+        Q N   Q+ L  + ++P     E 
Sbjct: 527  SKKPATAKELVENAAADQPKEPFLGSKTETALLAFAQKNLGMQN-LHHYRDEPDCLGIEK 585

Query: 532  IAEF-PFDSTVKRMSSVYYNNHNETYNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDV 590
            I +  PF+S+ ++   +     N  +  Y KGA E ++  C      D  K+T ++  D 
Sbjct: 586  IVQIIPFESS-RKWGGIVVKYKNGLHRFYIKGAAELLLRRCMQKRASDS-KLTLISQKDF 643

Query: 591  ETIRKNVYSLSNEGLRVLGFASKSF--------------------TKDQVNDDQLKNITS 630
            +   + + +L+ E LR +  A + +                    + D +  D++    S
Sbjct: 644  DEESQTITNLAAEALRAISLAHRDYPNCPNWPPSELQDEVEPEAASPDLLFGDEVSRSDS 703

Query: 631  NRATAE---SDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEV 687
                A+   S +V  G++GI DP R     +V++  +AG+ V M+TGD + TA AIA++ 
Sbjct: 704  VSEPAQELVSPMVLDGIVGIQDPLRKGVRKSVEQCQKAGVTVRMVTGDNILTATAIAKKC 763

Query: 688  GILPTNLYHYSQEIVDSMVMTGSQFDGLS-EEEVDDLPVLPLVIARCSPQTKVRMIEALH 746
             IL        +       M G +F  LS +E V  LP L  V+AR SP+ K  ++E L 
Sbjct: 764  SILSEEQAENPES-----SMEGPRFRKLSNKERVRILPNL-RVLARSSPEDKRILVETLK 817

Query: 747  RRKKFCTMTGDGVNDSPSLKMANVGIAMGINGSDVSKEASDIVLSDDNFASILNAVEEGR 806
            +      +TGDG ND+P+LK+A+VG +MGI G++V++EASDI+L  D+F++I+NA++ GR
Sbjct: 818  KMGDVVAVTGDGTNDAPALKLADVGFSMGIAGTEVAREASDIILMTDDFSAIVNAIKWGR 877

Query: 807  RMTDNIQKFVLQLLAENVAQALYLIIGLVFRDENGKSVFPLSPVEVLWIIVVTSCFPAMG 866
             ++ +I+KF+   L  NV   +   +  V   E       L+ V++LW+ ++     A+ 
Sbjct: 878  CVSTSIKKFIQFQLTVNVTAVVLTFVSAVASSEEASV---LTAVQLLWVNLIMDTLAALA 934

Query: 867  LGLEKAAPDLMDRPPHDSE---VGIFTWEVIIDTFAYGIIMTGSCMASFTGS--LYGINS 921
            L  +K   ++++R P   E   + + TW++I+      +I+T   +  F G    +   +
Sbjct: 935  LATDKPDENILERKPKGREAVLITVSTWKMILGQSTLQLIVT--FILHFAGKQIFFPGKA 992

Query: 922  GRLGHDCDG----TYNSSCRDVYRSRSAAFATMTWCALILAWEVVDMRRSFFRMHPDTDS 977
               GH+       T+N            AF  + +  LI+  + +D       +     +
Sbjct: 993  TITGHEQQQLNAMTFN------------AFVWLQFFKLIVTRK-LDEADGISNVKDRITA 1039

Query: 978  PVKEFFRSIWGNQFLFWSIIFGFVSAFPVVYIPVINDKVFLHKPIGAEWGLAI 1030
                FF+ ++ N + F +II   +  F V+ + V      + K  GA W  AI
Sbjct: 1040 SNLNFFQDLFRN-YYFLAIIV-LIGGFQVLIMYVGGAAFSIAKQTGAMWATAI 1090

>CAGL0A00517g 58830..62198 similar to sp|P38929 Saccharomyces
           cerevisiae YGL006w PMC1, hypothetical start
          Length = 1122

 Score =  225 bits (573), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 241/886 (27%), Positives = 388/886 (43%), Gaps = 149/886 (16%)

Query: 90  DWITGGVISFVIAVNVLIGLVQEYKATKTMNSL-KNLSSPNAHVIRNGKSETINSKDVVP 148
           DWI G  I   + V VL+    +Y+       L +        V+R+     I+  +++ 
Sbjct: 118 DWIEGLAIMMAVLVVVLVSAANDYQKELQFQQLNRKREDRQVVVVRDAAESLISIHNLLV 177

Query: 149 GDICLVKVGDTIPADLRLIETKNFDTDESLLTGES-----LPVS---------------- 187
           GD+  ++ GD +PAD  L+  +  +TDES LTGES     LP++                
Sbjct: 178 GDLLKLQTGDVVPADCVLVRGE-CETDESALTGESNTIKKLPLADALEYHSAHGGRDIGD 236

Query: 188 KDANLVFGKEEETSVGDRLNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLI 247
             A+   G  +++   D   +  S S V+ G A  IV    +NS  GK   SL+ DS   
Sbjct: 237 TSASGASGAADDSRCPD--CMLISGSRVLSGLASAIVTNVGVNSVHGKTMASLKEDSE-- 292

Query: 248 SRDPSKSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKL-----------AVLLFWIAVL 296
                                        TPL  +LS+L           A+ LF   VL
Sbjct: 293 ----------------------------DTPLQMRLSQLTDNISVYGCVAAITLF--VVL 322

Query: 297 FA-----IIVMASQKFDVDKR--------VAIYAICVALSMIPSSLVVVLTITMSVGAAV 343
           FA     I+    +  D+           + I AI V +  +P  L + +T+ ++     
Sbjct: 323 FARYLSYILPSGGKYHDLPPAEKGSKFMDIFITAITVIVVAVPEGLPLAVTLALAFATTR 382

Query: 344 MVSRNVIVRKLDSLEALGAVNDICSDKTGTLTQGKMLARQIWIPRFGTITISNSDD-PFN 402
           M     +VR L S E +G+   +CSDKTGTLT+  M   +      GT+  +  DD   +
Sbjct: 383 MTKDGNLVRVLRSCETMGSATAVCSDKTGTLTENIMTVVR------GTLGRAGFDDIGAD 436

Query: 403 PNEGNVSLIPRFSPYEYSHNEDGDVGILQNFKDRLYEKDLPEDIDMDLFQKWLETATLAN 462
           P++ N+    + S    +   D  V     F+++ Y KD      +D  Q       +  
Sbjct: 437 PSKSNLVFKKKCSDLLRTVIYDNIVLNSTAFENKDY-KDPNNYNSIDDSQPRRLIRRITQ 495

Query: 463 IATVFKDDATDCWKAH----------GDPTEIAIQVFATK-MDLPHNALTGEKSTNQSNE 511
                K D  +   AH          G  TE A+   A K   L   AL           
Sbjct: 496 TLQKKKPDDEENLLAHAAEGRQEPYIGSKTETALLSLARKSFGLKFGAL----------- 544

Query: 512 NDQSSLSQHNEKPGSAQFEHIAEF-PFDSTVKRMSSVYYNNHNE-----TYNIYGKGAFE 565
               S   H EK  +   E I +  PF+S+ K  + V   N N+      + +Y KGA E
Sbjct: 545 ---QSFRGHPEKLPTV--ETIVQIIPFESSRKWSAIVVKLNSNKENEGKKFRLYVKGAAE 599

Query: 566 SIISCCS-SWYGKDGVKITPLTDCDVETIRKNVYSLSNEGLRVLGFASKSFTKDQVNDDQ 624
            +   C+      +G  I+ +     + I + ++SL+ + LR +  A   F  ++    +
Sbjct: 600 IVAKACTLKNVCNEG--ISEIDQKSKDDIEEQIFSLAKDALRAISLAHMDFDVNEWPPKE 657

Query: 625 LKNITSNRATAESDLV-----------FLGLIGIYDPPRNETAGAVKKFHQAGINVHMLT 673
           L +  ++       L+              ++GI DP R     +V +  +AG+ V M+T
Sbjct: 658 LADPENSHEALAVKLIDPKKPHLEGLTLDAIVGIQDPLRENVKNSVAQCQKAGVTVRMVT 717

Query: 674 GDFVGTAKAIAQEVGILPTNLYHYSQEIVDSMVMTGSQFDGLSEEEVDDLPVLPLVIARC 733
           GD + TAKAIA+  GIL +   + S     +  M G  F  LS+ E   +     V+AR 
Sbjct: 718 GDNLLTAKAIARNCGILSSKSLNDS-----ACAMEGPAFRKLSDSERKRILPKLRVLARS 772

Query: 734 SPQTKVRMIEALHRRKKFCTMTGDGVNDSPSLKMANVGIAMGINGSDVSKEASDIVLSDD 793
           SP+ K  ++ AL    +   +TGDG ND+P+LK+A+VG +MGI G++V++EASDI+L  D
Sbjct: 773 SPEDKKILVRALKEMGEVVAVTGDGTNDAPALKLADVGFSMGITGTEVAREASDIILMTD 832

Query: 794 NFASILNAVEEGRRMTDNIQKFV-LQLLAENVAQALYLIIGLVFRDENGKSVFPLSPVEV 852
           +F++I+NA++ GR +  +I+KF+  QL+    A  L  +  ++  D   KSV  L+ V++
Sbjct: 833 DFSAIVNAIKWGRCVAASIKKFIQFQLIVNVTAVLLTFVTSVISSDV--KSV--LTAVQL 888

Query: 853 LWIIVVTSCFPAMGLGLEKAAPDLMDRPPHDSEVGIF---TWEVII 895
           LW+ ++     A+ L  +K  P++MDR P      +    TW++II
Sbjct: 889 LWVNLIMDTLAALALATDKPDPNIMDRKPKGRSTPLITPSTWKMII 934

>KLLA0A08910g complement(779526..783368) similar to sp|P38929
            Saccharomyces cerevisiae YGL006w PMC1 Ca2+-transporting
            P-type ATPase, start by similarity
          Length = 1280

 Score =  212 bits (539), Expect = 8e-56,   Method: Compositional matrix adjust.
 Identities = 219/851 (25%), Positives = 369/851 (43%), Gaps = 157/851 (18%)

Query: 132  VIRNGKSETINSKDVVPGDICLVKVGDTIPADLRLIETKNFDTDESLLTGESLPVSKDA- 190
            VIRNG    I+  D++ GD+  ++ GD +PAD  LI + + + DES LTGES  + K A 
Sbjct: 243  VIRNGDEHLISIHDLLVGDVISLQTGDVVPADAVLI-SGSCECDESALTGESDTIKKVAL 301

Query: 191  -------NLVFGKEEETSVGDRL-------NLAFSSSAVVKGRAKGIVIKTALNSEIGKI 236
                     +F K+    +G           L  S S ++ G    ++     NS  G+I
Sbjct: 302  KPALEKYKQIFEKDPTIDIGSHGVGEKVPDPLLISGSKLLSGIGNAVITSVGENSVNGRI 361

Query: 237  AKSLQGDSGLISRDPSKSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLA--------- 287
              +L+ +S                                TPL  +LS LA         
Sbjct: 362  MMALKTESE------------------------------STPLQERLSNLADNISIYGCM 391

Query: 288  ---VLLFWIAVLFAIIVMASQKF-DV------DKRVAIYAICVALSMI--PSSLVVVLTI 335
               VL   + + F   +   +K+ D+       K + I+   V + ++  P  L + +T+
Sbjct: 392  AALVLFIILFIRFLTYLPNGKKYHDLPPAQKGSKFMNIFITAVTVIVVAVPEGLPLAVTL 451

Query: 336  TMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSDKTGTLTQGKMLARQIWIPRFG----- 390
             ++     M     +VR L + E +G+   ICSDKTGTLT+ +M   + +    G     
Sbjct: 452  ALAFATTRMTKDGNLVRVLRACETMGSATAICSDKTGTLTENRMTVVKGFAGNLGFDDTT 511

Query: 391  ----------TITISNSDDPFNPN-EGNVSLIPRFSPYEYSHNEDGDVGILQNFKDRLYE 439
                       +  SN D     +   N+SL       + S ++D DV      K R   
Sbjct: 512  HAENKEIKSAVVLRSNCDASLLTDILSNISLNSTAFENKESQHKDKDVDENPYHKSR--- 568

Query: 440  KDLPEDIDMDLFQKWLETATLANIATVFKDDATDCWKAHGDPTEIAIQVFATKMDLPHNA 499
                      LF       T   IA   K++        G  TE A+  FA K       
Sbjct: 569  --------KSLFPWSRNNRTSQLIADAMKENDEQFL---GSKTETALLAFAQKS------ 611

Query: 500  LTGEKSTNQSNENDQSSLSQHNEKPGSAQFEHIAE-FPFDSTVKRMSSVYYNNHNETYNI 558
              G K  ++              KP     + + +  PF+S+ K  +       N+ Y  
Sbjct: 612  -LGMKDVHK-----------LRTKPSDLGIDKVVQVIPFESSRKWGAIAVQLADNKGYRF 659

Query: 559  YGKGAFESIISCCSSWYGKDGVKITPLTDCDVETIRKNVYSLSNEGLRVLGFASKSF--- 615
            Y KGA E ++  CS+    D   I P+     +   K +  +++  LR +    + F   
Sbjct: 660  YAKGAAEILLKVCSNQRNSDN-SIVPMNQDLYDESFKKIQDMASHALRTISLVHRDFKEW 718

Query: 616  --------------TKDQVNDDQL--KNITSNRATAESDLVFLGLIGIYDPPRNETAGAV 659
                          + D V   +L  KN++S   T ++      ++G+ DP R     +V
Sbjct: 719  PPKEFADSTDPSIASPDLVMGHELDHKNLSSEGMTLDA------MVGLQDPLREGVKESV 772

Query: 660  KKFHQAGINVHMLTGDFVGTAKAIAQEVGILPTNLYHYSQEIVDSMVMTGSQFDGLSEEE 719
            ++  +AG+ V M+TGD + TA+AI++   IL    Y+  +       M G  F  L  ++
Sbjct: 773  EQCQRAGVTVRMVTGDNILTARAISRNCNILSEEGYNDPE-----CAMEGPTFRKLPYKK 827

Query: 720  VDDLPVLP--LVIARCSPQTKVRMIEALHRRKKFCTMTGDGVNDSPSLKMANVGIAMGIN 777
            +  L V+P   V+AR SP+ K  ++E L +  +   +TGDG ND+P+LK+A+VG +MGI+
Sbjct: 828  M--LRVIPKLRVLARSSPEDKRILVETLKKMGEVVAVTGDGTNDAPALKLADVGFSMGIS 885

Query: 778  GSDVSKEASDIVLSDDNFASILNAVEEGRRMTDNIQKFVLQLLAENVAQALYLIIGLVFR 837
            G++V++EASDI+L  D+F +I+NA++ GR ++ +I+KF+   L  N+   +   +  V  
Sbjct: 886  GTEVAREASDIILMTDDFTAIVNAIKWGRCVSVSIKKFIQFQLTVNITAVILTFVSAVAS 945

Query: 838  DENGKSVFPLSPVEVLWIIVVTSCFPAMGLGLEKAAPDLMDRPPHDSE---VGIFTWEVI 894
             E   SV  L+ V++LW+ ++     A+ L  +K    ++DR P   +   + + TW++I
Sbjct: 946  AEE-TSV--LTAVQLLWVNLIMDTLAALALATDKPDEFILDRKPKGRDAPLIAVSTWKMI 1002

Query: 895  IDTFAYGIIMT 905
            +   A  + +T
Sbjct: 1003 LGQAALQLTVT 1013

>YGL006W (PMC1) [1966] chr7 (485923..489444) Vacuolar
           Ca2+-transporting P-type ATPase, member of the cation
           transporting (E1-E2) P-type ATPase superfamily,
           functions to pump Ca2+ into the vacuole [3522 bp, 1173
           aa]
          Length = 1173

 Score =  182 bits (461), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 126/391 (32%), Positives = 213/391 (54%), Gaps = 28/391 (7%)

Query: 532 IAEFPFDSTVKRMSSV--YYNNHNET--YNIYGKGAFESIISCCSSWYGKDGVKITPLTD 587
           +   PF+S+ K    V  Y    N+   Y  + KGA E +   CS     D   +  + +
Sbjct: 610 VQTIPFESSRKWAGLVVKYKEGKNKKPFYRFFIKGAAEIVSKNCSYKRNSDDT-LEEINE 668

Query: 588 CDVETIRKNVYSLSNEGLRVLGFASKSFTK------DQVNDDQLKNITSNRA--TAESDL 639
            + +     + +L+++ LR +  A K F +      +Q+ D    NI +      ++  L
Sbjct: 669 DNKKETDDEIKNLASDALRAISVAHKDFCECDSWPPEQLRDKDSPNIAALDLLFNSQKGL 728

Query: 640 VFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPTNLYHYSQ 699
           +  GL+GI DP R     +V++  +AG+ V M+TGD + TAKAIA+   IL T++   S 
Sbjct: 729 ILDGLLGIQDPLRAGVRESVQQCQRAGVTVRMVTGDNILTAKAIARNCAILSTDI---SS 785

Query: 700 EIVDSMVMTGSQFDGLSE-EEVDDLPVLPLVIARCSPQTKVRMIEALHRRKKFCTMTGDG 758
           E   +M   G++F  L++ E +  LP L  V+AR SP+ K  ++E L        +TGDG
Sbjct: 786 EAYSAM--EGTEFRKLTKNERIRILPNLR-VLARSSPEDKRLLVETLKGMGDVVAVTGDG 842

Query: 759 VNDSPSLKMANVGIAMGINGSDVSKEASDIVLSDDNFASILNAVEEGRRMTDNIQKFV-L 817
            ND+P+LK+A+VG +MGI+G++V++EASDI+L  D+F++I+NA++ GR ++ +I+KF+  
Sbjct: 843 TNDAPALKLADVGFSMGISGTEVAREASDIILMTDDFSAIVNAIKWGRCVSVSIKKFIQF 902

Query: 818 QLLAENVAQALYLIIGLVFRDENGKSVFPLSPVEVLWIIVVTSCFPAMGLGLEKAAPDLM 877
           QL+    A  L  +  +   DE       L+ V++LWI ++     A+ L  +K  P++M
Sbjct: 903 QLIVNITAVILTFVSSVASSDETS----VLTAVQLLWINLIMDTLAALALATDKPDPNIM 958

Query: 878 DRPPH---DSEVGIFTWEVIIDTFAYGIIMT 905
           DR P     S + + TW++I+      +I+T
Sbjct: 959 DRKPRGRSTSLISVSTWKMILSQATLQLIVT 989

 Score = 82.8 bits (203), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 86/336 (25%), Positives = 134/336 (39%), Gaps = 79/336 (23%)

Query: 90  DWITGGVISFVIAVNVLIGLVQEYKATKTMNSL-KNLSSPNAHVIRNGKSETINSKDVVP 148
           DWI G  I   + V VL+    +Y+       L K   +    VIRN +   I+   V+ 
Sbjct: 153 DWIEGVAIMIAVFVVVLVSAANDYQKELQFAKLNKKKENRKIIVIRNDQEILISIHHVLV 212

Query: 149 GDICLVKVGDTIPADLRLIETKNFDTDESLLTGES-----LPV----------------- 186
           GD+  ++ GD +PAD  +I  K  + DES +TGES      PV                 
Sbjct: 213 GDVISLQTGDVVPADCVMISGK-CEADESSITGESNTIQKFPVDNSLRDFKKFNSIDSHN 271

Query: 187 -SKDANLVFGKEEETSVGDRLNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGDSG 245
            SK  ++    E+   + D   +  S S ++ G  +G++    +NS  G+   SL  +  
Sbjct: 272 HSKPLDIGDVNEDGNKIAD--CMLISGSRILSGLGRGVITSVGINSVYGQTMTSLNAEPE 329

Query: 246 LISRDPSKSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKL-----------AVLLFWI- 293
                                          TPL   LS+L           A++LF + 
Sbjct: 330 ------------------------------STPLQLHLSQLADNISVYGCVSAIILFLVL 359

Query: 294 --AVLFAIIVMASQKFDVDK--------RVAIYAICVALSMIPSSLVVVLTITMSVGAAV 343
               LF II    +  D+D          + I +I V +  +P  L + +T+ ++     
Sbjct: 360 FTRYLFYIIPEDGRFHDLDPAQKGSKFMNIFITSITVIVVAVPEGLPLAVTLALAFATTR 419

Query: 344 MVSRNVIVRKLDSLEALGAVNDICSDKTGTLTQGKM 379
           M     +VR L S E +G+   +CSDKTGTLT+  M
Sbjct: 420 MTKDGNLVRVLRSCETMGSATAVCSDKTGTLTENVM 455

>AFL011W [3182] [Homologous to ScYGL006W (PMC1) - SH]
           complement(415265..418993) [3729 bp, 1242 aa]
          Length = 1242

 Score =  167 bits (424), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 117/400 (29%), Positives = 203/400 (50%), Gaps = 43/400 (10%)

Query: 535 FPFDSTVKRMSSVYYNNHNETYNIYGKGAFESIISCCSSWYGK--DGVKITPLTDCDVET 592
            PF+S+ ++ + +     +  Y  + KGA E+I   C        D +K++P    ++  
Sbjct: 578 IPFESS-RKWAGLVVRLVDGNYRFFIKGASETIFKSCHYMRSSNDDVIKLSPQKHGEIFG 636

Query: 593 IRKNVYSLSNEGLRVLGFASKSFT--------------------KDQVNDDQLKNITSNR 632
           +  N   L+++ LR +  A K FT                     D +  D+     ++R
Sbjct: 637 LINN---LASDALRTISLAHKDFTDISSWPPAELRDASDPSTASPDLLLGDEYVPTATDR 693

Query: 633 ATA----ESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVG 688
            +      S L+  G++GI+DP R     +VK   Q+G+ V M+TGD + T +AIA+  G
Sbjct: 694 PSIITNNNSGLILDGVVGIHDPLRPGVKESVKNCQQSGVTVRMITGDNITTGRAIARACG 753

Query: 689 ILPTNLYHYSQEIVDSMVMTGSQFDGLSEEEVDDLPVLPLVIARCSPQTKVRMIEALHRR 748
           IL  + Y   +       M G  F  LS  ++ D      V+AR SP+ K   ++ L + 
Sbjct: 754 ILSESEYADHE-----CAMEGPVFRKLSRRQMMDAAPKLKVLARSSPEDKRIFVDILKKM 808

Query: 749 KKFCTMTGDGVNDSPSLKMANVGIAMGINGSDVSKEASDIVLSDDNFASILNAVEEGRRM 808
            +   +TGDG ND+P+L +A+VG +MGI+G+ V++EASDI+L  D+F SI+NA++ GR +
Sbjct: 809 NEVVAVTGDGTNDAPALTLADVGFSMGISGTGVAREASDIILMTDDFTSIVNAIKWGRCV 868

Query: 809 TDNIQKFV-LQLLAENVAQALYLIIGLVFRDENGKSVFPLSPVEVLWIIVVTSCFPAMGL 867
           + +I+KF+  QL     A  L  +  +   +EN      L+ V++LW+ ++     A+ L
Sbjct: 869 SLSIKKFIQFQLTVNITAVTLTCVTAVTSTEENPV----LTAVQLLWVNLIMDTLAALAL 924

Query: 868 GLEKAAPDLMDRPP--HDSE-VGIFTWEVIIDTFAYGIIM 904
             +K  P +++R P   DS  + + TW++I+      +I+
Sbjct: 925 ATDKPDPHILERIPTGRDSPLIAVSTWKMILGQAVLQLII 964

 Score = 64.3 bits (155), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 72/278 (25%), Positives = 115/278 (41%), Gaps = 52/278 (18%)

Query: 132 VIRNGKSETINSKDVVPGDICLVKVGDTIPADLRLIETKNFDTDESLLTGESLPVSKDA- 190
           V+RNG    I+  D++ GD+  ++ GD +P D  L+E K  + DES +TGES  + K + 
Sbjct: 187 VVRNGDKHVISVHDLLVGDLLSLQTGDVVPVDCILVEGK-CECDESGITGESDTIKKVSL 245

Query: 191 -------NLVFGKEEETSVGDRLN--------LAFSSSAVVKGRAKGIVIKTALNSEIGK 235
                    V        +G   N        +  S S ++ G    +V     +S  GK
Sbjct: 246 AMSLQVYRTVAADNPSADIGSSDNGHSLVPDPMLISGSKLLSGIGHAVVTAVGPHSVHGK 305

Query: 236 IAKSLQGDSGLISRDPSKSWLQ---NTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFW 292
           +  +L+ +       P  + LQ   NT      + G               S  A LLF 
Sbjct: 306 MMLALKSE-------PETTPLQERLNTLADDISIYG---------------SVAAFLLFV 343

Query: 293 IAVLFAIIVMASQKFDVDKRVA----------IYAICVALSMIPSSLVVVLTITMSVGAA 342
           +  L  +  +   +   D   A          I A+ V +  +P  L + +T+ ++    
Sbjct: 344 VLFLRFLSYLPKGRLYHDLPSARKGSRFMDIFITAVTVIVVAVPEGLPLAVTLALAFATT 403

Query: 343 VMVSRNVIVRKLDSLEALGAVNDICSDKTGTLTQGKML 380
            M     +VR L + E +G+   +CSDKTGTLTQ KM+
Sbjct: 404 RMTKDGNLVRVLRACETMGSATTVCSDKTGTLTQNKMV 441

>Scas_297.1
          Length = 800

 Score =  135 bits (341), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 82/237 (34%), Positives = 138/237 (58%), Gaps = 15/237 (6%)

Query: 674 GDFVGTAKAIAQEVGILPTNLYHYSQEIVDSMVMTGSQFDGLSEEE-VDDLPVLPLVIAR 732
           GD + TA+AIA+   IL    Y     ++    + G +F  L+++E +  LP L  V+AR
Sbjct: 1   GDNILTARAIARNCNILSEETY-----LIPECAIEGPKFRTLTKQERIKMLPNL-RVMAR 54

Query: 733 CSPQTKVRMIEALHRRKKFCTMTGDGVNDSPSLKMANVGIAMGINGSDVSKEASDIVLSD 792
            SP+ K  ++E L        +TGDG ND+P+LK+A+VG +MGI+G++V++EASDI+L  
Sbjct: 55  SSPEDKRLLVETLKGMGDVVAVTGDGTNDAPALKLADVGFSMGISGTEVAREASDIILMT 114

Query: 793 DNFASILNAVEEGRRMTDNIQKFV-LQLLAENVAQALYLIIGLVFRDENGKSVFPLSPVE 851
           D+FA+I++A++ GR ++ +I+KF+  QL+    A  L  +  +   DE       L+ V+
Sbjct: 115 DDFAAIVDAIKWGRCVSISIKKFIQFQLIVNITAVILAFVSSIASEDETSV----LTAVQ 170

Query: 852 VLWIIVVTSCFPAMGLGLEKAAPDLMDRPPHDSEVGIF---TWEVIIDTFAYGIIMT 905
           +LWI ++     A+ L  +K  P++MDR P      +    TW++I+      +I+T
Sbjct: 171 LLWINLIMDTLAALALATDKPDPNIMDRKPRGRSTPLIFPSTWKMILSQSCLQLIVT 227

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 51/172 (29%), Positives = 79/172 (45%), Gaps = 21/172 (12%)

Query: 90  DWITGGVISFVIAVNVLIGLVQEYKATKTMNSL-KNLSSPNAHVIRNGKSETINSKDVVP 148
           DWI G  I   + V V +G V +Y+       L K   +    VIRN +    +  +++ 
Sbjct: 559 DWIEGIAIMIAVIVVVFVGAVNDYQKELQFARLNKKKENRKIIVIRNSQELLTSIHNLLV 618

Query: 149 GDICLVKVGDTIPADLRLIETKNFDTDESLLTGESLPVSK----DANLVF-----GKEEE 199
           GDI  ++ GD IPAD  L+E +  + DES +TGES  + K    +A   F     GK  +
Sbjct: 619 GDIITLQTGDVIPADGVLVEGQ-CEVDESSITGESDTIKKVKVFNALKTFDVINEGKSND 677

Query: 200 --------TSVGDRLN--LAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQ 241
                   T  GD++   +  S S ++ G  K I+     NS  G+   +L+
Sbjct: 678 QILDIGFKTPNGDKIPDCMLISGSKLLSGLGKAIITSVGTNSIHGRTMMALK 729

>CAGL0A00495g complement(55014..57722) highly similar to sp|P05030
           Saccharomyces cerevisiae YGL008c PMA1 or sp|P19657
           Saccharomyces cerevisiae YPL036w PMA2, hypothetical
           start
          Length = 902

 Score =  132 bits (332), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 110/366 (30%), Positives = 170/366 (46%), Gaps = 47/366 (12%)

Query: 17  YHTLTAEEAAE-FIGTSLTEGLTQDEFVHRLKTVGENTLGDDTKIDYKAMVLHQVCNAXX 75
           +HT +A    E ++ T  + GLT DE  HR K  G N + D+ +      V+  V     
Sbjct: 51  HHTGSARVVPEEYLQTDPSYGLTSDEVAHRRKKYGLNQMADERESMIVKFVMFFV-GPIQ 109

Query: 76  XXXXXXXXXXFAMHDWITGGVISFVIAVNVLIGLVQEYKATKTMNSLKNLSSPNAHVIRN 135
                       + DW+  GVI  ++ +N  +G +QE++A   ++ LK   +  A VIR+
Sbjct: 110 FVMEAAAILAAGLSDWVDFGVICGLLMLNACVGFIQEFQAGSIVDELKKTLANVAVVIRD 169

Query: 136 GKSETINSKDVVPGDICLVKVGDTIPADLRLIETKNF-DTDESLLTGESLPVSKDANLVF 194
           G+   + + +VVPGDI  ++ G  IPAD RL+    F   D+S +TGESL V K      
Sbjct: 170 GQLVEVPANEVVPGDILQLEDGTIIPADGRLVTENCFLQVDQSAITGESLAVDK------ 223

Query: 195 GKEEETSVGDRLNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLISRDPSKS 254
                   GD+    FSSS V +G A  +V  T  N+ +G+ A  +   SG         
Sbjct: 224 ------GYGDQ---TFSSSTVKRGEAFMVVTATGDNTFVGRAAALVNKASG--------- 265

Query: 255 WLQNTWISTKKVTGAFLGT-NVGTPLHRKLSKLAVLLFWIAVLFAIIVMASQKFDVDKRV 313
                        G F    N    L   L  + +L  W A  +        + D   ++
Sbjct: 266 -----------GQGHFTEVLNGIGILLLVLVIVTLLGVWAACFY--------RTDNIVKI 306

Query: 314 AIYAICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSDKTGT 373
             + + + +  +P  L  V+T TM+VGAA +  +  IV+KL ++E+L  V  +CSDKTGT
Sbjct: 307 LRFTLGITIIGVPVGLPAVVTTTMAVGAAYLAKKQAIVQKLSAIESLAGVEILCSDKTGT 366

Query: 374 LTQGKM 379
           LT+ K+
Sbjct: 367 LTKNKL 372

 Score = 97.8 bits (242), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 89/318 (27%), Positives = 147/318 (46%), Gaps = 40/318 (12%)

Query: 514 QSSLSQHNEKPGSAQFEHIAEFPFDSTVKRMSSVYYNNHNETYNIYGKGAFESIISCCSS 573
           +S ++    K    +++ I   PFD   K++++V  +   E   +  KGA   ++     
Sbjct: 412 KSLINYPKAKDALTKYKVIEFHPFDPVSKKVTAVVESPEGERI-VCVKGAPLFVLKTVEE 470

Query: 574 WYGKDGVKITPLTDCDVETIRKNVYSLSNEGLRVLGFASKSFTKDQVNDDQLKNITSNRA 633
            +        P+ +   E     V  L++ G R LG A                    R 
Sbjct: 471 DH--------PIPEDVHENYENKVAELASRGFRALGVA--------------------RK 502

Query: 634 TAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPTN 693
             E     LG++   DPPR++TA  V +  + G+ V MLTGD VG AK   +++G L TN
Sbjct: 503 RGEGHWEILGVMPCMDPPRDDTAETVNEARRLGLRVKMLTGDAVGIAKETCRQLG-LGTN 561

Query: 694 LYHYSQEIVDSMV-MTGSQFDGLSEEEVDDLPVLPLVIARCSPQTKVRMIEALHRRKKFC 752
           +Y+  +  +     M GS+     E   D         A   PQ K +++E L  R    
Sbjct: 562 IYNAERLGLGGGGDMPGSELADFVEN-ADGF-------AEVFPQHKYKVVEILQNRGYLV 613

Query: 753 TMTGDGVNDSPSLKMANVGIAMGINGSDVSKEASDIVLSDDNFASILNAVEEGRRMTDNI 812
            MTGDGVND+PSLK A+ GIA+    SD ++ A+DIV      ++I++A++  R++   +
Sbjct: 614 AMTGDGVNDAPSLKKADTGIAVE-GASDAARSAADIVFLAPGLSAIIDALKTSRQIFHRM 672

Query: 813 QKFVLQLLAENVAQALYL 830
             +V+  +A ++   L+L
Sbjct: 673 YSYVVYRIALSLHLELFL 690

>YGL008C (PMA1) [1965] chr7 complement(479913..482669)
           H+-transporting P-type ATPase of the plasma membrane
           required for nutrient uptake and pH homeostasis,
           activity is rate limiting for growth at low pH [2757 bp,
           918 aa]
          Length = 918

 Score =  132 bits (331), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 106/354 (29%), Positives = 163/354 (46%), Gaps = 44/354 (12%)

Query: 27  EFIGTSLTEGLTQDEFVHRLKTVGENTLGDDTKIDYKAMVLHQVCNAXXXXXXXXXXXXF 86
           E++ T  + GLT DE + R K  G N + D+ +      V+  V                
Sbjct: 78  EYLQTDPSYGLTSDEVLKRRKKYGLNQMADEKESLVVKFVMFFV-GPIQFVMEAAAILAA 136

Query: 87  AMHDWITGGVISFVIAVNVLIGLVQEYKATKTMNSLKNLSSPNAHVIRNGKSETINSKDV 146
            + DW+  GVI  ++ +N  +G VQE++A   ++ LK   +  A VIR+G+   I + +V
Sbjct: 137 GLSDWVDFGVICGLLMLNAGVGFVQEFQAGSIVDELKKTLANTAVVIRDGQLVEIPANEV 196

Query: 147 VPGDICLVKVGDTIPADLRLIETKNF-DTDESLLTGESLPVSKDANLVFGKEEETSVGDR 205
           VPGDI  ++ G  IP D R++    F   D+S +TGESL V K              GD+
Sbjct: 197 VPGDILQLEDGTVIPTDGRIVTEDCFLQIDQSAITGESLAVDK------------HYGDQ 244

Query: 206 LNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLISRDPSKSWLQNTWISTKK 265
               FSSS V +G    +V  T  N+ +G+ A  +   +G           Q  +     
Sbjct: 245 ---TFSSSTVKRGEGFMVVTATGDNTFVGRAAALVNKAAG----------GQGHFTEVLN 291

Query: 266 VTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAIIVMASQKFDVDKRVAIYAICVALSMI 325
             G  L   V   L         LL W A  +        + +   R+  Y + + +  +
Sbjct: 292 GIGIILLVLVIATL---------LLVWTACFY--------RTNGIVRILRYTLGITIIGV 334

Query: 326 PSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSDKTGTLTQGKM 379
           P  L  V+T TM+VGAA +  +  IV+KL ++E+L  V  +CSDKTGTLT+ K+
Sbjct: 335 PVGLPAVVTTTMAVGAAYLAKKQAIVQKLSAIESLAGVEILCSDKTGTLTKNKL 388

 Score =  112 bits (279), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 91/327 (27%), Positives = 150/327 (45%), Gaps = 41/327 (12%)

Query: 516 SLSQHNEKPGSAQFEHIAEF-PFDSTVKRMSSVYYNNHNETYNIYGKGAFESIISCCSSW 574
           SL Q+ +   +     + EF PFD   K++++V  +   E   +  KGA   ++      
Sbjct: 429 SLKQYPKAKDALTKYKVLEFHPFDPVSKKVTAVVESPEGERI-VCVKGAPLFVLKTVEED 487

Query: 575 YGKDGVKITPLTDCDVETIRKNVYSLSNEGLRVLGFASKSFTKDQVNDDQLKNITSNRAT 634
           +        P+ +   E     V  L++ G R LG A                    R  
Sbjct: 488 H--------PIPEDVHENYENKVAELASRGFRALGVA--------------------RKR 519

Query: 635 AESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPTNL 694
            E     LG++   DPPR++TA  V +    G+ V MLTGD VG AK   +++G L TN+
Sbjct: 520 GEGHWEILGVMPCMDPPRDDTAQTVSEARHLGLRVKMLTGDAVGIAKETCRQLG-LGTNI 578

Query: 695 YHYSQEIVDSMV-MTGSQFDGLSEEEVDDLPVLPLVIARCSPQTKVRMIEALHRRKKFCT 753
           Y+  +  +     M GS+     E   D         A   PQ K R++E L  R     
Sbjct: 579 YNAERLGLGGGGDMPGSELADFVEN-ADGF-------AEVFPQHKYRVVEILQNRGYLVA 630

Query: 754 MTGDGVNDSPSLKMANVGIAMGINGSDVSKEASDIVLSDDNFASILNAVEEGRRMTDNIQ 813
           MTGDGVND+PSLK A+ GIA+    +D ++ A+DIV      ++I++A++  R++   + 
Sbjct: 631 MTGDGVNDAPSLKKADTGIAVE-GATDAARSAADIVFLAPGLSAIIDALKTSRQIFHRMY 689

Query: 814 KFVLQLLAENVAQALYLIIGLVFRDEN 840
            +V+  +A ++   ++L + +   D +
Sbjct: 690 SYVVYRIALSLHLEIFLGLWIAILDNS 716

>KLLA0A09031g 787768..790467 gi|1346734|sp|P49380|PMA1_KLULA
           Kluyveromyces lactis Plasma membrane ATPase (Proton
           pump), start by similarity
          Length = 899

 Score =  127 bits (318), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 107/355 (30%), Positives = 164/355 (46%), Gaps = 46/355 (12%)

Query: 27  EFIGTSLTEGLTQDEFVHRLKTVGENTLGDDTKIDYKAMVLHQVCNAXXXXXXXXXXXXF 86
           E + T  + GLT DE   R K  G N + ++T+  +   ++  +                
Sbjct: 59  ELLQTDPSYGLTSDEVTKRRKKYGLNQMSEETENLFVKFLMFFI-GPIQFVMEAAAILAA 117

Query: 87  AMHDWITGGVISFVIAVNVLIGLVQEYKATKTMNSLKNLSSPNAHVIRNGKSETINSKDV 146
            + DW+  GVI  ++ +N  +G +QEY+A   ++ LK   + +A VIR+G    + S +V
Sbjct: 118 GLEDWVDFGVICGLLFLNAAVGFIQEYQAGSIVDELKKTLANSAVVIRDGNLVEVPSNEV 177

Query: 147 VPGDICLVKVGDTIPADLRLIETKNF-DTDESLLTGESLPVSKDANLVFGKEEETSVGDR 205
           VPGDI  ++ G  IPAD RL+    F   D+S +TGESL V K     FG          
Sbjct: 178 VPGDILQLEDGVVIPADGRLVTEDCFIQIDQSAITGESLAVDKR----FGDS-------- 225

Query: 206 LNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLISRDPSKSWLQNTWISTKK 265
               FSSS V +G A  IV  T              GDS  + R  +             
Sbjct: 226 ---TFSSSTVKRGEAFMIVTAT--------------GDSTFVGRAAALV------NKAAA 262

Query: 266 VTGAFLGTNVGT-PLHRKLSKLAVLLFWIAVLFAIIVMASQKFDVDKRVAIYAICVALSM 324
            +G F     G   +   L  + +LL W+A  +        + +   R+  Y + + +  
Sbjct: 263 GSGHFTEVLNGIGTILLILVIVTLLLVWVASFY--------RTNKIVRILRYTLAITIVG 314

Query: 325 IPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSDKTGTLTQGKM 379
           +P  L  V+T TM+VGAA +  +  IV+KL ++E+L  V  +CSDKTGTLT+ K+
Sbjct: 315 VPVGLPAVVTTTMAVGAAYLAKKQAIVQKLSAIESLAGVEILCSDKTGTLTKNKL 369

 Score =  110 bits (275), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 87/318 (27%), Positives = 146/318 (45%), Gaps = 40/318 (12%)

Query: 514 QSSLSQHNEKPGSAQFEHIAEFPFDSTVKRMSSVYYNNHNETYNIYGKGAFESIISCCSS 573
           +S +S    K    +++ +   PFD   K+++++  +   E   I  KGA   ++     
Sbjct: 409 KSLISYPRAKAALTKYKLLEFHPFDPVSKKVTAIVESPEGERI-ICVKGAPLFVLKTVEE 467

Query: 574 WYGKDGVKITPLTDCDVETIRKNVYSLSNEGLRVLGFASKSFTKDQVNDDQLKNITSNRA 633
            +        P+ +   E     V  L++ G R LG A                    R 
Sbjct: 468 EH--------PIPEDVRENYENKVAELASRGFRALGVA--------------------RK 499

Query: 634 TAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPTN 693
             E     LG++   DPPR++TA  V +    G+ V MLTGD VG AK   +++G L TN
Sbjct: 500 RGEGHWEILGVMPCMDPPRDDTAQTVNEARHLGLRVKMLTGDAVGIAKETCRQLG-LGTN 558

Query: 694 LYHYSQEIVDSMV-MTGSQFDGLSEEEVDDLPVLPLVIARCSPQTKVRMIEALHRRKKFC 752
           +Y+  +  +     M GS+     E   D         A   PQ K  ++E L +R    
Sbjct: 559 IYNAERLGLGGGGDMPGSELADFVEN-ADGF-------AEVFPQHKYNVVEILQQRGYLV 610

Query: 753 TMTGDGVNDSPSLKMANVGIAMGINGSDVSKEASDIVLSDDNFASILNAVEEGRRMTDNI 812
            MTGDGVND+PSLK A+ GIA+    +D ++ A+DIV      ++I++A++  R++   +
Sbjct: 611 AMTGDGVNDAPSLKKADTGIAVE-GATDAARSAADIVFLAPGLSAIIDALKTSRQIFHRM 669

Query: 813 QKFVLQLLAENVAQALYL 830
             +V+  +A ++   ++L
Sbjct: 670 YSYVVYRIALSLHLEIFL 687

>YPL036W (PMA2) [5403] chr16 (482839..485682) H[+]-transporting
           P-type ATPase of the plasma membrane, expression not
           detected under normal growth conditions [2844 bp, 947
           aa]
          Length = 947

 Score =  126 bits (317), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 101/346 (29%), Positives = 156/346 (45%), Gaps = 46/346 (13%)

Query: 36  GLTQDEFVHRLKTVGENTLGDDTKIDYKAMVLHQVCNAXXXXXXXXXXXXFAMHDWITGG 95
           GLT DE   R K  G N + ++ +       L                    + DW+  G
Sbjct: 116 GLTSDEVARRRKKYGLNQMAEENE-SLIVKFLMFFVGPIQFVMEAAAILAAGLSDWVDVG 174

Query: 96  VISFVIAVNVLIGLVQEYKATKTMNSLKNLSSPNAHVIRNGKSETINSKDVVPGDICLVK 155
           VI  ++ +N  +G +QE++A   ++ LK   +  A VIR+G+   I + +VVPG+I  ++
Sbjct: 175 VICALLLLNASVGFIQEFQAGSIVDELKKTLANTATVIRDGQLIEIPANEVVPGEILQLE 234

Query: 156 VGDTIPADLRLIETKNF-DTDESLLTGESLPVSKDANLVFGKEEETSVGDRLNLAFSSSA 214
            G   PAD R++    F   D+S +TGESL   K     +G E            FSSS 
Sbjct: 235 SGTIAPADGRIVTEDCFLQIDQSAITGESLAAEKH----YGDE-----------VFSSST 279

Query: 215 VVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLISRDPSKSWLQNTWISTKKVTGAFLGTN 274
           V  G A  +V  T  N+ +G+ A  +   SG                    V G F    
Sbjct: 280 VKTGEAFMVVTATGDNTFVGRAAALVGQASG--------------------VEGHFTEVL 319

Query: 275 VGTPLHRKLSKLAVLLF-WIAVLFAIIVMASQKFDVDKRVAIYAICVALSMIPSSLVVVL 333
            G  +   +  +A LL  W A  +  + + S        +  Y + + +  +P  L  V+
Sbjct: 320 NGIGIILLVLVIATLLLVWTACFYRTVGIVS--------ILRYTLGITIIGVPVGLPAVV 371

Query: 334 TITMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSDKTGTLTQGKM 379
           T TM+VGAA +  +  IV+KL ++E+L  V  +CSDKTGTLT+ K+
Sbjct: 372 TTTMAVGAAYLAKKQAIVQKLSAIESLAGVEILCSDKTGTLTKNKL 417

 Score =  108 bits (269), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 85/301 (28%), Positives = 140/301 (46%), Gaps = 41/301 (13%)

Query: 532 IAEF-PFDSTVKRMSSVYYNNHNETYNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDV 590
           + EF PFD   K++++V  +   E   +  KGA   ++      +        P+ +   
Sbjct: 474 VLEFHPFDPVSKKVTAVVESPEGERI-VCVKGAPLFVLKTVEEDH--------PIPEDVH 524

Query: 591 ETIRKNVYSLSNEGLRVLGFASKSFTKDQVNDDQLKNITSNRATAESDLVFLGLIGIYDP 650
           E     V  L++ G R LG A                    R   E     LG++   DP
Sbjct: 525 ENYENKVAELASRGFRALGVA--------------------RKRGEGHWEILGVMPCMDP 564

Query: 651 PRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPTNLYHYSQEIVDSMV-MTG 709
           PR++TA  + +    G+ + MLTGD VG AK   +++G L TN+Y+  +  +     M G
Sbjct: 565 PRDDTAQTINEARNLGLRIKMLTGDAVGIAKETCRQLG-LGTNIYNAERLGLGGGGDMPG 623

Query: 710 SQFDGLSEEEVDDLPVLPLVIARCSPQTKVRMIEALHRRKKFCTMTGDGVNDSPSLKMAN 769
           S+     E   D         A   PQ K R++E L  R     MTGDGVND+PSLK A+
Sbjct: 624 SELADFVEN-ADGF-------AEVFPQHKYRVVEILQNRGYLVAMTGDGVNDAPSLKKAD 675

Query: 770 VGIAMGINGSDVSKEASDIVLSDDNFASILNAVEEGRRMTDNIQKFVLQLLAENVAQALY 829
            GIA+    +D ++ A+DIV      ++I++A++  R++   +  +V+  +A ++   ++
Sbjct: 676 TGIAVE-GATDAARSAADIVFLAPGLSAIIDALKTSRQIFHRMYSYVVYRIALSLHLEIF 734

Query: 830 L 830
           L
Sbjct: 735 L 735

>Scas_710.41
          Length = 904

 Score =  123 bits (309), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 105/349 (30%), Positives = 164/349 (46%), Gaps = 52/349 (14%)

Query: 36  GLTQDEFVHRLKTVGENTLGDDTKIDYKAMVLHQVCNAXXXXXXXXXXXXFAMHDWITGG 95
           GLT DE V R K  G N + ++ + ++    L                    + DW+  G
Sbjct: 74  GLTTDEVVRRRKKYGLNQMKEENE-NFIVKFLMYFVGPIQFVMEAAAILAAGLSDWVDFG 132

Query: 96  VISFVIAVNVLIGLVQEYKATKTMNSLKNLSSPNAHVIRNGKSETINSKDVVPGDICLVK 155
           VI  ++ +N  +G +QE++A   +  LK   +  A VIR+G  + I + ++VPGDI  + 
Sbjct: 133 VICGLLMLNASVGFIQEFQAGSIVEELKKTLANTARVIRDGTLQEIPANEIVPGDILELD 192

Query: 156 VGDTIPADLRLI-ETKNFDTDESLLTGESLPVSKDANLVFGKEEETSVGDRLNLAFSSSA 214
            G  IPAD RL+ E +    D+S +TGESL V K+    +G           ++ FSSS 
Sbjct: 193 EGTIIPADGRLVTENRFLQVDQSAITGESLAVDKN----YG-----------DVTFSSST 237

Query: 215 VVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLISRDPSKSWLQNTWISTKKVTGAF--LG 272
           V  G +  +V  T  N+ +G+ A  +   SG                      G F  + 
Sbjct: 238 VKTGTSVMVVTATGDNTFVGRAAALVGEASG--------------------GQGHFTDIL 277

Query: 273 TNVGTPLHRKLSKLAVLLFWIAVLFAIIVMASQKFDVDKRVAIYAICVALSMI--PSSLV 330
            ++GT +   L  + +LL W A            +  D  V I    + +++I  P  L 
Sbjct: 278 NDIGT-ILLVLVIITLLLVWTACF----------YRTDGIVMILRFTLGITIIGVPVGLP 326

Query: 331 VVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSDKTGTLTQGKM 379
            V+T TM+VGAA +  +  IV+KL ++E+L  V  +CSDKTGTLT+ K+
Sbjct: 327 AVVTTTMAVGAAYLAKKQAIVQKLSAIESLAGVEILCSDKTGTLTKNKL 375

 Score =  105 bits (263), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 87/308 (28%), Positives = 141/308 (45%), Gaps = 41/308 (13%)

Query: 516 SLSQHNEKPGSAQFEHIAEF-PFDSTVKRMSSVYYNNHNETYNIYGKGAFESIISCCSSW 574
           SL+Q+ +   +     I EF PFD   K++++V  +   ET     KGA   ++      
Sbjct: 416 SLNQYPKAMNALPKYKILEFHPFDPVSKKVTAVVKSPEGETITCV-KGAPLFVLKTVEED 474

Query: 575 YGKDGVKITPLTDCDVETIRKNVYSLSNEGLRVLGFASKSFTKDQVNDDQLKNITSNRAT 634
           +        P+ +   E     V  L++ G R LG A                    R  
Sbjct: 475 H--------PVPEDVHENYENKVAELASRGFRSLGVA--------------------RKR 506

Query: 635 AESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPTNL 694
            E     LG++   DPPR++TA  + +    G+ V MLTGD VG AK  ++++G L  N+
Sbjct: 507 GEGYWEILGVMPCMDPPRDDTARTIAEARTLGLRVKMLTGDAVGIAKETSRQLG-LGVNI 565

Query: 695 YHYSQEIVDSMV-MTGSQFDGLSEEEVDDLPVLPLVIARCSPQTKVRMIEALHRRKKFCT 753
           Y+  +  +     M GS+     E   D         A   PQ K +++E L  R     
Sbjct: 566 YNAEKLGLGGGGDMPGSELADFVEN-ADGF-------AEVFPQHKYKVVEILQNRGYLVA 617

Query: 754 MTGDGVNDSPSLKMANVGIAMGINGSDVSKEASDIVLSDDNFASILNAVEEGRRMTDNIQ 813
           MTGDGVND+PSLK A+ GIA+    +D ++ A+DIV      ++I++ ++  R++   + 
Sbjct: 618 MTGDGVNDAPSLKKADTGIAVE-GATDAARSAADIVFLAPGLSAIIDGLKTSRQIFHRMY 676

Query: 814 KFVLQLLA 821
            +V+  +A
Sbjct: 677 SYVVYRIA 684

>CAGL0M11308g 1110211..1114569 similar to sp|Q12697 Saccharomyces
            cerevisiae YOR291w, hypothetical start
          Length = 1452

 Score =  122 bits (306), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 184/779 (23%), Positives = 331/779 (42%), Gaps = 131/779 (16%)

Query: 91   WITGGVISFVIAVNVLIGLVQEYKATKTMNSLKNLSSPNAHVIRNGKSETINSKDVVPGD 150
            +   G I  +  +++L  L++  K ++T+  + + +     V+R G   +I+S ++VPGD
Sbjct: 503  YYYAGCIFLISLLSILDTLIETKKISRTLAEMSHFNC-EVRVLREGFWSSIHSSELVPGD 561

Query: 151  ICLVKVGDT----IPADLRLIETKNFDTDESLLTGESLPVSKDANLVFGKEEETSVGDRL 206
            I   ++ D     +P D  L+ + +   +ES+LTGES+PVSK     +   EET +  +L
Sbjct: 562  I--YEISDPNLNLLPCDSILL-SGDCIVNESMLTGESVPVSK-----YPASEETIL--QL 611

Query: 207  NLAFSSSAVVKGRAKGIVIK--TALNSEI---GKIAKSLQGDSGLISRDPSKSWLQNTWI 261
               F S+ +    +K  +    T + ++I   G +A ++   +G  +   +K  L  + +
Sbjct: 612  FDDFQSTQISTFLSKSFLFNGTTLIRAKIPNGGSVALAMAVRTGFST---TKGSLIRSMV 668

Query: 262  STKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAIIVMASQKFDVDKRVAIY-AICV 320
              K     F   +      + +  +A++ F+    F+I  +   K  +DKR  I  A+ +
Sbjct: 669  FPKPSGFKFYSDSF-----KYIGFMAIIAFF---GFSISCINFIKLGLDKRTMILRALDI 720

Query: 321  ALSMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSDKTGTLTQGKML 380
               ++P +L   LTI  S     +  + +       +   G ++ +C DKTGTLT+  + 
Sbjct: 721  ITIVVPPALPATLTIGTSFALNRLKEKGIFCIAPTRVNIGGKIDVMCFDKTGTLTEDGLD 780

Query: 381  ARQIWIPRFGTITISNSDDPFNPNEGNVSLIPRFSPYEYSHNEDGD-----VGILQNFKD 435
               + +    T   ++  D  +       + P+FS  + S+ +D       + +L     
Sbjct: 781  VLGVRVSCAATRNKASFSDLISDTH---DIFPKFSLKDCSNPDDYKRRNFLISLLTCHSL 837

Query: 436  RLYEKDL---PEDIDMDLFQKWLETATLAN--IATVFKDDATDCWKAHGDPTEIAIQVFA 490
            R+ + +L   P D  M  F  W       N    +++++      +  G       Q F 
Sbjct: 838  RVVDGELLGDPLDFKMFQFTGWSYEEDFQNHQFHSLYEE------RHEG-------QNFP 884

Query: 491  TKMDLPHNALTGEKSTNQSNENDQSSLSQHNEKPGSAQFEHIAEFPFDSTVKRMSSVYYN 550
               D+    +      N S+E ++   +  N   G      I  F F S ++RMS +   
Sbjct: 885  ENNDI----IPAIVHPNDSDERNKFVQNDPNNILGI-----IRSFEFLSELRRMSVIVKP 935

Query: 551  NHNETYNIYGKGAFESIISCCSSWYGKDGVKITPLT-DCDVETIRKNVYSLSNEGLRVLG 609
            N+   Y  Y KGA E II  C+           P T   D + I  N Y+ S  G RV+ 
Sbjct: 936  NNENVYWAYTKGAPEVIIDICN-----------PATLPSDYDDIL-NFYTHS--GYRVIA 981

Query: 610  FASKSFTKDQVNDDQLKNITSNRATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINV 669
             A K+  K+      L +    R   ES++ FLG I   +  ++ T+  + K   A I  
Sbjct: 982  CAGKTLPKNT----WLYSQKVRREEVESNMEFLGFIIFQNKLKDATSPTLSKLKTANIRT 1037

Query: 670  HMLTGDFVGTAKAIAQEVGIL-------PTNLY---------HY-----SQEIVDS---- 704
             M TGD V TA ++ +E  ++       PT  Y         H+     ++ I+D+    
Sbjct: 1038 VMCTGDNVLTAISVGKECQLITEDRVYVPTVAYSDMTVQPVIHWNEISNAEHILDTFTLQ 1097

Query: 705  ----------MVMTGSQF-------DGLSEEEVDDLPVLPLVIARCSPQTKVRMIEALHR 747
                      + +TG  F       D  SEE V+++ +   + AR SP  K  ++E L +
Sbjct: 1098 PIDDYSGPYTLAITGEVFRIIFSNQDNYSEEYVNEILLKGSIFARMSPDEKHELVEQLQK 1157

Query: 748  RKKFCTMTGDGVNDSPSLKMANVGIAMGINGSDVSKEASDIVLSDDNFASILNAVEEGR 806
                    GDG ND  +LK A+VGI++    + V+   +  +    +   +L+ ++EGR
Sbjct: 1158 MDYTVGFCGDGANDCGALKAADVGISLSEAEASVAAPFTSKIF---DITCVLDVIKEGR 1213

>Kwal_47.17522
          Length = 899

 Score =  121 bits (303), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 108/357 (30%), Positives = 166/357 (46%), Gaps = 50/357 (14%)

Query: 27  EFIGTSLTEGLTQDEFVHRLKTVGENTLGDDTKIDYKAMVLHQVCNAXXXXXXXXXXXXF 86
           E + T  + GLT DE   R K  G N + ++++       L                   
Sbjct: 59  ELLQTDPSYGLTSDEVTKRRKKYGLNQMAEESE-SLVVKFLMFFIGPIQFVMEAAAILAA 117

Query: 87  AMHDWITGGVISFVIAVNVLIGLVQEYKATKTMNSLKNLSSPNAHVIRNGKSETINSKDV 146
            + DW+  GVI  ++ +N  +G +QEY+A   ++ LK   + +A V+R+G    I + +V
Sbjct: 118 GLEDWVDFGVILGLLFLNAGVGFIQEYQAGSIVDELKKSLANSAVVVRDGNLVEIPANEV 177

Query: 147 VPGDICLVKVGDTIPADLRLIETKNF-DTDESLLTGESLPVSKDANLVFGKEEETSVGDR 205
           VPGDI  ++ G  I AD RL+  + F   D+S +TGESL V K              GD 
Sbjct: 178 VPGDIMQLEDGVVICADGRLVTEECFLQIDQSAITGESLAVDK------------HYGDT 225

Query: 206 LNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQ---GDSGLISRDPSKSWLQNTWIS 262
               FSSS V +G    IV  T  N+ +G+ A  +    GD G                 
Sbjct: 226 ---TFSSSTVKRGEGFMIVTATGDNTFVGRAAALVNQAAGDQGHF--------------- 267

Query: 263 TKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAIIVMASQKFDVDKRVAIYAICVAL 322
           T+ + G      +GT +   L  + +LL W A  +        + D   R+  Y + + +
Sbjct: 268 TEVLNG------IGT-ILLVLVIVTLLLVWTACFY--------RTDRIVRILRYTLGITI 312

Query: 323 SMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSDKTGTLTQGKM 379
             +P  L  V+T TM+VGAA +  +  IV+KL ++E+L  V  +CSDKTGTLT+ K+
Sbjct: 313 IGVPVGLPAVVTTTMAVGAAYLAKKQAIVQKLSAIESLAGVEILCSDKTGTLTKNKL 369

 Score =  108 bits (269), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 85/296 (28%), Positives = 138/296 (46%), Gaps = 40/296 (13%)

Query: 536 PFDSTVKRMSSVYYNNHNETYNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDVETIRK 595
           PFD   K++++V  +   E   I  KGA   ++      +        P+ +   E    
Sbjct: 431 PFDPVSKKVTAVVESPEGERI-ICVKGAPLFVLKTVEEDH--------PIPEDVHENYEN 481

Query: 596 NVYSLSNEGLRVLGFASKSFTKDQVNDDQLKNITSNRATAESDLVFLGLIGIYDPPRNET 655
            V  L++ G R LG A                    R   E     LG++   DPPR++T
Sbjct: 482 KVAELASRGFRALGVA--------------------RKRGEGHWEILGVMPCMDPPRDDT 521

Query: 656 AGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPTNLYHYSQEIVDSMV-MTGSQFDG 714
           A  V +  + G+ V MLTGD VG AK   +++G L TN+Y+  +  +     M GS+   
Sbjct: 522 AQTVHEARRLGLRVKMLTGDAVGIAKETCRQLG-LGTNIYNAERLGLGGGGDMPGSELAD 580

Query: 715 LSEEEVDDLPVLPLVIARCSPQTKVRMIEALHRRKKFCTMTGDGVNDSPSLKMANVGIAM 774
              E  D         A   PQ K  ++E L +R     MTGDGVND+PSLK A+ GIA+
Sbjct: 581 FV-ENADGF-------AEVFPQHKYSVVEILQQRGYLVAMTGDGVNDAPSLKKADTGIAV 632

Query: 775 GINGSDVSKEASDIVLSDDNFASILNAVEEGRRMTDNIQKFVLQLLAENVAQALYL 830
               +D ++ A+DIV      ++I++A++  R++   +  +V+  +A ++   ++L
Sbjct: 633 E-GATDAARSAADIVFLAPGLSAIIDALKTSRQIFHRMYSYVVYRIALSLHLEIFL 687

>Scas_688.1
          Length = 913

 Score =  120 bits (300), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 101/346 (29%), Positives = 159/346 (45%), Gaps = 46/346 (13%)

Query: 36  GLTQDEFVHRLKTVGENTLGDDTKIDYKAMVLHQVCNAXXXXXXXXXXXXFAMHDWITGG 95
           GL+ DE   R K  G N + ++ +      ++  V                 + DW+  G
Sbjct: 82  GLSSDEVARRRKKYGLNQMSEENESLVVKFIMFFV-GPIQFVMEAAAILAAGLSDWVDFG 140

Query: 96  VISFVIAVNVLIGLVQEYKATKTMNSLKNLSSPNAHVIRNGKSETINSKDVVPGDICLVK 155
           VI  ++ +N  +G VQE++A   +  LK   + +A VIR+G+   + + +VVPGDI  ++
Sbjct: 141 VICGLLLLNAGVGFVQEFQAGSIVEELKKTLANSAIVIRDGQLVEVPANEVVPGDILQLE 200

Query: 156 VGDTIPADLRLIETKNF-DTDESLLTGESLPVSKDANLVFGKEEETSVGDRLNLAFSSSA 214
            G  IPAD R++    F   D+S +TGESL   K              GD+    FSSS 
Sbjct: 201 DGVIIPADGRIVTEDCFVQIDQSAITGESLAADK------------HYGDQ---TFSSST 245

Query: 215 VVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLISRDPSKSWLQNTWISTKKVTGAFLGT- 273
           V +G A  ++  T  N+ +G+ A  +   SG                      G F    
Sbjct: 246 VKRGEAFMVITATGDNTFVGRAAALVNKASG--------------------GQGHFTEVL 285

Query: 274 NVGTPLHRKLSKLAVLLFWIAVLFAIIVMASQKFDVDKRVAIYAICVALSMIPSSLVVVL 333
           N    +   L  + +LL W A  +        + D   R+  Y + + +  +P  L  V+
Sbjct: 286 NGIGIILLVLVIVTLLLVWTASFY--------RTDGIVRILRYTLGITIVGVPVGLPAVV 337

Query: 334 TITMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSDKTGTLTQGKM 379
           T TM+VGAA +  +  IV+KL ++E+L  V  +CSDKTGTLT+ K+
Sbjct: 338 TTTMAVGAAYLAKKQAIVQKLSAIESLAGVEILCSDKTGTLTKNKL 383

 Score =  109 bits (272), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 90/317 (28%), Positives = 146/317 (46%), Gaps = 41/317 (12%)

Query: 516 SLSQHNEKPGSAQFEHIAEF-PFDSTVKRMSSVYYNNHNETYNIYGKGAFESIISCCSSW 574
           SL+Q+     +     + EF PFD   K++++V  +   E   I  KGA   ++      
Sbjct: 424 SLAQYPAAKNALTKYKVLEFHPFDPVSKKVTAVVESPEGERI-ICVKGAPLFVLKTVEED 482

Query: 575 YGKDGVKITPLTDCDVETIRKNVYSLSNEGLRVLGFASKSFTKDQVNDDQLKNITSNRAT 634
           +        P+ +   E     V  L++ G R LG A                    R  
Sbjct: 483 H--------PIPEDIHENYENKVAELASRGFRALGVA--------------------RKR 514

Query: 635 AESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPTNL 694
            E     LG++   DPPR++T   V +  + G+ V MLTGD VG AK   +++G L TN+
Sbjct: 515 GEGHWEILGVMPCMDPPRDDTGETVAEARRLGLRVKMLTGDAVGIAKETCRQLG-LGTNV 573

Query: 695 YHYSQ-EIVDSMVMTGSQFDGLSEEEVDDLPVLPLVIARCSPQTKVRMIEALHRRKKFCT 753
           Y+  +  +     M GS+     E   D         A   PQ K R++E L  R     
Sbjct: 574 YNAERLGLSGGGDMPGSELADFVEN-ADGF-------AEVFPQDKYRVVEILQTRGYLVA 625

Query: 754 MTGDGVNDSPSLKMANVGIAMGINGSDVSKEASDIVLSDDNFASILNAVEEGRRMTDNIQ 813
           MTGDGVND+PSLK A+ GIA+    +D ++ A+DIV      ++I++A++  R++   + 
Sbjct: 626 MTGDGVNDAPSLKKADTGIAVE-GATDAARSAADIVFLAPGLSAIIDALKTSRQIFHRMY 684

Query: 814 KFVLQLLAENVAQALYL 830
            +V+  +A ++   ++L
Sbjct: 685 SYVVYRIALSIHLEIFL 701

>AGL085C [4226] [Homologous to ScYGL008C (PMA1) - SH; ScYPL036W
           (PMA2) - NSH] (546285..549014) [2730 bp, 909 aa]
          Length = 909

 Score =  117 bits (293), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 104/357 (29%), Positives = 167/357 (46%), Gaps = 50/357 (14%)

Query: 27  EFIGTSLTEGLTQDEFVHRLKTVGENTLGDDTKIDYKAMVLHQV---CNAXXXXXXXXXX 83
           E + T  + GLT DE   R K  G N + +  +    +M+L  V                
Sbjct: 59  ELLQTDPSYGLTSDEVSRRRKKYGLNQMSEANE----SMILKFVMFFVGPIQFVMEAAAI 114

Query: 84  XXFAMHDWITGGVISFVIAVNVLIGLVQEYKATKTMNSLKNLSSPNAHVIRNGKSETINS 143
               + +WI  G+I  ++ +N  +G +QE++A   +  LK   + +A VIR+G    I +
Sbjct: 115 LAAGLEEWIDFGIICALLLLNAAVGFIQEFQAGSIVEELKKTLANSAVVIRDGSLVEIPA 174

Query: 144 KDVVPGDICLVKVGDTIPADLRLIETKNF-DTDESLLTGESLPVSKDANLVFGKEEETSV 202
            +VVPGDI  ++ G  IPAD R++    F   D+S +TGESL V K              
Sbjct: 175 NEVVPGDILQLEDGVIIPADGRIVTEGCFVQIDQSAITGESLAVDK------------RY 222

Query: 203 GDRLNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLISRDPSKSWLQNTWIS 262
           GD     FSSS V +G    IV  T  ++ +G+ A        L+++  + S        
Sbjct: 223 GDA---TFSSSTVKRGEGFMIVTATGDSTFVGRAA-------ALVNKASAGSGH-----F 267

Query: 263 TKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAIIVMASQKFDVDKRVAIYAICVAL 322
           T+ + G  +GT +   +   L  + V  F+ ++    I+              Y + + +
Sbjct: 268 TEVLNG--IGTILLILVILTLLVVYVACFYRSIDIVTILR-------------YTLAITV 312

Query: 323 SMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSDKTGTLTQGKM 379
             +P  L  V+T TM+VGAA +  +  IV+KL ++E+L  V  +CSDKTGTLT+ K+
Sbjct: 313 VGVPVGLPAVVTTTMAVGAAYLAKKKAIVQKLSAIESLAGVEILCSDKTGTLTKNKL 369

 Score =  105 bits (261), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 88/319 (27%), Positives = 147/319 (46%), Gaps = 42/319 (13%)

Query: 514 QSSLSQHNEKPGSAQFEHIAEFPFDSTVKRMSSVYYNNHNETYNIYGKGAFESIISCCSS 573
           +S ++    K    +++ +   PFD   K+++++  +   E   +  KGA   ++     
Sbjct: 409 KSLINYPRAKAALTKYKVLEFHPFDPVSKKVTAIVESPEGERI-VCVKGAPLFVLKT--- 464

Query: 574 WYGKDGVKITPLTDCDV-ETIRKNVYSLSNEGLRVLGFASKSFTKDQVNDDQLKNITSNR 632
                 V+   L   DV E     V  L++ G R LG A                    R
Sbjct: 465 ------VEENHLIPEDVKENYENKVAELASRGYRALGVA--------------------R 498

Query: 633 ATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPT 692
              E     LG++   DPPR++TA  V +    G+ V MLTGD VG AK   +++G L T
Sbjct: 499 KRGEGHWEILGVMPCMDPPRDDTAQTVNEARHLGLRVKMLTGDAVGIAKETCRQLG-LGT 557

Query: 693 NLYHYSQEIVDSMV-MTGSQFDGLSEEEVDDLPVLPLVIARCSPQTKVRMIEALHRRKKF 751
           N+Y+  +  +     M GS+     E   D         A   PQ K  ++E L +R   
Sbjct: 558 NIYNAERLGLGGGGDMPGSELADFVEN-ADGF-------AEVFPQHKYNVVEILQQRGYL 609

Query: 752 CTMTGDGVNDSPSLKMANVGIAMGINGSDVSKEASDIVLSDDNFASILNAVEEGRRMTDN 811
             MTGDGVND+PSLK A+ GIA+    +D ++ A+DIV      ++I++A++  R++   
Sbjct: 610 VAMTGDGVNDAPSLKKADTGIAVE-GATDAARSAADIVFLAPGLSAIIDALKTSRQIFHR 668

Query: 812 IQKFVLQLLAENVAQALYL 830
           +  +V+  +A ++   ++L
Sbjct: 669 MYSYVVYRIALSLHLEIFL 687

>YIL048W (NEO1) [2619] chr9 (261436..264891) Member of the
           Drs2p-like ATPases family in the superfamily of P-type
           ATPases, overproduction confers neomycin resistance
           [3456 bp, 1151 aa]
          Length = 1151

 Score =  110 bits (274), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 192/763 (25%), Positives = 316/763 (41%), Gaps = 116/763 (15%)

Query: 131 HVIRNGKSETINSKDVVPGDICLVKVGDTIPADLRLIETKNFDTDESLLTGESLPVSKDA 190
           HVI   +S  I SKD+  GD+  V  GD IPADL L+++    + ES +  + L    D 
Sbjct: 257 HVITRNRS--IPSKDLKVGDLIKVHKGDRIPADLVLLQSSE-PSGESFIKTDQLDGETDW 313

Query: 191 NLVFG--KEEETSVGDRLN-LAFSSSAVVKGRAK--GIVIKTALNSEIGKIAKSLQGDSG 245
            L       +  S  D +N ++ ++SA  K   K  G V      S    +  +L  ++ 
Sbjct: 314 KLRVACPLTQNLSENDLINRISITASAPEKSIHKFLGKVTYKDSTSNPLSVDNTLWANTV 373

Query: 246 LISRDPSKSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAIIVMASQ 305
           L S     + +  T   T++             L  +++ ++ +L       +I+++A  
Sbjct: 374 LASSGFCIACVVYTGRDTRQAMNTTTAKVKTGLLELEINSISKILCACVFALSILLVAFA 433

Query: 306 KFDVDK---RVAIYAICVALSMIPSSLVVVLTITMSVGAAVM----VSRNVIVRKLDSLE 358
            F  D     +  Y I  + ++IP SL V L +  SV A  +         IVR     E
Sbjct: 434 GFHNDDWYIDILRYLILFS-TIIPVSLRVNLDLAKSVYAHQIEHDKTIPETIVRTSTIPE 492

Query: 359 ALGAVNDICSDKTGTLTQGKMLARQIWIPRFGTITISNSDDPFNPNEGNVSLIPRFSPYE 418
            LG +  + SDKTGTLTQ  M  ++I     GT++ ++           + ++  +    
Sbjct: 493 DLGRIEYLLSDKTGTLTQNDMQLKKI---HLGTVSYTSE---------TLDIVSDYVQSL 540

Query: 419 YSHNEDGDVGILQNFKDRLYEKDLPEDIDMDLFQKWLETATLANIATVFKDDATDCWKAH 478
            S   D     L N K  L      +D+   +    L  A   N+   F+DD      A 
Sbjct: 541 VSSKNDS----LNNSKVAL--STTRKDMSFRVRDMILTLAICHNVTPTFEDDELTYQAA- 593

Query: 479 GDPTEIAIQVFATKMDLPHNALTGEKSTNQSNENDQSSLSQHNEKPGSAQFEHIAEFPFD 538
             P EIAI  F   + L         S  + + +  S L +H+ K  +  +E +  FPF+
Sbjct: 594 -SPDEIAIVKFTESVGL---------SLFKRDRHSISLLHEHSGK--TLNYEILQVFPFN 641

Query: 539 STVKRMSSVYYNNHNETYNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDVETIRKNVY 598
           S  KRM  +  +   + Y    KGA ++++S           KI    D     + +   
Sbjct: 642 SDSKRMGIIVRDEQLDEYWFMQKGA-DTVMS-----------KIVESNDW----LEEETG 685

Query: 599 SLSNEGLRVLGFASKSFTKD-------QVNDDQLKNITSNRATA-------ESDLVFLGL 644
           +++ EGLR L    K   K        + ND  L  +  ++  +       E DL  LGL
Sbjct: 686 NMAREGLRTLVIGRKKLNKKIYEQFQKEYNDASLSMLNRDQQMSQVITKYLEHDLELLGL 745

Query: 645 IGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPTNLYHYSQEIVDS 704
            G+ D  + +   +++    AGI + MLTGD V TA+ ++    ++    Y ++   V  
Sbjct: 746 TGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHTITKVTR 805

Query: 705 MVMTGSQFDGLS---------------------EEEVDDLPV-LPLVIA-RCSPQTKVRM 741
                +Q + L                      E+E  D+ V LP VIA RC+PQ K  +
Sbjct: 806 PEGAFNQLEYLKINRNACLLIDGESLGMFLKHYEQEFFDVVVHLPTVIACRCTPQQKADV 865

Query: 742 IEALHRR--KKFCTMTGDGVNDSPSLKMANVGIAMGINGSDVSKEASDIVLSDDNFASIL 799
              + +   K+ C + GDG ND   ++ A+VG+  GI G +  K+AS  + +D +     
Sbjct: 866 ALVIRKMTGKRVCCI-GDGGNDVSMIQCADVGV--GIVGKE-GKQAS--LAADFSITQFC 919

Query: 800 NAVE----EGR---RMTDNIQKFVLQL-LAENVAQALYLIIGL 834
           +  E     GR   + +  + +FV+   L   + QA+Y I  L
Sbjct: 920 HLTELLLWHGRNSYKRSAKLAQFVMHRGLIIAICQAVYSICSL 962

>Scas_665.30
          Length = 1439

 Score =  109 bits (273), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 176/802 (21%), Positives = 316/802 (39%), Gaps = 175/802 (21%)

Query: 91   WITGGVISFVIAVNVLIGLVQEYKATKTMNSLKNLSSPNAHVIRNGKSETINSKDVVPGD 150
            +   G I  +  ++++  LV+  +  K++  + + +     V R+     +NS D+VPGD
Sbjct: 291  YYYAGCIFLISILSIVDTLVETRRTQKSLADMSHFAC-EVRVFRDEFWTNVNSADLVPGD 349

Query: 151  ICLVKVGD----TIPADLRLIETKNFDTDESLLTGESLPVSKDANLVFGKEEET------ 200
            I   ++ D      P D  L+ + +   +ES+LTGES+PVSK     F  E ET      
Sbjct: 350  I--YEISDPSLTVFPCD-SLLLSGDCIVNESMLTGESVPVSK-----FPAEPETMLQLLD 401

Query: 201  -----SVGDRLN--LAFSSSAVVKGR-------AKGIVIKTALNSEIGKIAKSLQGDSGL 246
                  +   L+    F+ + +++ R       A  +V++T  ++  G + +S+      
Sbjct: 402  DFQNTQISSYLSKSFLFNGTTIIRARIPYGQSAALAMVVRTGFSTTKGSLVRSM------ 455

Query: 247  ISRDPSKSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVL-FAIIVMASQ 305
            +   P+                       G   +    K   ++  IA+  F+I  +   
Sbjct: 456  VFPKPT-----------------------GFKFYEDSFKYIGVMALIALFGFSISCIQFI 492

Query: 306  KFDVDKRVAIY-AICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVN 364
            K  +DKR  I  A+ +   ++P +L   LTI      + +  + +       +   G ++
Sbjct: 493  KIGLDKRTMILRALDIITIVVPPALPATLTIGTGFALSRLKKKGIFCISPTRVNIGGKID 552

Query: 365  DICSDKTGTLTQGKM--LARQIWIPRFGTITISNSDDPFNPNEGNVSLIPRFSPYEYSHN 422
             +C DKTGTLT+  +  L  Q+ +P     +  NS    +  +    L P+FS  + S  
Sbjct: 553  ILCFDKTGTLTENGLDVLGVQLCVP-----SSHNSFQFADLVQDVHKLFPKFSLNDCSSP 607

Query: 423  EDGD-----VGILQNFKDRLYEKDL---PEDIDMDLFQKWL--ETATLANIATVFKDDAT 472
             D       + +L     R+ + +L   P D  M  F KW   E        + +++   
Sbjct: 608  RDYRAKNFFISLLTCHSLRVVDNELIGDPLDFKMFQFTKWSYEEDFQEKEFHSTYEERRH 667

Query: 473  DCWKAHGDPTEIAIQVFATKMDLPHNALTGEKSTNQSNENDQSSLSQHNEKPGSAQFEHI 532
            D   A  +  +I   V       P N            +ND      HN          I
Sbjct: 668  D--NALPENIDIIPAVVHPNSADPENTFI---------DNDP-----HN------FLGII 705

Query: 533  AEFPFDSTVKRMSSVYYNNHNETYNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDVET 592
              F F S ++RMS +   ++ + Y  + KGA E I   C+                   T
Sbjct: 706  RSFEFLSELRRMSVIVKPSNEDVYWAFTKGAPEVITQICNK-----------------AT 748

Query: 593  IRKNVYSLSN----EGLRVLGFASKSFTKDQVNDDQLKNITSNRATAESDLVFLGLIGIY 648
            +  N   + N    +G RV+  A +   ++      L +   +R   ES++ FLG I   
Sbjct: 749  LPANFEEMLNYYTHKGYRVIACAGRVLPRNT----WLYSQKVSREEVESNMEFLGFIIFE 804

Query: 649  DPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPT-NLYHYSQEIVDS--- 704
            +  + ETA  ++   +A I   M TGD V TA ++ ++  ++ +  +Y  S E +DS   
Sbjct: 805  NKLKKETAKTLQTLQEASIRTVMCTGDNVLTAISVGRQCNLIKSKKVYVPSLEEIDSTGQ 864

Query: 705  --------------------------------MVMTGSQF--------DGLSEEEVDDLP 724
                                            + +TG  F        + +SE+ ++ + 
Sbjct: 865  TSIIWRDVDNMDDTLDSRTLLPINNSSSTSYTLAITGDIFRIIFGDENNSISEDYINTVL 924

Query: 725  VLPLVIARCSPQTKVRMIEALHRRKKFCTMTGDGVNDSPSLKMANVGIAMGINGSDVSKE 784
            +   + AR SP  K  ++E L R        GDG ND  +LK A+VGI++    + V+  
Sbjct: 925  LKGTIYARMSPDEKHELMEQLQRLNYTVGFCGDGANDCGALKAADVGISLSEAEASVAAP 984

Query: 785  ASDIVLSDDNFASILNAVEEGR 806
             +  V    + + +L+ ++EGR
Sbjct: 985  FTSQVF---DISCVLDVIKEGR 1003

>YOR291W (YOR291W) [5075] chr15 (861172..865590) Member of the
            cation-translocating P-type ATPase superfamily of
            membrane transporters [4419 bp, 1472 aa]
          Length = 1472

 Score =  104 bits (259), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 185/792 (23%), Positives = 315/792 (39%), Gaps = 164/792 (20%)

Query: 99   FVIAV-NVLIGLVQEYKATKTMNSLKNLSSPNAHVIRNGKSETINSKDVVPGDICLVKVG 157
            F+I+V ++   L ++ K ++ +  + +    +  V+R+    TI+S ++VPGDI   +V 
Sbjct: 522  FLISVLSIFDSLNEQKKVSRNLAEMSHFHC-DVRVLRDKFWTTISSSELVPGDI--YEVS 578

Query: 158  D----TIPADLRLIETKNFDTDESLLTGESLPVSKDANLVFGKEEETSVGDRLNLAFSSS 213
            D     +P D  L+ +     +ES+LTGES+PVSK     F   EET    +L   F S+
Sbjct: 579  DPNITILPCDSILLSSDCI-VNESMLTGESVPVSK-----FPATEETMY--QLCDDFQST 630

Query: 214  AVVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLISRDPSKSWLQNTWISTKK---VTGAF 270
             +    +K   +    N    +IA        ++ R         T  ST K   V    
Sbjct: 631  QISSFVSKSF-LYNGTNIIRARIAPGQTAALAMVVR---------TGFSTTKGSLVRSMV 680

Query: 271  LGTNVGTPLHRKLSKLAVLLFWIAVL-FAIIVMASQKFDVDKRVAIY-AICVALSMIPSS 328
                 G   +R   K    +  IA+  F +  +   K  +DK+  I  A+ +   ++P +
Sbjct: 681  FPKPTGFKFYRDSFKYIGFMSLIAIFGFCVSCVQFIKLGLDKKTMILRALDIITIVVPPA 740

Query: 329  LVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSDKTGTLTQGKM--LARQIWI 386
            L   LTI  +   + +  + +       L   G ++ +C DKTGTLT+  +  L  QI  
Sbjct: 741  LPATLTIGTNFALSRLKEKGIFCISPTRLNISGKIDVMCFDKTGTLTEDGLDVLGVQISE 800

Query: 387  P------RFGTITISNSDDPFNPNEGNVSLIPRFSPYEYSHNEDGDVGILQNFKDRLYEK 440
            P      +FG + +S+    F          P+FS  + S   D        FK R    
Sbjct: 801  PNGVRGQKFGEL-LSDIRQVF----------PKFSLNDCSSPLD--------FKSR---- 837

Query: 441  DLPEDIDMDLFQKWLETATLANIATVFKDDATDC-------WKAHGDPTEIAIQ-VFATK 492
                    + F   L   +L ++      D  D        W    D  + A   ++  +
Sbjct: 838  --------NFFMSLLTCHSLRSVDGNLLGDPLDFKMFQFTGWSFEEDFQKRAFHSLYEGR 889

Query: 493  MD---LPHN-----ALTGEKSTNQSNENDQSSLSQHNEKPGSAQFEHIAEFPFDSTVKRM 544
             +    P N     A+    S N+  EN  +    HN       FE ++E      ++RM
Sbjct: 890  HEDDVFPENSEIIPAVVHPDSNNR--ENTFTDNDPHNFLGVVRSFEFLSE------LRRM 941

Query: 545  SSVYYNNHNETYNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDVETIRKNVYSLSNEG 604
            S +   N+++ Y  + KGA E I   C+        K T   D + E +R      ++ G
Sbjct: 942  SVIVKTNNDDVYWSFTKGAPEVISEICN--------KSTLPADFE-EVLR----CYTHNG 988

Query: 605  LRVLGFASKSFTKDQVNDDQLKNITSNRATAESDLVFLGLIGIYDPPRNETAGAVKKFHQ 664
             RV+  A K+  K       L +   +R   ES+L FLG I   +  + ET+  +K    
Sbjct: 989  YRVIACAGKTLPKRT----WLYSQKVSREEVESNLEFLGFIIFQNKLKKETSETLKSLQD 1044

Query: 665  AGINVHMLTGDFVGTAKAIAQEVGIL---------------------------------- 690
            A I   M TGD + TA ++ +E G++                                  
Sbjct: 1045 ANIRTIMCTGDNILTAISVGREAGLIQCSRVYVPSINDTPLHGEPVIVWRDVNEPDKILD 1104

Query: 691  -----PTNLYHYSQEIVD----SMVMTGSQF-------DGLSEEEVDDLPVLPLVIARCS 734
                 P  L + S E +     ++ ++G  F       + + EE ++++ +   + AR S
Sbjct: 1105 TKTLKPVKLGNNSVESLRECNYTLAVSGDVFRLLFRDENEIPEEYLNEILLNSSIYARMS 1164

Query: 735  PQTKVRMIEALHRRKKFCTMTGDGVNDSPSLKMANVGIAMGINGSDVSKEASDIVLSDDN 794
            P  K  ++  L +        GDG ND  +LK A+VGI++    + V+   +  +    N
Sbjct: 1165 PDEKHELMIQLQKLDYTVGFCGDGANDCGALKAADVGISLSEAEASVAAPFTSKIF---N 1221

Query: 795  FASILNAVEEGR 806
             + +L+ + EGR
Sbjct: 1222 ISCVLDVIREGR 1233

>Scas_704.38
          Length = 1161

 Score = 99.0 bits (245), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 189/774 (24%), Positives = 308/774 (39%), Gaps = 163/774 (21%)

Query: 94  GGVISFVIAVNVLIGLVQEYKATKTMNSLKNLSSPNA---HVIRNGKSETINSKDVVPGD 150
           G + S+V+ +  ++ +    +A   +   +  +  N+   HV+   +S+ + SKD+  GD
Sbjct: 227 GYLSSYVVPLAFVLTVTMSKEAMDDIQRRRRDNESNSELYHVL--NQSKLVPSKDLKVGD 284

Query: 151 ICLVKVGDTIPADLRLIETKNFDTDESLLTGESLPVSKDANLVFGKE-----EETSVGDR 205
           +  +  GD +PADL L+++    + E+ +  + L    D  L           E  + ++
Sbjct: 285 LIKISKGDRLPADLVLLQSSE-PSGETFIKTDQLDGETDWKLRIAPALTQNLTEPDLMNK 343

Query: 206 LNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLIS------------RDPSK 253
           +++  S+         G V     +S    I  +L  ++ L S            RD  +
Sbjct: 344 VSITASAPEKAIHNFLGKVTYKDTSSNPLSIDNTLWANTVLASTGFCIGCVVYTGRDTRQ 403

Query: 254 SWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAIIVMASQKFDVDKRV 313
           +   NT  +T K     L  N    + + L      L  I V+FA    +    DV + +
Sbjct: 404 A--MNTTTATVKTGLLELEIN---SISKILCASVFALSIILVVFAGFHNSDWYLDVMRYL 458

Query: 314 AIYAICVALSMIPSSLVVVLTITMSVGAAVMVSRNVI----VRKLDSLEALGAVNDICSD 369
            +++     ++IP SL V L +  SV A  +   + I    VR     E LG +  + SD
Sbjct: 459 ILFS-----TIIPVSLRVNLDLAKSVYAHQIEHDDTIPETIVRTSTIPEDLGRIEYLLSD 513

Query: 370 KTGTLTQGKMLARQIWIPRFGTITIS---------------NSDDPFNPNEGNVSLIPRF 414
           KTGTLTQ  M  ++I     GT++ +               NS +  NP+  +V    R 
Sbjct: 514 KTGTLTQNDMQLKKI---HLGTVSYTSETLDIVSDYVDALVNSSNSANPSGKSVPSTSR- 569

Query: 415 SPYEYSHNEDGDVGILQNFKDRLYEKDLPEDI-DMDLFQKWLETATLANIATVFKDDATD 473
                                    KDL   + DM      +  A   N+   F+DD   
Sbjct: 570 -------------------------KDLSARVRDM-----VVTLAICHNVTPTFEDDELT 599

Query: 474 CWKAHGDPTEIAIQVFATKMDLPHNALTGEKSTNQSNENDQSSLSQHNEKPGS-AQFEHI 532
              A   P EIAI  F   + L               + D+ S+S  +   GS   +E +
Sbjct: 600 YQAA--SPDEIAIVKFTESVGL------------SLFKRDRHSISLLHGHSGSILTYEIL 645

Query: 533 AEFPFDSTVKRMSSVYYNNHNETYNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDVET 592
             FPF+S  KRM  + ++   + Y    KGA              D V    + + D   
Sbjct: 646 QVFPFNSDSKRMGIIVHDEQKDEYWFMQKGA--------------DTVMARIVENND--W 689

Query: 593 IRKNVYSLSNEGLRVLGFASK--------SFTKD-------QVNDDQLKNITSNRATAES 637
           + +   +++ EGLR L    K         F KD        VN DQ  N    +   E 
Sbjct: 690 LEEETGNMAREGLRTLVVGRKKLSRNIYDQFKKDYDDASLSMVNRDQQMNAVITKY-LEY 748

Query: 638 DLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIA---------QEVG 688
           DL  LGL G+ D  +N+   +++    AGI + MLTGD V TA+ ++         Q V 
Sbjct: 749 DLELLGLTGVEDKLQNDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVH 808

Query: 689 ILPT--------NLYHYSQEIVDSMVMTGSQFDGL-----SEEEVDDLPVLPLVIA-RCS 734
           I+          N   Y +    + ++   +  G+       E  D +  LP V+A RC+
Sbjct: 809 IITKLTKPEGALNQLEYLKVNKGACLLIDGESLGMFLRYYKREFFDVVICLPTVVACRCT 868

Query: 735 PQTK--VRMIEALHRRKKFCTMTGDGVNDSPSLKMANVGIAMGINGSDVSKEAS 786
           PQ K  V ++      K+ C + GDG ND   ++ A+VG+  GI G +  K+AS
Sbjct: 869 PQQKADVALVIREFTGKRVCCI-GDGGNDVSMIQCADVGV--GIVGKE-GKQAS 918

>AFR567W [3759] [Homologous to ScYOR291W - SH]
            complement(1455295..1459644) [4350 bp, 1449 aa]
          Length = 1449

 Score = 95.1 bits (235), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 179/774 (23%), Positives = 308/774 (39%), Gaps = 139/774 (17%)

Query: 99   FVIAV-NVLIGLVQEYKATKTMNSLKNLSSPNAHVIRNGKSETINSKDVVPGDICLVKVG 157
            F+I+V +V+  LV+  ++++ ++ L      +  V R+G    + S D+VPGDI   ++ 
Sbjct: 510  FIISVLSVIDTLVETKQSSERLSELSQFYC-DVRVYRDGFWSQVPSSDLVPGDI--YELT 566

Query: 158  DT----IPADLRLIETKNFDTDESLLTGESLPVSKDANLVFGKEEETSVGD-----RLNL 208
            D     +P D  LI       +ES+LTGES+PVSK A     +E    + D     +L+ 
Sbjct: 567  DPSLSLLPCDSILISGDCL-VNESMLTGESVPVSKVAA---TRETMLQLLDDFMDTQLSS 622

Query: 209  AFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLISRDPSKSWLQNTWISTKK--- 265
              S S +  G  K I ++      I           G+++R         T  ST K   
Sbjct: 623  FVSKSFLFNG-TKLIRVRATAGQSIAL---------GMVAR---------TGFSTTKGSL 663

Query: 266  VTGAFLGTNVGTPLHRKLSKLAVLLFWIAVL-FAIIVMASQKFDVDKRVAIY-AICVALS 323
            V         G   +    K    +  IA+  FA+  +   +  +DKR  I  A+ +   
Sbjct: 664  VRSMVFPKPTGFKFYEDSFKYIGYISIIALFGFAVSFIQFLRLGLDKRTMILRALDIITV 723

Query: 324  MIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSDKTGTLTQGKM--LA 381
            ++P +L   L+I        +  + +       +   G ++ +C DKTGTLT+  +  L 
Sbjct: 724  VVPPALPASLSIGTGFALNRLKKKGIFCISPTRVNVGGKIDVMCFDKTGTLTEDGLDVLG 783

Query: 382  RQIWIPRFGTITISNSDDPFNPNEGNVSLIPRFSPYEYSHNEDGDVGILQNFKDRLYEKD 441
              +  P    + IS           ++SL    S  +    ++  V +L     R+ + +
Sbjct: 784  VHVVQPLQQEMKISKLVTDVKDLLQSLSLSDCVSTRDMK-AKNFLVSLLTCHSLRMVDGE 842

Query: 442  L---PEDIDMDLFQKWLETATLANIATVFKDDATDCWKAHGDPTEIAIQVFATKMD---L 495
            L   P D  M  F KW +            ++ T   K H         ++  + D   +
Sbjct: 843  LLGDPFDFKMVQFTKWSD------------EEETGNRKVHS--------LYEERHDGSTM 882

Query: 496  PHNALTGEKSTNQSNENDQSSLSQHNEKPGSAQFEHIAEFPFDSTVKRMSSVYYNNHNET 555
            P N+       + S +       +  E+  S     +  F F S ++RMS +        
Sbjct: 883  PENSRFAPAIVHPSGKG------RFIEREPSNVIGIVRSFEFLSNLRRMSVIVKPFSENV 936

Query: 556  YNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDVETIRKNVYSLSNEGLRVLGFASKSF 615
            +  + KGA E I   CS        +  PL   D E +   ++  ++ G RV+  A K  
Sbjct: 937  FMSFTKGAPEVIFELCSK-------QTLPL---DYEAL---LHHYTHNGYRVIACAGKKL 983

Query: 616  TKDQVNDDQLKNITSNRATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGD 675
            T+       L +   +R   ES+L FLG I   +  +  T   ++  H+A I   M TGD
Sbjct: 984  TRQS----WLYSQKVSREEIESNLEFLGFIIFENKLKGTTKETLESLHRADIRTIMCTGD 1039

Query: 676  FVGTAKAIAQEVGILPT--------NLYHYSQE--------------IVDSMVM------ 707
             V TA ++ +E G++ +        N    SQE               +DS+ +      
Sbjct: 1040 NVLTAISVGREAGLVESPRVFVSVINDIDTSQEGDIITWQNVANSSDTLDSVTLRPLSGD 1099

Query: 708  --------TGSQFDGLS-------EEEVDDLPVLPLVIARCSPQTKVRMIEALHRRKKFC 752
                    TG  F  L        EE ++++ +   + AR SP  K  ++E L       
Sbjct: 1100 TDDYTLAVTGEVFRLLFKTDKSQIEEVINNILLKTSIYARMSPDEKHELVERLQSIGYQV 1159

Query: 753  TMTGDGVNDSPSLKMANVGIAMGINGSDVSKEASDIVLSDDNFASILNAVEEGR 806
               GDG ND  +LK A++GI++    + V+   +  +      + +L+ ++EGR
Sbjct: 1160 GFCGDGANDCGALKAADIGISLSEAEASVAAPFTSRLF---EISCVLDVMKEGR 1210

>KLLA0C08393g 734655..738101 highly similar to sp|P40527
           Saccharomyces cerevisiae YIL048w NEO1 ATPase whose
           overproduction confers neomycin resistance, start by
           similarity
          Length = 1148

 Score = 95.1 bits (235), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 185/802 (23%), Positives = 319/802 (39%), Gaps = 123/802 (15%)

Query: 94  GGVISFVIAVNVLIGLVQEYKATKTMNSLKNLSSPNAHVIRN-GKSETINSKDVVPGDIC 152
           G + S+++ +  ++ +    +A   +N  K     N  +     K   I SKD+  GDI 
Sbjct: 220 GYLSSYIVPLAFVLTVTMSKEAMDDINRRKRDREANNELYEVVNKPCPIPSKDLKVGDII 279

Query: 153 LVKVGDTIPADLRLIETKNFDTDESLLTGESLPVSKDANLVFGKEEETSV--GDRLN-LA 209
            +K G  +PAD+ +++T N    ES +  + L    D  L        S+   D LN + 
Sbjct: 280 KLKKGARVPADVVVLQT-NEPNGESFIKTDQLDGETDWKLRLACSLTQSLTENDLLNNIT 338

Query: 210 FSSSA---VVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLISRDPSKSWLQNTWISTKKV 266
            ++SA    +      I  K + +S +  +  ++  ++ L S       +  T   T++ 
Sbjct: 339 ITASAPEHSIHNFLGKITYKDSTSSPLS-VDNTMWENTVLASSAACICCIVYTGRETRQA 397

Query: 267 TGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAIIVMASQKFDV-DKRVAIYAICVALS-M 324
                       L  +++ L+ +L     L +I+++A   F+  D  V I    +  S +
Sbjct: 398 LNTTKSKAKTGLLELEINGLSKILCACVFLLSIMLVAFAGFNNNDWYVDIMRYLILFSTI 457

Query: 325 IPSSLVVVLTITMSVGAAVMVS----RNVIVRKLDSLEALGAVNDICSDKTGTLTQGKML 380
           IP SL V L +  SV A  +       + IVR     E LG +  + SDKTGTLTQ  M 
Sbjct: 458 IPVSLRVNLDLGKSVYAYKIEHDKQIEDTIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQ 517

Query: 381 ARQIWIPRFGTITISNSDDPFNPNEGNVSLIPRFSPYEYSHNEDGD-VGILQNFKDRLYE 439
            ++I     GT++ +N           + ++  F     S   +       +N  DR+  
Sbjct: 518 LKKI---HLGTVSYTNE---------TMDIVTDFIQSMNSRTSNSTPTTTRKNISDRV-- 563

Query: 440 KDLPEDIDMDLFQKWLETATLANIATVFKDDATDCWKAHGDPTEIAIQVFATKMDLPHNA 499
                   +DL       A   N+   F+D       A   P EIAI  F   + L    
Sbjct: 564 --------IDLVTTL---AICHNVTPTFEDGELTYQAA--SPDEIAIVKFTESVGL---- 606

Query: 500 LTGEKSTNQSNENDQSSLSQHNEKPG-SAQFEHIAEFPFDSTVKRMSSVYYNNHNETYNI 558
                        D+ S+S  ++  G   +++    FPF+S  KRM  + ++   + Y  
Sbjct: 607 --------SLFRRDRHSISLFHDHSGMKLEYDIKILFPFNSDSKRMGVIIFDKLKQEYWF 658

Query: 559 YGKGA--FESIISCCSSWYGKDGVKITPLTDCDVETIRKNVYSLSNEGLRVLGFASKSFT 616
             KGA    S I   + W                  + +   +++ EGLR L    K  +
Sbjct: 659 LQKGADTVMSSIVVRNDW------------------LEEETSNMATEGLRTLVIGRKKLS 700

Query: 617 KD--------------QVNDDQLKNITSNRATAESDLVFLGLIGIYDPPRNETAGAVKKF 662
            +               + D ++      R   E+DL  LGL G+ D  + +   +++  
Sbjct: 701 TNLFEQFEKEYSEASLTMMDREVHMQNVVRKFLENDLELLGLTGVEDKLQKDVKSSIELL 760

Query: 663 HQAGINVHMLTGDFVGTAKAIAQEVGILPTNLY-----------------HYSQEIVDSM 705
             AGI + MLTGD V TA+ ++    ++    Y                  Y Q   +S 
Sbjct: 761 RNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHTVTKVNKPEGALHHLEYLQVNQNSC 820

Query: 706 VMTGSQFDGL-----SEEEVDDLPVLPLVIA-RCSPQTKVRMIEALHRR--KKFCTMTGD 757
           ++   +  GL      +E  D +  LP V+A RC+PQ K  +   + +   K+ C + GD
Sbjct: 821 LLIDGESLGLYLQYFPDEFFDIVVNLPTVVACRCTPQQKADVAVFIRQATGKRVCCI-GD 879

Query: 758 GVNDSPSLKMANVGIAM-GINGSDVSKEASDIVLSDDNFASILNAVEEGR---RMTDNIQ 813
           G ND   ++ A+VG+ + G  G   S  A   +    +   +L  +  GR   + +  + 
Sbjct: 880 GGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQFCHLTKLL--LWHGRNSYKSSAKLS 937

Query: 814 KFVLQL-LAENVAQALYLIIGL 834
           +FV+   L  +V QA+Y I  +
Sbjct: 938 QFVIHRGLIISVCQAVYSICSM 959

>Kwal_26.9207
          Length = 1469

 Score = 95.1 bits (235), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 177/788 (22%), Positives = 315/788 (39%), Gaps = 165/788 (20%)

Query: 99   FVIAVNVLIGLVQEYKATKTMNSLKNLSSPNAHVIRNGKSETINSKDVVPGDICLVKVGD 158
            F+I++  +I  + E K T    +  + S     V R+G    ++S ++VPGD+   ++ D
Sbjct: 528  FIISMLSIIDTLVETKKTSQRLAEVSHSHCEVRVYRDGFWVQVSSSELVPGDV--YEISD 585

Query: 159  ----TIPADLRLIETKNFDTDESLLTGESLPVSK----DANL--VFGKEEETSVGDRL-- 206
                T P D  L+ + +   +ES+LTGES+PVSK    D  +  +    ++T + + L  
Sbjct: 586  PSLSTFPCD-SLLLSGDCIVNESMLTGESVPVSKIPASDETIYQLLEDFQKTQISNFLAK 644

Query: 207  NLAFSSSAVVKGRAKG-------IVIKTALNSEIGKIAKSLQGDSGLISRDPSKSWLQNT 259
            +  F+ + +++ R  G       +V++T  ++  G + +S+     +  +     + +++
Sbjct: 645  SFLFNGTKIIRVRIGGEQSTALAMVVRTGFSTTKGSLLRSM-----IFPKPSGFKFYEDS 699

Query: 260  WISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAIIVMASQKFDVDKRVAIYAIC 319
            +         ++G          ++ +A+  F I+ +  I +  + K  + + + I  I 
Sbjct: 700  F--------KYIGF---------MTLIALAGFSISCINFIRLGLAYKVMILRALDIITIV 742

Query: 320  VALSMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSDKTGTLTQGKM 379
            V     P +L   L+I  S   A +  + +       +   G ++ +C DKTGTLT+  +
Sbjct: 743  V-----PPALPATLSIGASFAIARLKKKGIFCIAPTRVNVSGKIDVMCFDKTGTLTEDGL 797

Query: 380  --LARQIWIP------RFGTITISNSDDPFNPNEGNVSLIPRFSPYEYSHNEDGDVGILQ 431
              L   +  P      RFG + I+N    FN      SL    SP ++  + +  V +L 
Sbjct: 798  DVLGVHVAEPQGHQNFRFGAL-ITNVRGLFN----KYSLNDCGSPIDFK-SRNFLVSLLT 851

Query: 432  NFKDRLYEKDL---PEDIDMDLFQKWLETATLANIATVFKDDATDCWKAHGDPTEIAIQV 488
                R+ + +L   P D  M  F  W       + A  F+D     +K H    E     
Sbjct: 852  CHSLRVVDGELLGDPLDFKMFQFTNW-------SYAEDFQD-----FKFHSLNEERN--- 896

Query: 489  FATKMDLPHNA--------LTGEKSTNQSNENDQSSLSQHNEKPGSAQFEHIAEFPFDST 540
               K  LP NA           E + N+  END  +L              I  F F S 
Sbjct: 897  --NKSTLPENAGIAPAVVHPNAESTENKFTENDPHNL-----------LGVIRSFEFVSE 943

Query: 541  VKRMSSVYYNNHNETYNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDVETIRKNVYSL 600
            ++RMS +        +  + KGA E I   C+                + E I +     
Sbjct: 944  LRRMSVIVKPYGENVFWGFTKGAPEVISEICNK----------STLPANYEQILQQ---Y 990

Query: 601  SNEGLRVLGFASKSFTKDQVNDDQLKNITSNRATAESDLVFLGLIGIYDPPRNETAGAVK 660
            ++ G RV+  A K+  K      Q      +R   ES++ FLG +   +  +  T   + 
Sbjct: 991  THNGYRVIACAGKTLPKRTWRFAQ----KVSREEVESNMEFLGFVVFENKLKPSTTPTLA 1046

Query: 661  KFHQAGINVHMLTGDFVGTAKAIAQEVGILPTNLYHYSQEIVDSM--------------- 705
                AGI   M TGD V TA ++ +E G++ T  + +  +I D+M               
Sbjct: 1047 SLQDAGIRSIMCTGDNVLTAISVGRESGLI-TESHVFVPQINDNMDPNEDLIIWRDVDDC 1105

Query: 706  --------------------VMTGSQF-------DGLSEEEVDDLPVLPLVIARCSPQTK 738
                                 +TG  F       + L E  ++ + +   + AR SP  K
Sbjct: 1106 DLILDGVTLEPMNGSSDYTIAVTGDVFRLLFKNNEVLPESYINMVLLKSSIYARMSPDEK 1165

Query: 739  VRMIEALHRRKKFCTMTGDGVNDSPSLKMANVGIAMGINGSDVSKEASDIVLSDDNFASI 798
              ++  L          GDG ND  +LK A+VG+++    + V+   +  V      + I
Sbjct: 1166 HELVGQLQGLDYVVGFCGDGANDCGALKAADVGVSLSEAEASVAAPFTSSVF---EISCI 1222

Query: 799  LNAVEEGR 806
            L+ ++EGR
Sbjct: 1223 LDVIKEGR 1230

>Sklu_2193.1 YIL048W, Contig c2193 334-3765 reverse complement
          Length = 1143

 Score = 92.0 bits (227), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 171/705 (24%), Positives = 296/705 (41%), Gaps = 116/705 (16%)

Query: 137 KSETINSKDVVPGDICLVKVGDTIPADLRLIETKNFDTDESLLTGESLPVSKDANL--VF 194
           K++ + SKD+  GD+  +  G  IPADL L+++    + ES +  + L    D  L    
Sbjct: 257 KAQLVPSKDLKVGDLIKIHKGTRIPADLVLLQSSE-PSGESFIKTDQLDGETDWKLRVAC 315

Query: 195 GKEEETSVGDRLN-LAFSSSAVVKG--RAKGIVIKTALNSEIGKIAKSLQGDSGLISRDP 251
              +  S  D LN ++ ++S+  K   R  G +     +S    +  ++  ++ L S   
Sbjct: 316 SLTQNLSTDDLLNKISITASSPEKSIHRFLGKLTYKDSSSNALSVDNTMWANTVLASVGS 375

Query: 252 SKSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAIIVMASQKF-DVD 310
               +  T   T++     + +     L  +++ L+ +L     + +I+++A   F + D
Sbjct: 376 CIGCVVYTGTDTRQAMNTTMSSVKTGLLELEINSLSKILCACVFVLSIVLVAFAGFGNKD 435

Query: 311 KRVAIYAICVALS-MIPSSLVVVLTITMSVGAAVM----VSRNVIVRKLDSLEALGAVND 365
             V I    +  S +IP SL V L +  SV A  +       + IVR     E LG +  
Sbjct: 436 WYVDIMRYLILFSTIIPVSLRVNLDLGKSVYARQIEHDATIPDTIVRTSTIPEDLGRIEY 495

Query: 366 ICSDKTGTLTQGKMLARQIWIPRFGTITIS-NSDDPFNPNEGNVSLIPRFSPYEYSHNED 424
           + SDKTGTLTQ  M  +++     GT++ + ++ D        +      +P   S  + 
Sbjct: 496 LLSDKTGTLTQNDMQLKKL---HLGTVSYTMDTMDIVTDYVQELVSSSTTTPMPQSTAK- 551

Query: 425 GDVGILQNFKDRLYEKDLPEDIDMDLFQKWLETATLANIATVFKDDATDCWKAHGDPTEI 484
                          KDLP  +  DL    +  A   N+   F+D       A   P EI
Sbjct: 552 ---------------KDLPNRV-RDLV---VTLAICHNVTPTFEDGELTYQAA--SPDEI 590

Query: 485 AIQVFATKMDLPHNALTGEKSTNQSNENDQSSLSQHNEKPGSAQFEH--IAEFPFDSTVK 542
           AI  F   + L         S  + + +  S   QH+    +  FE+  +  FPF+S  K
Sbjct: 591 AIVKFTESVGL---------SLFKRDRHSVSLFHQHS----ATNFEYDILQVFPFNSDTK 637

Query: 543 RMSSVYYNNHNETYNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDVETIRKNVYSLSN 602
           RM  + Y+     +    KGA +++++           +I    D     + + V +++ 
Sbjct: 638 RMGIIVYDKVKGEHWFMQKGA-DTVMA-----------RIVQSNDW----LDEEVGNMAR 681

Query: 603 EGLRVLGFASKSFT-------KDQVNDDQLKNITSNRATA-------ESDLVFLGLIGIY 648
           EGLR L    K  +       + + +D  L  +  +   +       E +L  LGL G+ 
Sbjct: 682 EGLRTLVIGRKKLSPKSYEQFRKEYHDASLSMLNRDETMSSVIKKHLEHNLELLGLTGVE 741

Query: 649 DPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPTNLY------------- 695
           D  +N+   +++    AG+ + MLTGD V TA+ ++    ++    Y             
Sbjct: 742 DKLQNDVKSSIELLRNAGVKIWMLTGDKVETARCVSISAKLISRGQYVHTVTKLSRPEGA 801

Query: 696 ----HYSQEIVDSMVMTGSQFDGL----SEEEVDDLPV-LPLVIA-RCSPQTKVRMIEAL 745
                Y +    S ++   +  G+     ++E  D+ V LP VIA RC+PQ K  +  AL
Sbjct: 802 LNALEYLKINKSSCLLIDGESLGMFLTYYKQEFFDIVVDLPAVIACRCTPQQKADV--AL 859

Query: 746 HRR----KKFCTMTGDGVNDSPSLKMANVGIAMGINGSDVSKEAS 786
             R    K+ C + GDG ND   ++ A+VG+  GI G +  K+AS
Sbjct: 860 LIREITGKRVCCI-GDGGNDVSMIQCADVGV--GIVGKE-GKQAS 900

>CAGL0L00715g 86810..90244 highly similar to sp|P40527 Saccharomyces
           cerevisiae YIL048w NEO1 ATPase whose overproduction
           confers neomycin resistance, hypothetical start
          Length = 1144

 Score = 91.7 bits (226), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 173/722 (23%), Positives = 283/722 (39%), Gaps = 145/722 (20%)

Query: 136 GKSETINSKDVVPGDICLVKVGDTIPADLRLIETKN------FDTDESLLTGESLPVSKD 189
           G+   + SKD+  GD+  +  G  +PADL L+++          TD+  L GE+    + 
Sbjct: 254 GRPRPVASKDLKVGDLIKISKGARVPADLILLQSSEPSGEAFIKTDQ--LDGETDWKLRI 311

Query: 190 ANLVFGKEEETSVGDRLNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLIS- 248
           A  +     E  + +++ +  S+         G V     N+    I  +L  ++ L S 
Sbjct: 312 ACTLTQNLNEDDLLEKITITASAPEKSIHSFLGRVTYKDTNTSGLTIDNTLWANTVLASS 371

Query: 249 -----------RDPSKSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLF 297
                      RD  ++   NT  ++ KV    L   +   + + L     +L  + V+F
Sbjct: 372 GFCIGCVIYTGRDTRQA--MNT--TSAKVKTGLLELEIN-DISKILCACVFILSILLVVF 426

Query: 298 AIIVMASQKFDVDKRVAIYAICVALSMIPSSLVVVLTITMSVGAAVM----VSRNVIVRK 353
           A +       D+ + + +++     ++IP SL V L +  SV A  +         IVR 
Sbjct: 427 AGLHNDDWYVDIMRYLILFS-----TIIPVSLRVNLDLAKSVYAHQIEHDKTIPETIVRT 481

Query: 354 LDSLEALGAVNDICSDKTGTLTQGKMLARQIWIPRFGTITISNSDDPFNPNEGNVSLIPR 413
               E LG +  + SDKTGTLTQ  M  +++ +                   GNVS    
Sbjct: 482 STIPEDLGRIEYLLSDKTGTLTQNDMQLKKVHL-------------------GNVSYTTE 522

Query: 414 ----FSPYEYSHNEDGDVGILQNFKDRLYEKDLPEDIDMDLFQKWLETATLANIATVFKD 469
                S Y     E  +  +          KD    + +DL       A   N+   F+D
Sbjct: 523 TADIVSDYIQGMIESKNDSVTNLGPRSTTRKDAATHV-IDLITTL---AICHNVTPTFED 578

Query: 470 DATDCWKAHGDPTEIAIQVFATKMDLPHNALTGEKSTNQSNENDQSSLSQHNEKPGS-AQ 528
           D      A   P EIAI  F   + L               + D+ S+S  +E  G+   
Sbjct: 579 DELTYQAA--SPDEIAIVKFTESVGL------------SLFKRDRHSMSLLHEHSGTILN 624

Query: 529 FEHIAEFPFDSTVKRMSSVYYNNHNETYNIYGKGAFESIISCCSSWYGKDGVKITPLTDC 588
           ++ +  FPF+S  KRM  + Y+   + Y    KGA              D V    + + 
Sbjct: 625 YDVLTMFPFNSDTKRMGIIVYDKQKDQYWFLQKGA--------------DTVMNRIVANN 670

Query: 589 DVETIRKNVYSLSNEGLRVLGFASKSFTK----------DQVN------DDQLKNITSNR 632
           D   + +   +++ EGLR L    K  TK          ++V+      + ++ N  S  
Sbjct: 671 D--WLEEETGNMAREGLRTLVIGRKKLTKKIYEQFKKEYEEVSASMYNREQEMANTISKY 728

Query: 633 ATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPT 692
              E DL  LGL G+ D  + +   +++    AGI + MLTGD V TA+ ++    ++  
Sbjct: 729 L--EHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISR 786

Query: 693 NLYHYSQEIVDSMVMTGSQFDGLS-------------------------EEEVDDLPVLP 727
             Y +   +V  +      F+ L                          +E  D +  LP
Sbjct: 787 GQYVH---VVTKLSKPEGAFNQLEYLKVNKNACLLIDGESLGMFLKYYRQEFFDVVVHLP 843

Query: 728 LVIA-RCSPQTK--VRMIEALHRRKKFCTMTGDGVNDSPSLKMANVGIAMGINGSDVSKE 784
            VIA RC+PQ K  V +I      K+ C + GDG ND   ++ A+VG+  GI G +  K+
Sbjct: 844 TVIACRCTPQQKADVALIIRELTGKRVCCI-GDGGNDVSMIQCADVGV--GIVGKE-GKQ 899

Query: 785 AS 786
           AS
Sbjct: 900 AS 901

>ADL079C [1662] [Homologous to ScYIL048W (NEO1) - SH]
           (544854..548354) [3501 bp, 1166 aa]
          Length = 1166

 Score = 89.7 bits (221), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 154/604 (25%), Positives = 257/604 (42%), Gaps = 115/604 (19%)

Query: 283 LSK-LAVLLFWIAVLFAIIV-MASQKFDVDKRVAIYAICVALSMIPSSLVVVLTITMSVG 340
           LSK L + +F +++L  +I  +   K+ VD  +  Y I  + ++IP SL V L +  SV 
Sbjct: 431 LSKILCICVFTLSILLVVIGGLDDDKWYVD--IMRYLILFS-TIIPVSLRVNLDLGKSVY 487

Query: 341 AAVMVSR----NVIVRKLDSLEALGAVNDICSDKTGTLTQGKMLARQIWIPRFGTITISN 396
           A  + S     + IVR     E LG +  + SDKTGTLTQ  M  R+I     GT++ + 
Sbjct: 488 ARQIESDKSIPDTIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLRKI---HLGTVSYTM 544

Query: 397 SDDPFNPNEGNVSLIPRFSPYEYSHNEDGDVGILQNFKDRLYEKDLPEDIDMDLFQKWLE 456
                      + ++  +     S    G  G+          K++ + +  DL    + 
Sbjct: 545 E---------TMDMVTDYIQTLTSPANMGAAGVAVTGS----RKEVSQRVR-DLV---VT 587

Query: 457 TATLANIATVFKDDATDCWKAHGDPTEIAIQVFATKMDLPHNALTGEKSTNQSNENDQSS 516
            AT  N+   F+D+    ++A   P EIAI  F  ++ L               + D+ S
Sbjct: 588 LATCHNVTPNFEDNEL-AYQA-ASPDEIAIVKFTERVGL------------SLFKRDRHS 633

Query: 517 LSQHNEKPG-SAQFEHIAEFPFDSTVKRMSSVYYNNHNETYNIYGKGAFESIISCCSSWY 575
           L+  +E  G + Q++ +  FPF S  KRM  +  +          KGA ++++S      
Sbjct: 634 LTLFHEYSGVNLQYDILHVFPFTSDTKRMGIIVRDRTKNEIWFLQKGA-DTVMS------ 686

Query: 576 GKDGVKITPLTDCDVETIRKNVYSLSNEGLRVLGFASK--------SFTKD-------QV 620
                KI    D     + + V +++ EGLR L  A K         F+K+        +
Sbjct: 687 -----KIVQSNDW----LEEEVSNMAREGLRTLVIARKKLSTRLYEQFSKEYKDASLSML 737

Query: 621 NDDQLKNITSNRATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTA 680
           N D+  N    R   E +L  LGL G+ D  + +   +++    AG+ + MLTGD V TA
Sbjct: 738 NRDEAMNEVVKRH-LEHNLELLGLTGVEDKLQKDVKTSIELLRNAGVKIWMLTGDKVETA 796

Query: 681 KAIAQEVGILPTNLY-HYSQEIV------------------------DSMVMTGSQFDGL 715
           + +     ++    Y H   ++                         DS+ +  S +   
Sbjct: 797 RCVCVSAKLISRGQYVHTITKLTRRDGALSRLEYLKANRNSCLLIDGDSLAIYMSHYRA- 855

Query: 716 SEEEVDDLPVLPLVIA-RCSPQTK--VRMIEALHRRKKFCTMTGDGVNDSPSLKMANVGI 772
             E  + +  LP+VIA RC+PQ K  V ++      K+ C + GDG ND   ++ A+VG+
Sbjct: 856 --EFFEIVICLPVVIACRCTPQQKADVALLIREMTGKRVCCI-GDGGNDVSMIQCADVGV 912

Query: 773 AM-GINGSDVSKEASDIVLSDDNFASILNAVEEGR---RMTDNIQKFVLQL-LAENVAQA 827
            + G  G   S  A   +    +   +L  +  GR   + +  + +FV+   L  +V QA
Sbjct: 913 GIVGKEGKQASLAADYSITQFCHLTKLL--LWHGRNSYKRSAKLSQFVIHRGLLISVCQA 970

Query: 828 LYLI 831
           +Y I
Sbjct: 971 VYSI 974

>Kwal_23.5789
          Length = 1133

 Score = 83.2 bits (204), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 176/763 (23%), Positives = 313/763 (41%), Gaps = 135/763 (17%)

Query: 136 GKSETINSKDVVPGDICLVKVGDTIPADLRLIETKNFDTDESLLTGESLPVSKDANLVFG 195
            KS+ + SKD+  GD+  +  G   PADL L+++    + E  +  + L    D  L   
Sbjct: 246 SKSQLVPSKDLKVGDLIKIGKGARAPADLVLLQSSE-PSGEIFIKTDQLDGETDWKLRIA 304

Query: 196 KEEETSVG-DRLNLAFSSSAVVKGRA----KGIVIKTALNSEIGKIAKSLQGDSGLISRD 250
                 +  D L    S +A V  ++     G +    + S+   +  ++  ++   S  
Sbjct: 305 CPLTQHLSQDDLLYRISITASVPEKSINNFLGKLTFGEIQSQPLSVDNTMWANTVFASAG 364

Query: 251 PSKSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAIIVMASQKFDV- 309
            + + +  T   T++     + +     L  +++ L+ +L     + ++ ++A   F+  
Sbjct: 365 TAIACVVYTGADTRQAMNTSMSSVKTGLLELEINSLSKILCACVFILSVALVAFAGFNNN 424

Query: 310 DKRVAIYAICVALS-MIPSSLVVVLTITMSVGAAVMVSRNVI----VRKLDSLEALGAVN 364
           D  V I    +  S +IP SL V L +  SV A  +   + I    VR     E LG + 
Sbjct: 425 DWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYAHQIEHDSTIPETIVRTSTIPEDLGRIE 484

Query: 365 DICSDKTGTLTQGKMLARQIWIPRFGTITISNSDDPFN---------PNEGNVSLIPRFS 415
            + SDKTGTLTQ  M  +++ +      T+S + D  +          +  N S +P  S
Sbjct: 485 YLLSDKTGTLTQNDMELKKLHLG-----TVSYTMDTMDIVTDYVRAMSDNLNSSAVPSAS 539

Query: 416 PYEYSHNEDGDVGILQNFKDRLYEKDLPEDIDMDLFQKWLETATLANIATVFKDDATDCW 475
                                  +KDLP  +     +  + T  L +  T   +D    +
Sbjct: 540 -----------------------KKDLPGRV-----RDLVLTLALCHQVTPTFEDGELTY 571

Query: 476 KAHGDPTEIAIQVFATKMDLPHNALTGEKSTNQSNENDQSSLSQHNEKPGSA-QFEHIAE 534
           +A   P EIAI  F   + L                 D+ S++  +++ G+  +++ +  
Sbjct: 572 QA-ASPDEIAIVKFTESVGL------------TLFRRDRHSITLLHDQSGTNFEYDILHV 618

Query: 535 FPFDSTVKRMSSVYYNNHNETYNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDVETIR 594
           FPF+S  KRM  V ++   + Y    KGA + ++S           KI    D     + 
Sbjct: 619 FPFNSDNKRMGIVIFDKQKDEYWFLQKGA-DVVMS-----------KIVQKNDW----LE 662

Query: 595 KNVYSLSNEGLRVLGFASK--------SFTKD-------QVNDD-QLKNITSNRATAESD 638
           +   +L+ EGLR L    K        +FTKD        +N +  + N+ S     E D
Sbjct: 663 EETGNLAREGLRTLVIGRKRLSKKLLQTFTKDYEDASLMMLNREVTMSNVISKHL--EHD 720

Query: 639 LVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPTNLYHYS 698
           L  LGL G+ D  + +   +++    AGI + MLTGD V TA+ ++    ++    Y ++
Sbjct: 721 LEILGLTGVEDKLQEDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLVSRGQYVHT 780

Query: 699 QEIVD-----------------SMVMTGSQFDGL-----SEEEVDDLPVLPLVIA-RCSP 735
              V+                 S ++   +  GL      ++  + +  LP VIA RC+P
Sbjct: 781 VTKVNKPEGALTHLELLKINTNSCLLIDGESLGLYLEYYRQQFFEIVVNLPAVIACRCTP 840

Query: 736 QTKVRMIEALHRR--KKFCTMTGDGVNDSPSLKMANVGIAM-GINGSDVSKEASDIVLSD 792
           Q K  +   +     K+ C + GDG ND   ++ A+VG+ + G  G   S  A   +   
Sbjct: 841 QQKADVATFIREVTGKRVCCI-GDGGNDVSMIQSADVGVGIVGKEGKQASLAADFSITQF 899

Query: 793 DNFASILNAVEEGR---RMTDNIQKFVLQL-LAENVAQALYLI 831
            + + +L  +  GR   + +  + +FV+   L  +V QA+Y I
Sbjct: 900 CHLSKLL--LWHGRNSYKRSAKLAQFVIHRGLLISVCQAVYSI 940

>Kwal_26.7070
          Length = 1315

 Score = 75.1 bits (183), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 200/923 (21%), Positives = 355/923 (38%), Gaps = 186/923 (20%)

Query: 141  INSKDVVPGDICLVKVGDTIPADLRLIETKNFDTDESLLTGESLPVSKDANLVFGKEEET 200
            +NS++ +P D+ ++   +  P  L  IET N D       GE+    K A +     E +
Sbjct: 309  VNSEEAIPADVIVIASSE--PEGLCYIETANLD-------GETNLKIKQARI-----ETS 354

Query: 201  SVGDRLNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLISRDPSK-----SW 255
               D+ +LA           +G V+    NS +     ++  +   IS  P +     + 
Sbjct: 355  KFIDKDDLA---------GMRGKVLSEHPNSSLYTYEGTMNLNGKNISLSPEQMVLRGAT 405

Query: 256  LQNT-WI---------STKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAIIVMASQ 305
            L+NT WI          TK +  A       T + R ++   V LF + ++ A+I     
Sbjct: 406  LRNTAWIYGLVVFTGHETKLMRNATATPIKRTAVERVINMQIVALFGVLIVLALISSIGN 465

Query: 306  KFDVD---------------------KRVAIYAICVALSMIPSSLVVVLTITMSVGAAVM 344
               V                      K +  Y I  + +++P SL V + +     A ++
Sbjct: 466  VIKVTSDAEHLTYLYLQGTNKVGLFFKDILTYWILFS-NLVPISLFVTVEMIKYYQAYMI 524

Query: 345  VS----------RNVIVRKLDSLEALGAVNDICSDKTGTLTQGKMLARQIWIPRFGTITI 394
             S             +VR    +E LG +  I SDKTGTLT+  M         F + +I
Sbjct: 525  ASDLDLYDEASDSPTVVRTSSLVEELGQIEYIFSDKTGTLTRNVM--------EFKSCSI 576

Query: 395  SNSDDPFNPNEGNVSLIPRFSPYEYSHNEDG-DVGI--LQNFKDRLYEKDLPEDIDMDLF 451
            +         +  +  IP       +  EDG ++G     + K+ L +   P+   ++ F
Sbjct: 577  AG--------KCYIETIPEDKA---ATTEDGIEIGFRKFDSMKETLNDTQDPDSHIINDF 625

Query: 452  QKWLETATLANIATVFKDDATDCWKAHGDPTEIAIQVFATKMDLPHNALTGEKSTNQSNE 511
               L  AT   +   F++D +  ++A   P E A+   A  +        G K   +   
Sbjct: 626  LTLL--ATCHTVIPEFQEDGSIKYQA-ASPDEGALVEGAASL--------GYKFIIR-KP 673

Query: 512  NDQSSLSQHNEKPGSAQFEHIAEFPFDSTVKRMSSVYYNNHNETYNIYGKGAFESIISCC 571
            N  S L +   +    Q  +I EF  +ST KRMS+++   + E   ++ KGA   I+   
Sbjct: 674  NSVSVLIEDLGQEQEYQLLNICEF--NSTRKRMSAIFRLPNGEI-KLFCKGADTVILE-- 728

Query: 572  SSWYGKDGVKITPLTDCDVETIRKNVYSLSNEGLRVLGFASKSFTKDQVN---------- 621
                     ++    +  +E   +++   + EGLR L  AS++ T+ +            
Sbjct: 729  ---------RLKAGENPYIEATLRHLEDYAAEGLRTLCLASRTVTESEYAEWKDIYDAAS 779

Query: 622  ---DDQLKNITSNRATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVG 678
               DD+ + +       E DL  LG   I D  ++     +     AGI V +LTGD   
Sbjct: 780  TTLDDRAQKLDDAAELIEKDLFLLGATAIEDKLQDGVPETIHTLQDAGIKVWVLTGDRQE 839

Query: 679  TAKAIAQEVGILPTNL--------------------------YHYSQEIVDS--MVMTGS 710
            TA  I     +L  ++                          +  SQ+ ++S  +V+ G 
Sbjct: 840  TAVNIGMSCRLLSEDMNLLIINEEDKEATRKNLTEKLKAISDHQISQQDMNSLALVIDGK 899

Query: 711  QFDGLSEEEVDDLPVL------PLVIARCSPQTKVRMIEALHRRKKFCTMT-GDGVNDSP 763
                  E +++D  +        ++  R SP  K  +++ + R+     +  GDG ND  
Sbjct: 900  SLGFALEADLEDYLLAIGKLCKAVICCRVSPLQKALVVKMVKRKTDSLLLAIGDGANDVS 959

Query: 764  SLKMANVGIAM-GINGSDVSKEASDIVLSDDNFASILNAVEEGRRMTDNIQKFVLQLLAE 822
             ++ A+VG+ + G+ G   ++ A D  ++   +   L  V  G      I + +L    +
Sbjct: 960  MIQAAHVGVGISGMEGMQAARSA-DFAIAQFKYLKKLLLV-HGSWSYQRISQAILYSFYK 1017

Query: 823  NVAQALYLI-IGLVFRDE-NGKSVFPLSPVEVLWIIVVTSCFP-AMGLGLEKAAPDLMDR 879
            N+  ALY+     VF +  +G+S+   S     + +  T   P  MG+  +  +  L+DR
Sbjct: 1018 NI--ALYMTQFWYVFANAYSGQSIME-SWTMTFYNVFFTVLPPFVMGVFDQFVSSRLLDR 1074

Query: 880  PPHDSEVG---------IFTWEVIIDTFAY-GIIMTGSCMASFTGSLYGINSGRLGHDCD 929
             P   ++G         IF W  +I+ F +  +   GS +    G++   +     H   
Sbjct: 1075 YPQLYKLGQRGQFFSVRIF-WGWVINGFYHSAVTFIGSTLFYRNGNVLNSHGETADHWAW 1133

Query: 930  GTYNSSCRDVYRSRSAAFATMTW 952
            G    +C  +     AA  T  W
Sbjct: 1134 GVSIYTCSVIIVIGKAALVTNQW 1156

>YEL031W (SPF1) [1394] chr5 (90258..93905) Putative
           Ca2+-transporting ATPase, member of the P-type ATPase
           superfamily of membrane transporters [3648 bp, 1215 aa]
          Length = 1215

 Score = 74.3 bits (181), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 82/297 (27%), Positives = 124/297 (41%), Gaps = 61/297 (20%)

Query: 521 NEKPGSAQFEHIAEFPFDSTVKRMSSVYYNNHNETYNIYGKGAFESIISCCSSWYGKDGV 580
           N + G+ + + I  F F S +KR +S+   +HN+      KGA E+I    S        
Sbjct: 566 NYREGTGKLDIIRRFQFSSALKRSASI--ASHNDALFAAVKGAPETIRERLS-------- 615

Query: 581 KITPLTDCDVETIRKNVY-SLSNEGLRVLGFASKSFTK-DQVNDDQLKNITSNRATAESD 638
                   D+      +Y S +  G RVL  ASKS  K  Q   D L     NR   ES+
Sbjct: 616 --------DIPKNYDEIYKSFTRSGSRVLALASKSLPKMSQSKIDDL-----NRDDVESE 662

Query: 639 LVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPTN----- 693
           L F G +  + P +++    +K  +++     M+TGD   TA  +A+EVGI+        
Sbjct: 663 LTFNGFLIFHCPLKDDAIETIKMLNESSHRSIMITGDNPLTAVHVAKEVGIVFGETLILD 722

Query: 694 ----------LYHYSQEIVD-------------------SMVMTGSQFDGLS-EEEVDDL 723
                     L+   +E V                     + +TG   + L    ++ DL
Sbjct: 723 RAGKSDDNQLLFRDVEETVSIPFDPSKDTFDHSKLFDRYDIAVTGYALNALEGHSQLRDL 782

Query: 724 PVLPLVIARCSPQTKVRMIEALHRRKKFCTMTGDGVNDSPSLKMANVGIAMGINGSD 780
                V AR SP  K  ++  L        M GDG ND  +LK A+VGIA+ +NG++
Sbjct: 783 LRHTWVYARVSPSQKEFLLNTLKDMGYQTLMCGDGTNDVGALKQAHVGIAL-LNGTE 838

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 54/267 (20%), Positives = 112/267 (41%), Gaps = 52/267 (19%)

Query: 131 HVIRNGKSETINSKDVVPGDICLVKVGDT-----IPADLRLIETKNFDTDESLLTGESLP 185
           +V RN K   + + +++P D  LV +  T     IP DL L++      +E++L+GES P
Sbjct: 257 NVFRNKKWVALQTNELLPMD--LVSITRTAEESAIPCDLILLDGSAI-VNEAMLSGESTP 313

Query: 186 VSKDANLVFGKEEETSVG--DRLNLAFSSSAVVK---------------GRAKGIVIKTA 228
           + K++  +   E+   +   D++ +    +  ++               G A  IV KT 
Sbjct: 314 LLKESIKLRPSEDNLQLDGVDKIAVLHGGTKALQVTPPEHKSDIPPPPDGGALAIVTKTG 373

Query: 229 LNSEIGKIAKSLQGDSGLISRDPSKSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAV 288
             +  G + + +   +  +S D  ++ +             F+              L +
Sbjct: 374 FETSQGSLVRVMIYSAERVSVDNKEALM-------------FI--------------LFL 406

Query: 289 LLFWIAVLFAIIVMASQKFDVDKRVAIYAICVALSMIPSSLVVVLTITMSVGAAVMVSRN 348
           L+F +   + + V  ++   +  ++ +  I +  S++P  L + LT+ ++   A +    
Sbjct: 407 LIFAVIASWYVWVEGTKMGRIQSKLILDCILIITSVVPPELPMELTMAVNSSLAALAKFY 466

Query: 349 VIVRKLDSLEALGAVNDICSDKTGTLT 375
           V   +   +   G ++  C DKTGTLT
Sbjct: 467 VYCTEPFRIPFAGRIDVCCFDKTGTLT 493

>KLLA0B08217g complement(724364..728683) similar to sp|Q12697
            Saccharomyces cerevisiae YOR291w, start by similarity
          Length = 1439

 Score = 73.2 bits (178), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 78/321 (24%), Positives = 132/321 (41%), Gaps = 70/321 (21%)

Query: 532  IAEFPFDSTVKRMSSVYYNNHNETYNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDVE 591
            I  F F S ++RMS +       TY  + KGA E I   C+                   
Sbjct: 904  IRSFEFLSELRRMSVIVKGFKENTYWSFTKGAPEVIADICNP-----------------A 946

Query: 592  TIRKNVYSL----SNEGLRVLGFASKSFTKDQVNDDQLKNITSNRATAESDLVFLGLIGI 647
            TI K+ + L    ++ G R++  A K+  K       L +   +R   E +L FLG I  
Sbjct: 947  TIPKDFHELLHHYTHNGFRIIACAGKTLPKSS----WLYSQKVSREEVEDNLEFLGFIVF 1002

Query: 648  YDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPT----------NL--- 694
             +  ++ T  A+K+   A I   M TGD V TA ++ ++ G++ +          NL   
Sbjct: 1003 ENKLKSRTKAALKELQNANIRTVMCTGDNVLTAVSVGRDSGLISSERVFIPFLNDNLEES 1062

Query: 695  -YHYSQEIVD---------------------SMVMTGSQF-------DGLSEEEVDDLPV 725
             +  S   VD                     ++ +TG  F       + L ++ +  + +
Sbjct: 1063 RHLLSWRDVDEEGSVLDAVTLKPLNDPEKSYTLAITGDIFRILFRNDEILPDDYISTVLM 1122

Query: 726  LPLVIARCSPQTKVRMIEALHRRKKFCTMTGDGVNDSPSLKMANVGIAMGINGSDVSKEA 785
               + AR SP  K  ++E L +        GDG ND  +LK AN+GI++    + V+   
Sbjct: 1123 KGSIYARMSPDEKHELVEQLQKLDYNVGFCGDGANDCGALKAANIGISLSEAEASVAAPF 1182

Query: 786  SDIVLSDDNFASILNAVEEGR 806
            +  V    + + +L+ ++EGR
Sbjct: 1183 TSAVF---DISCVLDVIKEGR 1200

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 74/301 (24%), Positives = 126/301 (41%), Gaps = 57/301 (18%)

Query: 99  FVIAVNVLIGLVQEYKATKTMNSLKNLSSPNA--HVIRNGKSETINSKDVVPGDICLVKV 156
           F+I+V  +I  V E K  K    L ++S  N    V ++     +NS D+VPGD  L ++
Sbjct: 509 FLISVLSIIDTVIETK--KNSEKLADISHFNCEVRVYKDRFWTQVNSSDLVPGD--LFEI 564

Query: 157 GD----TIPADLRLIETKNFDTDESLLTGESLPVSKDAN--------LVFGKEEETSVGD 204
            D     +P D  LI + +   +ES+LTGES+PVSK A         L   K  + S   
Sbjct: 565 SDPSLVVLPCDAVLI-SGDCIVNESMLTGESVPVSKYAATEATMAQLLQDFKSSQVSSFV 623

Query: 205 RLNLAFSSSAVVK-------GRAKGIVIKTALNSEIGKIAKSLQGDSGLISRDPSKSWLQ 257
             +  F+ + +++       G A  +VI+T  ++  G + +S+                 
Sbjct: 624 SKSFLFNGTKIIRVRNQPGQGMALALVIRTGFSTTKGSLVRSM----------------- 666

Query: 258 NTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVL-FAIIVMASQKFDVDKRVAIY 316
                            VG   +    K    +  IA+  F+I  +   +  ++ +V I 
Sbjct: 667 ------------VFPKPVGFKFYEDSFKYIGFMTLIAMFGFSISCIQFIRLGLEYKVMIL 714

Query: 317 -AICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSDKTGTLT 375
            A+ +   ++P +L   LTI  S     +  + +       +   G V+ +C DKTGTLT
Sbjct: 715 RALDIITIVVPPALPATLTIGTSFALGRLKKKGIFCISPTRVNVGGKVDMMCFDKTGTLT 774

Query: 376 Q 376
           +
Sbjct: 775 E 775

>ADR350W [2091] [Homologous to ScYAL026C (DRS2) - SH]
            complement(1320732..1324667) [3936 bp, 1311 aa]
          Length = 1311

 Score = 71.6 bits (174), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 182/881 (20%), Positives = 324/881 (36%), Gaps = 222/881 (25%)

Query: 97   ISFVIAVNVLIGLVQEYKATKTMNSLKNLSSPNAHVIRNGKSETINSK--DVVPGDICLV 154
            I  +I V V+  + +  +  K  NS K L+   A V  +   + I+ K  D+  GDI  V
Sbjct: 247  IGTLIVVLVVSAIKESVEDLKRSNSDKELNHSRADVYSDEMGQFISKKWIDIAVGDIIRV 306

Query: 155  KVGDTIPADLRL-----------IETKNFDTDESLLTGESLPVSKDANLVFGKEEETSVG 203
            +  + IPADL +           IET N D + +L   ++ P            E + + 
Sbjct: 307  RSEEAIPADLIVLSSSEPEGLCYIETANLDGETNLKIKQARP------------ETSKIL 354

Query: 204  DRLNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLISRDPSK-----SWLQN 258
            D   L+           +G ++    N+ +     ++   +  I   P +     + L+N
Sbjct: 355  DVRELS---------AMRGKILSEQPNTSLYTYEGTMILHNNRIPLSPDQILLRGATLRN 405

Query: 259  T-WI---------STKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAII-------V 301
            T WI          TK    A       T + R ++   V LF + +  ++I       V
Sbjct: 406  TVWIFGIVIFTGHETKLTRNATATPIKRTAVERVINLQIVALFGVLICLSLISSFGNLIV 465

Query: 302  MASQKFDVD--------------KRVAIYAICVALSMIPSSLVVVLTITMSVGAAVMVS- 346
            M +QK ++               K +  + I  + +++P SL V + +     A ++ S 
Sbjct: 466  MYNQKENLSYLYLQGTNMVALFFKNILTFWILFS-NLVPISLFVTVEMIKYYQAYMIASD 524

Query: 347  ---------RNVIVRKLDSLEALGAVNDICSDKTGTLTQGKMLARQIWIPRFGTITISNS 397
                        +VR    +E LG +  I SDKTGTLTQ  M         F + +I+  
Sbjct: 525  LDLFHEESNMPTVVRTSSLVEELGQIEYIFSDKTGTLTQNVM--------EFKSCSIAG- 575

Query: 398  DDPFNPNEGNVSLIPRFSPYEYSHNEDGDVGILQNFKDRLYEKDLPEDIDMDLFQKWLET 457
                                                  R Y + +PED D   F + +E 
Sbjct: 576  --------------------------------------RCYIQSIPEDKDA-AFDEGIE- 595

Query: 458  ATLANIATVFKDDATDCWKAHGDPTEIAIQVFATKMDLPHNALTGEKSTN----QSNEND 513
                 +     DD  +     G      I  F T + + H  +   +       Q+   D
Sbjct: 596  -----VGYRTYDDMHELLHTPGSGDGAIIDEFLTLLSICHTVIPEFQENGSIKYQAASPD 650

Query: 514  QSSLSQHN---------EKPGSAQ-----------FEHIAEFPFDSTVKRMSSVYYNNHN 553
            + +L Q            KP S             +E +    F+ST KRMS+++    N
Sbjct: 651  EGALVQGAADLGYKFIIRKPNSVTILREDITEEVVYELLNICEFNSTRKRMSAIFRFPDN 710

Query: 554  ETYNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDVETIRKNVYSLSNEGLRVLGFASK 613
             +  +  KGA   I+            ++   ++  V    +++   + EGLR L  AS+
Sbjct: 711  -SIRLLCKGADTVILE-----------RLAATSNPYVAATLRHLEDYAAEGLRTLCIASR 758

Query: 614  SFTKDQVND-----DQLKNITSNRATA--------ESDLVFLGLIGIYDPPRNETAGAVK 660
            +  + +  +     D       NR+          E  LV LG   I D  ++     + 
Sbjct: 759  TIPESEYEEWSKLYDAAATTMHNRSEELDKVAEMIEKGLVLLGATAIEDKLQDGVPETIH 818

Query: 661  KFHQAGINVHMLTGDFVGTA-------KAIAQEVGIL-------------------PTNL 694
               QAGI V +LTGD   TA       K +++++ +L                     N 
Sbjct: 819  TLQQAGIKVWVLTGDRQETAINIGMSCKLLSEDMNLLIVNEDTKESTRNNLIDKLRAIND 878

Query: 695  YHYSQEIVDSM--VMTGSQFDGLSEEEVDDLPVL------PLVIARCSPQTKVRMIEALH 746
            +  SQ+ ++++  V+ G       E ++++  +        ++  R SP  K  +++ + 
Sbjct: 879  HQISQQDMNTLALVIDGKSLGFALEPDLEEFLLAIGKMCRAVICCRVSPLQKALVVKMVK 938

Query: 747  RRKKFCTMT-GDGVNDSPSLKMANVGIAM-GINGSDVSKEASDIVLSDDNFASILNAVEE 804
            RR K   +  GDG ND   ++ A+VG+ + G+ G   ++ A D  L    +   L  V  
Sbjct: 939  RRTKSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSA-DFALGQFKYLKKLLLV-H 996

Query: 805  GRRMTDNIQKFVLQLLAENVAQALYLIIGLVFRDENGKSVF 845
            G      I + +L    +N+A  +     +++   +G+S+ 
Sbjct: 997  GSWSYQRISQAILYSFYKNIALYMTQFWYVLYNAFSGQSIM 1037

>KLLA0A04015g complement(355624..359655) similar to sp|P39524
           Saccharomyces cerevisiae YAL026c DRS2 P-type
           amino-phospholipids-ATPase, start by similarity
          Length = 1343

 Score = 70.9 bits (172), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 172/795 (21%), Positives = 320/795 (40%), Gaps = 160/795 (20%)

Query: 91  WITGGVISFVIAVNVLIGLVQEYKATKTMNSLKNLSSPNAHVIRNGKSETINSK--DVVP 148
           + T G +  V+ V+ +   V++ K +   N+ K L+     V+     E +  K  D+  
Sbjct: 252 YTTIGTLLVVLIVSAVKESVEDLKRS---NADKELNHSLCDVLDERSGEFVRKKWIDIAV 308

Query: 149 GDICLVKVGDTIPADLRLIETKNFDTDESLLTGESLPVSKDANLVFGKEEETSVGDRLNL 208
           GDI  V+  + IPADL ++ +      E L   E+  +  + NL   +  + +      L
Sbjct: 309 GDIIRVRSEEAIPADLIILSSSE---PEGLCYIETANLDGETNLKIKQARQETAN---YL 362

Query: 209 AFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLISRDP---SKSWLQNT-WI--- 261
              +   + GR +     ++L +  G +  +L G +  +S D      + L+NT WI   
Sbjct: 363 DEKALCKLHGRVQSEHPNSSLYTYEGTM--TLNGSTFPLSPDQMLLRGATLRNTAWIFGL 420

Query: 262 ------STKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAII-----VMASQKFDVD 310
                  TK +  A       T + R ++   + LF + ++ A+I     V+ +++    
Sbjct: 421 IVFTGHETKLMRNATATPIKRTAVERVINMQILALFGVLIVLALISSTGNVIMTKRDSAH 480

Query: 311 ----------------KRVAIYAICVALSMIPSSLVVVLTITMSVGAAVMVSRNV----- 349
                           K +  + I  + +++P SL V + + +    A M+  ++     
Sbjct: 481 LGYLYIEGTNKAGLFFKDILTFWILFS-NLVPISLFVTVEM-IKYYQAYMIGSDLDLYHE 538

Query: 350 ------IVRKLDSLEALGAVNDICSDKTGTLTQGKMLARQIWIPRFGTITISNSDDPFNP 403
                 +VR    +E LG +  I SDKTGTLT+  M         F +++I+        
Sbjct: 539 ESDTPTVVRTSSLVEELGQIEYIFSDKTGTLTRNVM--------EFKSVSIAG------- 583

Query: 404 NEGNVSLIPRFSPYEYSHNEDG-DVGI--LQNFKDRLYEKDLPEDIDMDLFQKWLET-AT 459
               +  IP       +  EDG ++G    ++ KD++ +   PED +  +  ++L   AT
Sbjct: 584 -RCYIETIPE---DRRATVEDGIEIGFHSFESLKDKMTD---PEDDEAGIVIEFLTLLAT 636

Query: 460 LANIATVFKDDATDCWKAHGDPTEIAIQVFATKMDLPHNALTGEKSTNQSNENDQSSLSQ 519
              +    + D T  ++A   P E A+   A  +    +              +  S+S 
Sbjct: 637 CHTVIPETQSDGTIKYQA-ASPDEGALVQGAADLGFRFDI----------RRPNSVSIST 685

Query: 520 HNEKPGSAQFEHIAEFPFDSTVKRMSSVYYNNHNETYNIYGKGAFESIISCCSSWYGKDG 579
              +    Q  +I EF  +ST KRMS+++    + +  ++ KGA   I+    S      
Sbjct: 686 PFSEQLEYQLLNICEF--NSTRKRMSAIF-RMPDGSIKLFCKGADTVILERLDS------ 736

Query: 580 VKITPLTDCDVETIRKNVYSLSNEGLRVLGFASKSFTKDQVND-------------DQLK 626
            +  P     V++  +++   + EGLR L  AS++  + +  +             D+ +
Sbjct: 737 -EFNPY----VQSTLRHLEDYAAEGLRTLCIASRTIPEKEYEEWSKIYEAASTTMKDRTE 791

Query: 627 NITSNRATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQE 686
            +       E DL FLG   I D  +      +    +AG+ V +LTGD   TA  I   
Sbjct: 792 ELDRAAELIEHDLFFLGATAIEDKLQEGVPETIHHLQEAGLKVWVLTGDRQETAINIGMS 851

Query: 687 VGILP-----------------TNL---------YHYSQEIVDS--MVMTGSQFDGLSEE 718
             +L                  TNL         +  SQ+ ++S  +V+ G       EE
Sbjct: 852 CRLLSEDMNLLIVNEETKEDTRTNLQSKLNAIESHQISQQDMNSLALVIDGKSLGYALEE 911

Query: 719 EVDD--LPVLPL----VIARCSPQTKVRMIEALHRRKKFCTMT-GDGVNDSPSLKMANVG 771
           +++D  L +  L    +  R SP  K  +++ + R+     +  GDG ND   ++ A+VG
Sbjct: 912 DLEDQFLTIGKLCKAVICCRVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVG 971

Query: 772 IAM-GINGSDVSKEA 785
           + + G+ G   ++ A
Sbjct: 972 VGISGMEGMQAARSA 986

>Scas_583.14*
          Length = 875

 Score = 69.7 bits (169), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 80/311 (25%), Positives = 134/311 (43%), Gaps = 57/311 (18%)

Query: 523 KPGSAQFEHIAEFPFDSTVKRMSSVYYNNHNETYNIYGKGAFESIISCCSSWYGKDGVKI 582
           +P + + + +  F F S +KR SSV   +H +      KGA E+I         ++ + +
Sbjct: 222 RPKTGKLQILRRFQFSSALKRSSSV--ASHKDKLFTAVKGAPETI---------RERLAV 270

Query: 583 TPLTDCDVETIRKNVYSLSNEGLRVLGFASKSFTKDQVNDDQLKNITSNRATAESDLVFL 642
            P    + + I K   S +  G RVL  ASKS     ++  QL ++  +R   E+ L F 
Sbjct: 271 VP---KNYDEIYK---SFTRSGSRVLALASKSLP--NLSSKQLDDL--DRDEIETGLTFN 320

Query: 643 GLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGIL------------ 690
           G +  + P + +    +K  +++     M+TGD   TA  +A+EV I+            
Sbjct: 321 GFLVFHCPLKPDAVETIKMLNESAHRSIMITGDNPLTAVHVAKEVAIVTGETLILDKSET 380

Query: 691 --------------------PTNLYHYSQEIVDS--MVMTGSQFDGLSEE-EVDDLPVLP 727
                               P +     +E+ D   + +TG   + L +  ++ DL    
Sbjct: 381 VGDGKLLFFNVEETIKIPFDPASDKFDHRELFDKYDIAVTGYALNLLEDHSQLKDLIRHT 440

Query: 728 LVIARCSPQTKVRMIEALHRRKKFCTMTGDGVNDSPSLKMANVGIAMGINGSDVSKEASD 787
            V AR SP  K  ++  L        M GDG ND  +LK A+VG+A+ +NG++ S  A  
Sbjct: 441 WVYARVSPSQKEFILNNLKEMGYQTLMCGDGTNDVGALKQAHVGVAL-LNGTEESMTAMA 499

Query: 788 IVLSDDNFASI 798
               D+N  S+
Sbjct: 500 QKRRDENMKSM 510

>YBR295W (PCA1) [472] chr2 (792805..796455) P-type
           copper-transporting ATPase, involved in resistance to
           cadmium [3651 bp, 1216 aa]
          Length = 1216

 Score = 67.0 bits (162), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 75/294 (25%), Positives = 131/294 (44%), Gaps = 48/294 (16%)

Query: 93  TGGVISFVIAVNVLIGLVQEYKATKTMNSLKNLSSPNAHVI-RNGKSETINSKDVVPGDI 151
           T  ++  +I V   +  +  ++A K++ S+++L + +A ++ + GK   IN + +  GDI
Sbjct: 661 TSSLLVTLIMVGRFVSELARHRAVKSI-SVRSLQASSAILVDKTGKETEINIRLLQYGDI 719

Query: 152 CLVKVGDTIPADLRLIETKNFDTDESLLTGESLPVSKDANLVFGKEEETSVGDRLNLAFS 211
             V     IP D  +I + + + DE+L+TGES+PV K                       
Sbjct: 720 FKVLPDSRIPTDGTVI-SGSSEVDEALITGESMPVPKKCQ-------------------- 758

Query: 212 SSAVVKGRAKGI------VIKTALNSEIGKIAKSLQGDSGLISRDPSKSWLQNTWISTKK 265
            S VV G   G       + K   N+ I  IA ++  ++ L     +K  +QN      K
Sbjct: 759 -SIVVAGSVNGTGTLFVKLSKLPGNNTISTIA-TMVDEAKL-----TKPKIQNI---ADK 808

Query: 266 VTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAIIVMASQKFDVDKRVAIYAICVALSMI 325
           +   F+ T +G         + V+ F + +   I V    + D   +  IYAI V +   
Sbjct: 809 IASYFVPTIIG---------ITVVTFCVWIAVGIRVEKQSRSDAVIQAIIYAITVLIVSC 859

Query: 326 PSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSDKTGTLTQGKM 379
           P  + + + I   + + V   R VI +  +S+E     + +  DKTGTLT+GK+
Sbjct: 860 PCVIGLAVPIVFVIASGVAAKRGVIFKSAESIEVAHNTSHVVFDKTGTLTEGKL 913

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 41/163 (25%), Positives = 73/163 (44%), Gaps = 38/163 (23%)

Query: 646  GIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPTNLYHY------SQ 699
             + D  R +    +    Q GI++H+L+GD  G  +++A  +GI  +N+  +      S+
Sbjct: 1021 ALEDSLRADAVSTINLLRQRGISLHILSGDDDGAVRSMAARLGIESSNIRSHATPAEKSE 1080

Query: 700  EIVDSMVMTGSQFDGLSEEEVDDLPVLPLVIARCSPQTKVRMIEALHRRKKFCTMTGDGV 759
             I D  ++ G   D  S+ +       P+V+                    FC   GDG 
Sbjct: 1081 YIKD--IVEGRNCDSSSQSK------RPVVV--------------------FC---GDGT 1109

Query: 760  NDSPSLKMANVGIAMGINGSDVSKEASDIVLSDDNFASILNAV 802
            ND+  L  A +G+ +   GS+V+K A+D+V+      +IL  +
Sbjct: 1110 NDAIGLTQATIGVHIN-EGSEVAKLAADVVMLKPKLNNILTMI 1151

>AFR354C [3546] [Homologous to ScYEL031W (SPF1) - SH]
           (1078275..1081907) [3633 bp, 1210 aa]
          Length = 1210

 Score = 66.6 bits (161), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 82/299 (27%), Positives = 128/299 (42%), Gaps = 61/299 (20%)

Query: 518 SQHNEKPGSAQFEHIAEFPFDSTVKRMSSVYYNNHNETYNIYGKGAFESIISCCSSWYGK 577
           S  NEK G      +  F F S +KR S++    HN+ +    KGA E+I         +
Sbjct: 566 SLSNEKVGDISI--LRRFQFSSALKRSSTIAV--HNKQHYSAVKGAPETI---------R 612

Query: 578 DGVKITPLTDCDVETIRKNVY-SLSNEGLRVLGFASKSFTKDQVNDDQLKNITSNRATAE 636
           + +   P TD D       VY S +  G RVL  ASK      +   Q++ +   R   E
Sbjct: 613 ERLSQVP-TDYD------QVYKSFTRAGSRVLALASKKLPSMSIK--QIEKL--EREAVE 661

Query: 637 SDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGIL------ 690
           SDL F G +  + P +++    +K  +++     M+TGD   TA  +A+EV I+      
Sbjct: 662 SDLEFKGFLVFHCPLKDDAIETIKMLNESSHRCIMITGDNPLTAVHVAKEVAIVERETLI 721

Query: 691 -----------------------PTN----LYHYSQEIVD-SMVMTGSQFDGLS-EEEVD 721
                                  P N     + +S+      + +TG     LS   +++
Sbjct: 722 LDEPIDGSSHALVFRNIEETIVNPFNPEKDTFEHSKLFAKYDIAVTGHALQLLSGHSQLN 781

Query: 722 DLPVLPLVIARCSPQTKVRMIEALHRRKKFCTMTGDGVNDSPSLKMANVGIAMGINGSD 780
           +L     V AR SP  K  ++ +L        M GDG ND  +LK A+VGIA+ +NG++
Sbjct: 782 ELIRHTWVYARVSPAQKEFIMNSLKDMGYQTLMCGDGTNDVGALKQAHVGIAL-LNGTE 839

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 58/252 (23%), Positives = 115/252 (45%), Gaps = 21/252 (8%)

Query: 131 HVIRNGKSETINSKDVVPGDICLVKVGD---TIPADLRLIETKNFDTDESLLTGESLPVS 187
           +V R+ K + + + +++P D+  V   D    +  D+ L++      +E++L+GES P+ 
Sbjct: 257 NVFRDSKWQLLQTNELLPMDLISVTRTDEDSALSCDMILVDGTCI-VNEAMLSGESTPLL 315

Query: 188 KDANLVFGKEEETSVGDRLNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLI 247
           K++  +   EE+  V          ++V+ G  K + +           A    G   ++
Sbjct: 316 KESVKLRSSEEKLQVE-----GLDKNSVLHGGTKVLQVTAPEKGSSSIPAPPDGGALAVV 370

Query: 248 SR---DPSKSWLQNTWI-STKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAIIVMA 303
           S+   + S+  L    I S+++V+       VG         L +L+F IA  + + V  
Sbjct: 371 SKTGFETSQGALVRVMIYSSERVS-------VGNK-EALYFILFLLIFAIAASWYVWVEG 422

Query: 304 SQKFDVDKRVAIYAICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAV 363
           ++   V  ++ +  I +  S++PS L + LT+ ++   AV+    V   +   +   G +
Sbjct: 423 TRMGRVQSKLILDCILIITSVVPSELPMELTMAVNNSLAVLSKFYVYCTEPFRIPLAGRI 482

Query: 364 NDICSDKTGTLT 375
           +  C DKTGTLT
Sbjct: 483 DVCCFDKTGTLT 494

>CAGL0G06270g 598357..602343 highly similar to sp|P39524
           Saccharomyces cerevisiae YAL026c DRS2, start by
           similarity
          Length = 1328

 Score = 64.3 bits (155), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 171/805 (21%), Positives = 303/805 (37%), Gaps = 181/805 (22%)

Query: 91  WITGGVISFVIAVNVLIGLVQEYKATKTMNSLKNLSSPNAHVIRNGKSETINSK--DVVP 148
           + T G +  V+ V+ +   V++ K   + N L N     A +    + + I  +  D+  
Sbjct: 231 YTTIGTLMVVLIVSAIKESVEDLKRASSDNELNN---SKAEIYFEAEGDFIQKRWIDIKV 287

Query: 149 GDICLVKVGDTIPADLRLIETKNFDTDESLLTGESLPVSKDANLVF--GKEEETSVGDRL 206
           GDI  V   + IPAD+ ++ +      E L   E+  +  + NL     + E   + D  
Sbjct: 288 GDIIRVNSEEPIPADIIILSSSE---PEGLCYIETANLDGETNLKIKQARTETAKIMDSR 344

Query: 207 NLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLISRDPSKSWLQNTWISTKKV 266
            L            KG++     NS +     +L+ +   I   P +  L+    +T + 
Sbjct: 345 ELR---------NIKGVISSEQPNSSLYTYEGTLEMNGTKIPLSPEQMILRG---ATLRN 392

Query: 267 TGAFLGTNVGTPLHRKLSKLA------------VLLFWIAVLFAIIVMASQKFDVDKRVA 314
           TG   G  + T    KL + A            V+   I  LF ++V+      +   + 
Sbjct: 393 TGWIFGIVIFTGHETKLMRNATATPIKRTAVEKVINMQIIALFTVLVVLILISSIGNVIM 452

Query: 315 IYAICVALS--------------------------MIPSSLVVVLTITMSVGAAVMVSRN 348
             A    LS                          ++P SL V + + +    A M+  +
Sbjct: 453 STADAKHLSYLYLQGTNKAGLFFKDFLTFWILFSNLVPISLFVTVEL-IKYYQAFMIGSD 511

Query: 349 V-----------IVRKLDSLEALGAVNDICSDKTGTLTQGKMLARQIWIPRFGTITISNS 397
           +           +V+    +E LG +  I SDKTGTLT+  M         F + +I+  
Sbjct: 512 LDLYYEETDTPTVVKTSSLVEELGQIEYIFSDKTGTLTRNIM--------EFKSCSIAG- 562

Query: 398 DDPFNPNEGNVSLIPRFSPYEYSHNEDG-DVGILQNFKDRLYEKDLPEDID----MDLFQ 452
                        IP      +   EDG +VG  ++F D   +K L  + D    +D F 
Sbjct: 563 -------RCYAEHIPEDKAATF---EDGIEVG-YRSFDD--LKKQLTTNSDDCKIIDEFL 609

Query: 453 KWLETATLANIATVFKDDATDCWKAHGDPTEIAIQVFATKMDLPHNALTGEKSTNQSNEN 512
             L  AT   +   F+ D +  ++A   P E A+        +   AL G K   +   +
Sbjct: 610 TLL--ATCHTVIPEFQADGSIKYQA-ASPDEGAL--------VEGGALLGYKFLIRKPNS 658

Query: 513 DQSSLSQHNEKPGSAQFEHIAEFPFDSTVKRMSSVYYNNHNETYNIYGKGAFESIISCCS 572
               +++  E+    Q  +I EF  +ST KRMS+++            +   +SI   C 
Sbjct: 659 VTILINEEEER--EYQLLNICEF--NSTRKRMSAIF------------RFPDDSIKLLCK 702

Query: 573 SWYGKDGVKITPLTDCD---VETIRKNVYSLSNEGLRVLGFASKSFTKDQVN-------- 621
              G D V +  L++     V+   +++   + EGLR L  A+K   +D+ N        
Sbjct: 703 ---GADSVILERLSETGNFYVDATTRHLEDYATEGLRTLCLATKDIPEDEYNAWNKKYMD 759

Query: 622 -----DDQLKNITSNRATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDF 676
                D + + + +     ES L  +G   I D  +      ++   +AGI + +LTGD 
Sbjct: 760 AATTLDHRAEKLDAVAEEIESGLTLIGATAIEDKLQEGVPDTIRTLQEAGIKIWVLTGDK 819

Query: 677 VGTAKAIAQEVGILP--TNLYHYSQEIVDSM------VMTGSQFDGLSEEEVDDLPVL-- 726
             TA  I     +L    NL   S+E  ++        +       LSE +++ L ++  
Sbjct: 820 QETAINIGMSCRLLSEDMNLLIISEETKEATRRNMEEKLAALHEHSLSEHDMNTLALVID 879

Query: 727 ------------------------PLVIARCSPQTKVRMIEALHRRKKFCTMT-GDGVND 761
                                    ++  R SP  K  +++ + R+     +  GDG ND
Sbjct: 880 GHSLSFALEADLEDYFLAIGKMCKAVICCRVSPLQKALVVKMVKRKTNSLLLAIGDGAND 939

Query: 762 SPSLKMANVGIAM-GINGSDVSKEA 785
              ++ A+VG+ + G+ G   ++ A
Sbjct: 940 VSMIQAAHVGVGISGMEGMQAARSA 964

>CAGL0L01419g 156123..159767 highly similar to sp|P39986
           Saccharomyces cerevisiae YEL031w SPF1 P-type ATPase,
           hypothetical start
          Length = 1214

 Score = 63.9 bits (154), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 68/278 (24%), Positives = 116/278 (41%), Gaps = 52/278 (18%)

Query: 549 YNNHNETYNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDVETIRKNVY---------- 598
           +N  N    I  +  F S +   SS    DG K+        ETIR+ ++          
Sbjct: 565 FNEKNGQVTILRRFQFSSALKRSSSVATHDG-KLYSAVKGAPETIRERLFTIPANYDEIY 623

Query: 599 -SLSNEGLRVLGFASKSFTKDQVNDDQLKNITSNRATAESDLVFLGLIGIYDPPRNETAG 657
            S +  G RVL  ASK   K  ++  Q+++  ++R   E DL F G +  + P +++   
Sbjct: 624 KSFTRSGSRVLALASKKLEK--MSQSQIED--ADREHFERDLEFNGFLIFHCPLKHDAIE 679

Query: 658 AVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPTN---------------LYHYSQEIV 702
            ++  +++     M+TGD   TA  +A+EVGI+                  ++   +E +
Sbjct: 680 TIQMLNESAHRCVMITGDNPLTAVHVAKEVGIVKGETLIVDMVDNGNDDKLVFRNVEETL 739

Query: 703 D-------------------SMVMTGSQFDGLS-EEEVDDLPVLPLVIARCSPQTKVRMI 742
                                + +TG   + L    ++ DL     + AR SP  K  ++
Sbjct: 740 SFEFVVSKDSFEKYGIFDKYDLAVTGHALEALKGHHQLQDLIRHAWIYARVSPAQKEFIL 799

Query: 743 EALHRRKKFCTMTGDGVNDSPSLKMANVGIAMGINGSD 780
             L        M GDG ND  +LK A+VG+A+ +NG++
Sbjct: 800 NNLKDMGYQTLMCGDGTNDVGALKQAHVGVAL-LNGTE 836

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 56/250 (22%), Positives = 116/250 (46%), Gaps = 18/250 (7%)

Query: 131 HVIRNGKSETINSKDVVPGDIC-LVKVGD--TIPADLRLIETKNFDTDESLLTGESLPVS 187
           +V+R+GK   + + +++P D+  +V+  +   +P DL L++      +E++L+GES P+ 
Sbjct: 255 NVLRDGKWVEMQTNELLPMDVVSVVRTAEDSALPCDLILVDGTCI-VNEAMLSGESTPLL 313

Query: 188 KDA-NLVFGKEEETSVG-DRLNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGDSG 245
           K++  L  G EE    G D++       +V+ G  K  V++     + GK+     G + 
Sbjct: 314 KESIRLRPGNEELQIEGTDKI-------SVLHGGTK--VLQVTTPEKTGKVPSPPDGGAI 364

Query: 246 LISRDPSKSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAIIVMASQ 305
            I         Q + +     +   +G +    L+     L +L+F +   + + V  ++
Sbjct: 365 AIVTKTGFETSQGSLVRVMIYSSERVGVDNKEALY---FILFLLIFAVVASWYVWVEGTK 421

Query: 306 KFDVDKRVAIYAICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVND 365
              V  ++ +  I +  S++P  L + LT+ ++   + +    V   +   +   G ++ 
Sbjct: 422 MGRVQSKLILDCILIITSVVPPELPMELTMAVNSSLSALSKFYVYCTEPFRIPFAGRIDV 481

Query: 366 ICSDKTGTLT 375
            C DKTGTLT
Sbjct: 482 CCFDKTGTLT 491

>YAL026C (DRS2) [42] chr1 complement(95633..99700) Membrane-spanning
           Ca-ATPase (P-type) required for ribosome assembly and
           involved in late Golgi function, member of the cation
           transporting (E1-E2) P-type ATPase superfamily [4068 bp,
           1355 aa]
          Length = 1355

 Score = 60.5 bits (145), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 169/806 (20%), Positives = 309/806 (38%), Gaps = 162/806 (20%)

Query: 91  WITGGVISFVIAVNVLIGLVQEYKATKTMNSLKNLSSPNAHVIRNGKSETINSK--DVVP 148
           + T G +  V+ V+ +   +++    K  NS K L++  A +      + +  +  D+  
Sbjct: 248 YTTIGTLLVVLIVSAMKECIED---IKRANSDKELNNSTAEIFSEAHDDFVEKRWIDIRV 304

Query: 149 GDICLVKVGDTIPADLRLIETKNFDTDESLLTGESLPVSKDANLVFGKEEETSVGDRLNL 208
           GDI  VK  + IPAD  ++ +      E L   E+  +  + NL   +        R+  
Sbjct: 305 GDIIRVKSEEPIPADTIILSSSE---PEGLCYIETANLDGETNLKIKQS-------RVET 354

Query: 209 AFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLISRDPSK-----SWLQNT-WIS 262
           A            G V+    NS +     ++  +   I   P +     + L+NT WI 
Sbjct: 355 AKFIDVKTLKNMNGKVVSEQPNSSLYTYEGTMTLNDRQIPLSPDQMILRGATLRNTAWIF 414

Query: 263 TKKV-TG---AFLGTNVGTPLHRK-----LSKLAVLLFWIAVLFAII------VMASQKF 307
              + TG     L     TP+ R      +++  + LF + ++  +I      +M++   
Sbjct: 415 GLVIFTGHETKLLRNATATPIKRTAVEKIINRQIIRLFTVLIVLILISSIGNVIMSTA-- 472

Query: 308 DVDKRVAIY---------------AICVALS-MIPSSLVVVLTITMSVGAAVMVSRNV-- 349
           D      +Y                  +  S ++P SL V + + +    A M+  ++  
Sbjct: 473 DAKHLSYLYLEGTNKAGLFFKDFLTFWILFSNLVPISLFVTVEL-IKYYQAFMIGSDLDL 531

Query: 350 ---------IVRKLDSLEALGAVNDICSDKTGTLTQGKMLARQIWIPRFGTITISNSDDP 400
                    +VR    +E LG +  I SDKTGTLT+  M         F + +I+     
Sbjct: 532 YYEKTDTPTVVRTSSLVEELGQIEYIFSDKTGTLTRNIM--------EFKSCSIAGH--- 580

Query: 401 FNPNEGNVSLIPRFSPYEYSHNEDG-DVGILQNFKDRLYEKDLPEDIDMDLFQKWLET-A 458
                     I +    + +  EDG +VG  + F D   + + P D D  +   +L   A
Sbjct: 581 --------CYIDKIPEDKTATVEDGIEVG-YRKFDDLKKKLNDPSDEDSPIINDFLTLLA 631

Query: 459 TLANIATVFKDDATDCWKAHGDPTEIAIQVFATKMDLPHNALTGEKSTNQSNENDQSSLS 518
           T   +   F+ D +  ++A   P E A+       DL +  +  +        N  + L 
Sbjct: 632 TCHTVIPEFQSDGSIKYQA-ASPDEGAL--VQGGADLGYKFIIRKG-------NSVTVLL 681

Query: 519 QHNEKPGSAQFEHIAEFPFDSTVKRMSSVYYNNHNETYNIYGKGAFESIISCCSSWYGKD 578
           +   +    Q  +I EF  +ST KRMS+++    + +  ++ KGA   I+          
Sbjct: 682 EETGEEKEYQLLNICEF--NSTRKRMSAIF-RFPDGSIKLFCKGADTVILE--------- 729

Query: 579 GVKITPLTDCDVETIRKNVYSLSNEGLRVLGFASKSFTKDQVND-----DQLKNITSNRA 633
             ++    +  VE   +++   ++EGLR L  A +  ++ +  +     ++      NRA
Sbjct: 730 --RLDDEANQYVEATMRHLEDYASEGLRTLCLAMRDISEGEYEEWNSIYNEAATTLDNRA 787

Query: 634 TA--------ESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQ 685
                     E +L+ +G   I D  ++     +    +AGI + +LTGD   TA  I  
Sbjct: 788 EKLDEAANLIEKNLILIGATAIEDKLQDGVPETIHTLQEAGIKIWVLTGDRQETAINIGM 847

Query: 686 EVGILP--TNLYHYSQEIVD--------------------------SMVMTGSQFDGLSE 717
              +L    NL   ++E  D                          ++V+ G       E
Sbjct: 848 SCRLLSEDMNLLIINEETRDDTERNLLEKINALNEHQLSTHDMKSLALVIDGKSLGFALE 907

Query: 718 EEVDD--LPVLPL----VIARCSPQTKVRMIEALHRRKKFCTMT-GDGVNDSPSLKMANV 770
            E++D  L V  L    +  R SP  K  +++ + R+     +    G ND   ++ A+V
Sbjct: 908 PELEDYLLTVAKLCKAVICCRVSPLQKALVVKMVKRKSSSLLLAIASGANDVSMIQAAHV 967

Query: 771 GIAM-GINGSDVSKEASDIVLSDDNF 795
           G+ + G+ G   ++ A DI L    F
Sbjct: 968 GVGISGMEGMQAARSA-DIALGQFKF 992

>Scas_89.1
          Length = 271

 Score = 56.2 bits (134), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 54/178 (30%), Positives = 86/178 (48%), Gaps = 33/178 (18%)

Query: 636 ESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPTNLY 695
           E +L  LGL G+ D  +N+   +++    AG+ + MLTGD V TA+ ++    ++    Y
Sbjct: 32  EHNLELLGLTGVEDKLQNDVKSSIELLRNAGVKIWMLTGDKVETARCVSISAKLISRGQY 91

Query: 696 -----------------HYSQEIVDSMVMTGSQFDGL----SEEEVDDLPV-LPLVIA-R 732
                             Y +    S ++   +  G+     ++E  D+ V LP VIA R
Sbjct: 92  VHTVTKLSRPEGALNALEYLKINKSSCLLIDGESLGMFLTYYKQEFFDIVVDLPAVIACR 151

Query: 733 CSPQTKVRMIEALHRR----KKFCTMTGDGVNDSPSLKMANVGIAMGINGSDVSKEAS 786
           C+PQ K  +  AL  R    K+ C + GDG ND   ++ A+VG+  GI G +  K+AS
Sbjct: 152 CTPQQKADV--ALLIREITGKRVCCI-GDGGNDVSMIQCADVGV--GIVGKE-GKQAS 203

>Scas_615.9
          Length = 942

 Score = 57.0 bits (136), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 44/174 (25%), Positives = 74/174 (42%), Gaps = 43/174 (24%)

Query: 618 DQVNDDQLKNITSNRATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFV 677
           D  +DD  K+  S   T       +G   I D  + + A  ++       +++M+TGD  
Sbjct: 677 DNTSDDFTKSYVSINDT------LVGKFEIRDSVKEDVADIIQYLQGLHYDIYMVTGDSH 730

Query: 678 GTAKAIAQEVGILPTNLYHYSQEIVDSMVMTGSQFDGLSEEEVDDLPVLPLVIARCSPQT 737
           G A  +AQ+VGI   N+Y                                   +  +P  
Sbjct: 731 GAAMKVAQQVGIAANNVY-----------------------------------SGVTPSG 755

Query: 738 KVRMIEALHRRK-KFCTMTGDGVNDSPSLKMANVGIAMGINGSDVSKEASDIVL 790
           K  ++E+L           GDG+NDSP L  +++G+A+   G+D++ EA+DIV+
Sbjct: 756 KCEIVESLQADSVGGVAFVGDGINDSPVLVTSDIGVALS-TGTDIAMEAADIVV 808

 Score = 47.4 bits (111), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 72/258 (27%), Positives = 109/258 (42%), Gaps = 43/258 (16%)

Query: 150 DICLVKVGDTIPADLRLIETKNFDTDESLLTGESLPVSKDANLVFGKEEETSVGDRLNLA 209
           DI  +K G  IPAD  +I+ ++ + DESL+TGES+ V K                     
Sbjct: 383 DIIEIKPGMKIPADGIIIQGES-EIDESLMTGESILVHKQ-------------------- 421

Query: 210 FSSSAVVKG--RAKGIVIKTALNSEIGKIAKSLQGDSGLISRDPSKSWLQNTWISTKKVT 267
              S V+ G     G     A+N  IG   K  Q    + S   +K+ +QN   +   + 
Sbjct: 422 -KGSQVIAGSLNGPGHFYFKAIN--IGDDTKLAQIIQTMKSAQLNKAPIQN---NADYLA 475

Query: 268 GAFLGTNVGTPLHRKLS--KLAVLLFWIAVLFAIIVMASQKFDVDKRVAIYAICVALSMI 325
             F+ T +   +   ++   L+ LL    V+F      + KF    ++AI  I VA    
Sbjct: 476 SIFVPTILCLSIITFITWITLSNLLTKPPVIFT--NNNNGKFYTSFQIAISVIVVAC--- 530

Query: 326 PSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSDKTGTLTQGKMLARQIW 385
           P +L +     + VG  +     V+++  D LE    +  I  DKTGT+T G+M  +   
Sbjct: 531 PCALGLATPTAIMVGTGIGAQHGVLIKGGDILERFNTITKIVFDKTGTITTGQMTVQ--- 587

Query: 386 IPRFGTITISNSDDPFNP 403
             RF  I  SN D P  P
Sbjct: 588 --RF--IPYSNDDLPVLP 601

>KLLA0E22352g 1984522..1988142 highly similar to sp|P39986
           Saccharomyces cerevisiae YEL031w SPF1 P-type ATPase,
           start by similarity
          Length = 1206

 Score = 57.0 bits (136), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 72/296 (24%), Positives = 124/296 (41%), Gaps = 57/296 (19%)

Query: 522 EKPGSAQFEHIAEFPFDSTVKRMSSVYYNNHNETYNIYGKGAFESIISCCSSWYGKDGVK 581
           ++ G+     +  F F S++KR +S+   + +  +    KGA E+I         ++ + 
Sbjct: 565 KRAGADNIRILRRFQFSSSLKRSASI--ASQSNRFFAAVKGAPETI---------RERLN 613

Query: 582 ITPLTDCDVETIRKNVYSLSNEGLRVLGFASKSFTKDQVNDDQLKNITSNRATAESDLVF 641
             P    D + I K   S +  G RVL  A K   K  +++ Q+ NI  +R   E+ L F
Sbjct: 614 SVP---SDYDDIYK---SFTRSGSRVLALAYKDLPK--MSNSQIDNI--DRDEIETGLTF 663

Query: 642 LGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPTNLYHYSQEI 701
              +  + P +++    +K  +++     M+TGD   TA  +A+EVGI+        + I
Sbjct: 664 GAFLVFHCPLKDDAIETIKMLNESSHRSIMITGDNPLTAVHVAKEVGIVDRETLILDEPI 723

Query: 702 VDS----------------------------------MVMTGSQFDGLS-EEEVDDLPVL 726
             S                                  + +TG     L   +++ D+   
Sbjct: 724 DGSSHALVMRDVNETIVKPFNPDADTFDEKEIFQKYDLAVTGHALKLLQGHKQLRDVIRH 783

Query: 727 PLVIARCSPQTKVRMIEALHRRKKFCTMTGDGVNDSPSLKMANVGIAMGINGSDVS 782
             + AR SP  K  ++  L        M GDG ND  +LK A+VGIA+ +NG++ S
Sbjct: 784 TWIYARVSPSQKEFILITLKDMGYQTLMCGDGTNDVGALKQAHVGIAL-LNGTEDS 838

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 63/261 (24%), Positives = 116/261 (44%), Gaps = 40/261 (15%)

Query: 131 HVIRNGKSETINSKDVVPGDICLVKVGDT-----IPADLRLIETKNFDTDESLLTGESLP 185
           +V R+GK   + +  + P D  LV +  T     IP DL LI+      +E++L+GES P
Sbjct: 256 NVFRDGKWVEMQTDKLFPMD--LVSITRTAEDSAIPCDLLLIDGSCI-VNEAMLSGESTP 312

Query: 186 VSKDANLVFGKEEETSVGDRLNL-AFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGDS 244
           + K++  +          D+L L     +AV+ G  K + + TA  +  G I     G  
Sbjct: 313 LLKESIKL------RPANDQLQLDGVDKNAVLHGGTKALQV-TAPENRTGVITPPDGGAL 365

Query: 245 GLISR---DPSKSWLQNTWI-STKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAII 300
            ++++   + S+  L    I S ++V       +VG       +K A+      ++FAI+
Sbjct: 366 AVVTKTGFETSQGSLVRVMIFSAERV-------DVG-------NKEALYFILFLLIFAIV 411

Query: 301 VM------ASQKFDVDKRVAIYAICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVRKL 354
                    ++   +  ++ +  I +  S++P  L + LT+ ++   A +    V   + 
Sbjct: 412 ASWYVWKEGTRMGRIQSKLILDCILIITSVVPPELPMELTMAVNSSLAALSKFYVYCTEP 471

Query: 355 DSLEALGAVNDICSDKTGTLT 375
             +   G ++  C DKTGTLT
Sbjct: 472 FRIPYAGRIDVCCFDKTGTLT 492

>YDR270W (CCC2) [1102] chr4 (1005667..1008681) Copper-transporting
           P-type ATPase, member of the heavy-metal transporting
           P-type ATPases in the superfamily of P-type ATPases
           [3015 bp, 1004 aa]
          Length = 1004

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 44/191 (23%), Positives = 86/191 (45%), Gaps = 44/191 (23%)

Query: 642 LGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPTNLYHYSQEI 701
            GL  I D  ++++   V+   + G   +M+TGD    AK +A+EVGI   N+Y      
Sbjct: 756 FGLFEINDEVKHDSYATVQYLQRNGYETYMITGDNNSAAKRVAREVGISFENVY------ 809

Query: 702 VDSMVMTGSQFDGLSEEEVDDLPVLPLVIARCSPQTKVRMIEALHRRK--KFCTMTGDGV 759
                                        +  SP  K  +++ +  ++      + GDG+
Sbjct: 810 -----------------------------SDVSPTGKCDLVKKIQDKEGNNKVAVVGDGI 840

Query: 760 NDSPSLKMANVGIAMGINGSDVSKEASDIV------LSDDNFASILNAVEEGRRMTDNIQ 813
           ND+P+L ++++GIA+   G++++ EA+DIV      L+ ++   + NA++   +    I+
Sbjct: 841 NDAPALALSDLGIAIS-TGTEIAIEAADIVILCGNDLNTNSLRGLANAIDISLKTFKRIK 899

Query: 814 KFVLQLLAENV 824
             +   L  N+
Sbjct: 900 LNLFWALCYNI 910

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 62/243 (25%), Positives = 103/243 (42%), Gaps = 45/243 (18%)

Query: 150 DICLVKVGDTIPADLRLIETKNFDTDESLLTGESLPVSKDAN--LVFGKEEETSVGDRLN 207
           DI  +K G  IPAD  +I     + DESL+TGES+ V K     ++ G     SV    +
Sbjct: 435 DIVEIKPGMKIPAD-GIITRGESEIDESLMTGESILVPKKTGFPVIAG-----SVNGPGH 488

Query: 208 LAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLISRDPSKSWLQNTWISTKKVT 267
             F ++ V +        +T L + I K+ K  Q     +S+ P + +    ++++  V 
Sbjct: 489 FYFRTTTVGE--------ETKL-ANIIKVMKEAQ-----LSKAPIQGYAD--YLASIFVP 532

Query: 268 GAFLGTNVGTPLHRKLSKLAVLLFWI-AVLFAIIVMASQKFDVDKRVAIYAIC------V 320
           G  +              LAVL F+I   +  I       F  + +   + IC      V
Sbjct: 533 GILI--------------LAVLTFFIWCFILNISANPPVAFTANTKADNFFICLQTATSV 578

Query: 321 ALSMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSDKTGTLTQGKML 380
            +   P +L +     + VG  V     V+++  + LE   ++     DKTGTLT G M+
Sbjct: 579 VIVACPCALGLATPTAIMVGTGVGAQNGVLIKGGEVLEKFNSITTFVFDKTGTLTTGFMV 638

Query: 381 ARQ 383
            ++
Sbjct: 639 VKK 641

>Kwal_55.21575
          Length = 989

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 82/295 (27%), Positives = 123/295 (41%), Gaps = 54/295 (18%)

Query: 107 IGLVQEYKA-TKTMNSLKNLSS---PNAHVIRNGKSETINSKDVVPGDICLVKVGDTIPA 162
           +G + E KA +KT NSL  L S       +I NGK+  I  + +  GD   +K G  IP 
Sbjct: 384 VGKLLENKAKSKTNNSLSKLMSLAPSTCTIIENGKAREIPVEFLQVGDTVEIKPGAKIPT 443

Query: 163 DLRLIETKNFDTDESLLTGESL--PVSKDANLVFGK--------EEETSVGDRLNLAFSS 212
           D  +IE ++ + DESL+TGESL  P  K   ++ G            TSVGD   LA   
Sbjct: 444 DGVIIEGES-EVDESLITGESLMVPRYKGFPVIAGSINGPNRFLLTATSVGDDTKLAQ-- 500

Query: 213 SAVVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLISRDPSKSWLQNTWISTKKVTGAFLG 272
                      +I+T   +++ K       D           +L + ++ +  V  A + 
Sbjct: 501 -----------IIQTMKQAQLSKAPIQHYAD-----------YLASKFVPSVLVL-AMIT 537

Query: 273 TNVGTPLHRKLSKLAVLLFWIAVLFAIIVMASQKFDVDKRVAIYAICVALSMIPSSLVVV 332
               T L R LS             +I    + KF +   + I  I VA    P +L + 
Sbjct: 538 FVTWTILSRVLSNPP----------SIFDSPNGKFFICLEMTISVIVVAC---PCALGLA 584

Query: 333 LTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSDKTGTLTQGKMLARQIWIP 387
               + VG  +     V+++  D LE   ++     DKTGTLT G M   Q ++P
Sbjct: 585 APTAIMVGTGLGAKHGVLIKGGDILEKCSSLETFLFDKTGTLTTGHMTVEQ-FVP 638

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 39/162 (24%), Positives = 74/162 (45%), Gaps = 40/162 (24%)

Query: 641 FLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPTNLYHYSQE 700
            +G   I D  + + A  V+   + G  V M+TGD   +A  +A E+GI   N+Y     
Sbjct: 739 LVGRFEISDFIKKDAAEVVQYLTEKGHRVCMVTGDNHKSAMKVALELGIEANNVY----- 793

Query: 701 IVDSMVMTGSQFDGLSEEEVDDLPVLPLVIARCSPQTKVRMIEALHRR-KKFCTMTGDGV 759
                                         +  +P  K ++++ L    +K     GDG+
Sbjct: 794 ------------------------------SELTPADKNQLVQDLQDGGRKNVAFIGDGI 823

Query: 760 NDSPSLKMANVGIAMGINGSDVSKEASDIVL---SDDNFASI 798
           NDSP+L  +++G+++   G+D++ EA+D+++   S++N  S+
Sbjct: 824 NDSPALVTSDLGVSIS-TGTDIAMEAADVIILNRSENNHVSL 864

>KLLA0F07447g 700685..703612 similar to sp|P38995 Saccharomyces
           cerevisiae YDR270w CCC2 probable copper-transporting
           ATPase, start by similarity
          Length = 975

 Score = 54.3 bits (129), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 74/284 (26%), Positives = 130/284 (45%), Gaps = 46/284 (16%)

Query: 107 IGLVQEYKA----TKTMNSLKNLS-SPNAHVIRNGKSETINSKDVVPGDICLVKVGDTIP 161
           +G + E KA    +  M+ L +L+ S  + V+ +G +  I+ + + P DI  V  G  IP
Sbjct: 382 LGKLLENKAKSETSTAMSKLISLTPSSCSIVLPDGSTREISVELLQPNDIVEVVPGMKIP 441

Query: 162 ADLRLIETKNFDTDESLLTGESLPVSKDANLVFGKEEETSVGDRLNLAFSSSAVVKGRAK 221
           AD  +I  +  + DESL+TGES+ V K    + G +    +G  +N          G   
Sbjct: 442 ADGVVIRNET-EVDESLITGESMLVEK----IVGSQ---VIGGSVN--------GPGHFY 485

Query: 222 GIVIKTALNSEIGKIAKSLQGDSGLISRDPSKSWLQNTWISTKKVTGAFLGTNVGTPLHR 281
              I+   ++++  I  +++     +S+ P + +         K+ G F+      P   
Sbjct: 486 FRAIRVGEDTKLANIIATMK--KAQLSKAPIQKY-------ADKMAGIFV------PFVI 530

Query: 282 KLSKLAVLLFWIAVLFAI----IVMASQ--KFDVDKRVAIYAICVALSMIPSSLVVVLTI 335
            LS +   + W+ V + +    ++  S+  KF +  +++I  I VA    P +L +    
Sbjct: 531 SLSAIT-FITWMLVSYTMKTPPLIFNSENGKFFMCMQMSISVIIVAC---PCALGLAAPT 586

Query: 336 TMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSDKTGTLTQGKM 379
            + VG  V  S  V+++  D LE   A+     DKTGTLT G+M
Sbjct: 587 AIMVGTGVGASHGVLIKGGDVLEKCSALQTFLFDKTGTLTTGRM 630

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/183 (23%), Positives = 80/183 (43%), Gaps = 39/183 (21%)

Query: 613 KSFTKDQVNDDQLKNITSNRATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHML 672
           K F  + ++D     +T +  + +  LV  G   I D  + +    V+     GI   M+
Sbjct: 715 KLFPDESLSDIASSTLTESYVSIDGSLV--GKFEISDRVKEDAHFVVEYLQNLGIKCCMV 772

Query: 673 TGDFVGTAKAIAQEVGILPTNLYHYSQEIVDSMVMTGSQFDGLSEEEVDDLPVLPLVIAR 732
           TGD   +A  +AQ++GI   +++                                   + 
Sbjct: 773 TGDAHQSALKVAQQLGISANDVF-----------------------------------SE 797

Query: 733 CSPQTKVRMIEALHRR-KKFCTMTGDGVNDSPSLKMANVGIAMGINGSDVSKEASDIVLS 791
            +P+ K  ++  L     +     GDG+NDSP+L  A++GI++  +G+D++ EA+DIV+ 
Sbjct: 798 VTPEQKRDIVIQLQNNGTERVAFVGDGINDSPALVEADLGISIS-SGTDIAIEAADIVIL 856

Query: 792 DDN 794
           D +
Sbjct: 857 DSD 859

>CAGL0M08602g complement(856349..859387) similar to sp|P38995
           Saccharomyces cerevisiae YDR270w CCC2, start by
           similarity
          Length = 1012

 Score = 53.9 bits (128), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 85/307 (27%), Positives = 133/307 (43%), Gaps = 61/307 (19%)

Query: 98  SFVIAVNVLIGLVQEYKA-TKTMNSLKNLSS--PNAHVIRNGKSETINSKDVVP----GD 150
           S +I   + IG   E KA +KT  +L  L S  P++ +I +   ++I  +  +     GD
Sbjct: 377 SVMIVAYISIGKYLENKAKSKTSTALSKLISLTPSSCIIVDKDDDSITQEIGIELLEVGD 436

Query: 151 ICLVKVGDTIPADLRLIETKNF-DTDESLLTGES-LPVSKDANLVFGKE---------EE 199
           I +VK G  IP+D   I TK   + DESL+TGE+ L V +  ++V G           E 
Sbjct: 437 IAMVKPGAKIPSDG--IVTKGISEVDESLMTGETNLVVKEIGSVVTGGTINGSGLIYFEV 494

Query: 200 TSVGDRLNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLISRDPSKSWLQNT 259
           TSVGD   LA              +IK   N+++ K +     D           ++ + 
Sbjct: 495 TSVGDDTKLAN-------------IIKVMKNAQLKKASIQRYTD-----------YVASI 530

Query: 260 WISTKKVTGAFLGTNVGTPLHRK---LSKLAVLLFWIAVLFAIIVMASQKFDVDKRVAIY 316
           ++ T  +  + L   V T L R    +SKL++              +  +F +  ++A  
Sbjct: 531 FVPTVLIL-SLLTFIVWTSLTRSEKIISKLSIFG----------ETSESRFYMCLQIATS 579

Query: 317 AICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSDKTGTLTQ 376
            + VA    P +L +     + VG  V     V+++  D LE    VN    DKTGTLT 
Sbjct: 580 VVIVAC---PCALGLATPTAIMVGTGVASENGVLIKGGDVLEKFNEVNTFVFDKTGTLTT 636

Query: 377 GKMLARQ 383
           G M  +Q
Sbjct: 637 GHMTVQQ 643

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 41/188 (21%), Positives = 77/188 (40%), Gaps = 42/188 (22%)

Query: 643 GLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPTNLYHYSQEIV 702
           G   + D  +++    ++        V M+TGD   +A  +A+ V I P N+Y       
Sbjct: 757 GRFELLDEVKSDAKDVIRYLRNNNYEVFMVTGDTHKSAMKVAEMVDIPPNNVY------- 809

Query: 703 DSMVMTGSQFDGLSEEEVDDLPVLPLVIARCSPQTKVRMIEALHRRKKFCTMTGDGVNDS 762
                                       +  +P  K + +E L    +     GDG+NDS
Sbjct: 810 ----------------------------SEVTPDGKSQTVEYLREEGRVIAFIGDGINDS 841

Query: 763 PSLKMANVGIAMGINGSDVSKEASDIVLSDD------NFASILNAVEEGRRMTDNIQKFV 816
            +L  +++GIA+  +G++V+ EA+ IV+ +D          ++NA++   R    ++  +
Sbjct: 842 LALVTSDLGIAIS-SGTEVAIEAAGIVILNDPDTDEPTLKGVVNALDLSIRTFRRVKLNL 900

Query: 817 LQLLAENV 824
              L  NV
Sbjct: 901 FWALCYNV 908

>CAGL0L11814g 1262124..1266854 highly similar to sp|P32660
            Saccharomyces cerevisiae YER166w or sp|Q12675
            Saccharomyces cerevisiae YDR093w, start by similarity
          Length = 1576

 Score = 53.9 bits (128), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 184/891 (20%), Positives = 323/891 (36%), Gaps = 215/891 (24%)

Query: 144  KDVVPGDICLVKVGDTIPADLRL-----------IETKNFDTDESLLTGESLPVSKD--- 189
            K V  GDI  +   D IPAD+ L           +ETKN D + +L   ++L  S     
Sbjct: 395  KSVKVGDIVRIHNNDEIPADIILLSTSDSDGGCYVETKNLDGETNLKVRQALKCSYKIKT 454

Query: 190  ----ANLVFGKEEETSVGD----RLNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQ 241
                A   F  E E    +    + NL +  S   + R + + I   L    G   ++ +
Sbjct: 455  SRDIARTRFWIESEGPHANLYSYQGNLKWKDSTNNELRNEPVTINNMLLR--GCTLRNTK 512

Query: 242  GDSGLI--SRDPSKSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAI 299
               G++  + D +K  L      TKK           + + R+L+   ++ F +  +   
Sbjct: 513  WAMGIVVFTGDDTKIMLNAGVTPTKK-----------SRISRELNFSVLINFLVLFILCF 561

Query: 300  IVMASQKFDVDKR---------------------VAIY-AICVALSMIPSSLVVVLTITM 337
            I   +   D DK                      V+ + A+ +  S++P SL + + I  
Sbjct: 562  ISGLANGIDYDKHPRSRDFFEFGTVAGNPATNGFVSFWVAVILYQSLVPISLYISVEIIK 621

Query: 338  SVGAAVMVSRNVIVR-KLDS---------LEALGAVNDICSDKTGTLTQGKMLARQIWIP 387
            +  AA +    ++   KLD           + LG +  I SDKTGTLTQ  M        
Sbjct: 622  TAQAAFIYGDVLLYNAKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVM-------- 673

Query: 388  RFGTITISNSDDPFNPNEGNVSLIPRFSPYEYSHNEDGDVGILQNFKDRLYEKDLPEDID 447
             F   TI+         E    L  R              GI    + R  ++++ +D D
Sbjct: 674  EFKKCTINGVSYGRAYTEALAGLRKR-------------QGIDVEAEGRREKEEIAKDRD 720

Query: 448  MDLFQKWLETATLANIATVFKDDAT--------DCWKAHGDPTEIAIQVFATKMDLPHNA 499
            + +     +   L+N    F D+ T        D    +GD  +   + F   + L H+ 
Sbjct: 721  VMIN----DLRNLSNNTQFFPDEITFISKEIVQDFKGRNGDIQKKCCEHFMLALALCHSV 776

Query: 500  LTGEKSTN------QSNENDQSSLSQHNEKPG------------------SAQFEHIAEF 535
            LT    TN      ++   D+++L       G                    +FE +   
Sbjct: 777  LTEPSPTNPNKLEMKAQSPDEAALVTTARDLGFCFMGKTKTGMVVEIQGIQKEFEILNIL 836

Query: 536  PFDSTVKRMSSVYY-----NNHNETYNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDV 590
             F+S  KRMS +        N      +  KGA   I S  S+  G++   +   T   +
Sbjct: 837  EFNSARKRMSCIIKIPGATPNDEPRALLICKGADSVIYSRLSTKAGENDETLLEKTALHL 896

Query: 591  ETIRKNVYSLSNEGLRVLGFASKSFTKDQ---------------VNDDQLKNITSNRATA 635
            E         + EGLR L  A +  T  +                N ++   I S+  + 
Sbjct: 897  E-------QYATEGLRTLCLAQRELTWSEYTEWNARYDIAAASLTNREEQLEIVSD--SI 947

Query: 636  ESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPTNL- 694
            E DL+ LG   I D  ++    ++    +AGI + +LTGD V TA  I     +L  ++ 
Sbjct: 948  ERDLILLGGTAIEDRLQDGVPESIALLAEAGIKLWVLTGDKVETAINIGFSCNLLNNDME 1007

Query: 695  -----------YHYSQ---EIVDSMV---------MTGSQFD------------------ 713
                         Y +   E+V+S++         ++GS+ +                  
Sbjct: 1008 LLVVKTAGEDVLEYGEDPHEVVNSLISKYLREKFGLSGSEMELDNAKGDHSFPKGDFAVV 1067

Query: 714  --------GLSEEEVDDLPVL------PLVIARCSPQTKVRMIEALHRRKKFCTMT-GDG 758
                     L+ +++    +L       ++  R SP  K  +++ +       T+  GDG
Sbjct: 1068 IDGDALKIALTGDDMKRKFLLLCKNCKAVLCCRVSPAQKAAVVKLVKNTLDVMTLAIGDG 1127

Query: 759  VNDSPSLKMANVGIAMGINGSDVSKEASDIVLSDDNFASILNAVEEGRRMTDNIQKFVLQ 818
             ND   ++ A+VGI +       +   SD  +    + + L  V  GR     + + + +
Sbjct: 1128 SNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQFRYLTRLLLV-HGRWSYKRLSEMIPE 1186

Query: 819  LLAENVAQALYLIIGLVFRDENGKSVFPLSPVEVLWIIVVTSCFPAMGLGL 869
               +NV   L L    ++ + +G  +F  + + + + +  TS  P + LG+
Sbjct: 1187 FFYKNVIFTLALFWYGIYNNFDGSYLFEYTYL-MFYNLAFTS-IPVILLGI 1235

>KLLA0D04092g complement(344666..348124) some similarities with
            sp|P38995 Saccharomyces cerevisiae YDR270w CCC2 probable
            copper-transporting ATPase P16.2.f2.1, hypothetical start
          Length = 1152

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 40/149 (26%), Positives = 66/149 (44%), Gaps = 45/149 (30%)

Query: 649  DPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPTNLYHYSQEIVDSMVMT 708
            D  R E    +K+  ++GI   M++GD   TA+A+AQE+                     
Sbjct: 929  DEIRPEAKDVIKELRRSGIECWMISGDNEVTARAVAQEL--------------------- 967

Query: 709  GSQFDGLSEEEVDDLPVLPLVIARCSPQTKVRMIEALHR-------RKKFCTMTGDGVND 761
                      ++D+      VIA   P+ K   ++ +           K   M GDG+ND
Sbjct: 968  ----------DIDN------VIAEVLPEEKAAKVKWIQHNNIGANGHHKVVAMVGDGIND 1011

Query: 762  SPSLKMANVGIAMGINGSDVSKEASDIVL 790
            +P+L  A+VGIA+  +GS+++  + D VL
Sbjct: 1012 APALAAADVGIALA-SGSELAMTSCDFVL 1039

 Score = 34.3 bits (77), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 51/93 (54%), Gaps = 10/93 (10%)

Query: 105 VLIG-LVQEYKATKTMNSLKNLSS---PNAHVIRN-----GKSETINSKDVVPGDICLVK 155
           +LIG L++    TKT +++ NLSS     A +++       + ET+  + +  GD   + 
Sbjct: 522 LLIGRLLESLAKTKTASAISNLSSFKQETATLMQKVGDQYQEVETVQIQYLELGDYIKIS 581

Query: 156 VGDTIPADLRLIETKNFDTDESLLTGESLPVSK 188
            G + P D  ++E +  + DES LTGES+P+ +
Sbjct: 582 PGQSPPLDSIILEGET-EFDESALTGESIPMVR 613

>CAGL0H04477g 421857..426737 similar to sp|Q12674 Saccharomyces
            cerevisiae YMR162c, start by similarity
          Length = 1626

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 63/245 (25%), Positives = 96/245 (39%), Gaps = 53/245 (21%)

Query: 590  VETIRKNVYSLSNEGLRVLGFASK-----SFTKDQVNDDQLKNITSNR--------ATAE 636
            +E   +++ S S EGLR L FA K      F + +    + K   S R        A  E
Sbjct: 958  LEKTLEDIESFSTEGLRTLLFAHKWISNEDFEQWRTRYHEAKTSLSERKQKIDEVGAQIE 1017

Query: 637  SDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPTNLYH 696
             +L  LG   I D  +   + A++K  +AGI + MLTGD   TA  I     +    ++ 
Sbjct: 1018 DELYLLGATAIEDKLQEGVSEAIEKIRRAGIKMWMLTGDKRETAINIGYSCKL----IHD 1073

Query: 697  YS---------QEIVDSMVMTGSQ------------FDGLSEEEVDDLPVL--------- 726
            YS         + I+  M     +             DG +    +D P L         
Sbjct: 1074 YSTVVILTTSDENIISKMNAISQEVDSGNVAHCVIVIDGATLAMFEDNPTLMSVFTELCT 1133

Query: 727  ---PLVIARCSPQTKVRMIEALHRR-KKFCTMT-GDGVNDSPSLKMANVGIAM-GINGSD 780
                +V  R SP  K  M+  +    K   T+  GDG ND   ++ A++G+ + G  G  
Sbjct: 1134 KTDSVVCCRASPAQKALMVSNIRNTDKSIVTLAIGDGANDIAMIQSADIGVGIAGKEGLQ 1193

Query: 781  VSKEA 785
             S+ A
Sbjct: 1194 ASRSA 1198

 Score = 39.7 bits (91), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 37/116 (31%), Positives = 53/116 (45%), Gaps = 24/116 (20%)

Query: 323 SMIPSSLVVVLTITMSVGAAVMVSRNV-----------IVRKLDSLEALGAVNDICSDKT 371
           ++IP SL V + + + V  + M+  ++            VR    LE LG V+ I SDKT
Sbjct: 473 TIIPLSLYVTMEL-IKVAQSRMMEWDIDMYHAESDTPCAVRTATILEELGQVSYIFSDKT 531

Query: 372 GTLTQGKMLARQIWIPRFGTITISNSDDPFNPNEGNVSLIPRFSPYEYSHNEDGDV 427
           GTLT  KML R++     GT  + N+             I  F P + S+  D DV
Sbjct: 532 GTLTDNKMLFRKLSF--CGTSWVHNATQD----------ISEFKPAQLSNKNDIDV 575

>AGR120C [4431] [Homologous to ScYER166W (DNF1) - SH; ScYDR093W (DNF2)
            - SH] (972456..977099) [4644 bp, 1547 aa]
          Length = 1547

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 199/932 (21%), Positives = 335/932 (35%), Gaps = 196/932 (21%)

Query: 121  SLKNLSSPNAHVIRNGKSETINSKDVVPGDICLVKVGDTIPADLRL-----------IET 169
            S+ N + P     R GKS   + KD+  GDI  +   D IPAD+ L           +ET
Sbjct: 386  SVLNRNLPPVPDCRFGKS---HWKDIRVGDIVRIHNNDEIPADIILLSTSDADGACYVET 442

Query: 170  KNFDTDESLLTGESLPVS------KD-ANLVFGKEEETSVGDRLNLAFSSSAVVKGRAKG 222
            KN D + +L   +SL  S      KD +   F  E E   G   NL        +G  K 
Sbjct: 443  KNLDGETNLKVRQSLKCSHRIRNSKDISRCKFWVESE---GPHANLY-----SYQGNFKW 494

Query: 223  IVIKTA-LNSEIGKIAKSLQGDSGLISRDPSKSWLQNTWISTKKVTGAFLGTNVGTPLHR 281
            +  +T  +++E   I   L     L +   +   +  T   TK +  A +     + + R
Sbjct: 495  VDSETGVMHNEPVNINNMLLRGCSLRNTKWAMGIVMFTGTDTKIMLNAGVTPTKRSRISR 554

Query: 282  KLSKLAVLLFWIAVLFAIIVMAS------QKFDVDKRV--------------AIYAICVA 321
            +L+   +L F    LF + + A        + D   R                I A  VA
Sbjct: 555  ELNYSVILNF--VFLFVLCLAAGLVNGIYYRRDATSRTFFEFGTVAGTPFANGILAFFVA 612

Query: 322  L----SMIPSSLVVVLTITMSVGAAVMVSRNVIV----------RKLDSLEALGAVNDIC 367
            L    S++P SL + + I  +  AA +    ++           R  +  + LG +  I 
Sbjct: 613  LILYQSLVPISLYISIEIIKTAQAAFIYGDVLLYNPKLDYPCTPRTWNISDDLGQIEYIF 672

Query: 368  SDKTGTLTQGKMLARQIWIPRFGTITISNSDDPFNPNEGNVSLIPRFSPYEYSHNEDGDV 427
            SDKTGTLTQ  M         F   TI+         E    L  R         +  D+
Sbjct: 673  SDKTGTLTQNVM--------EFKKCTINGVSYGRAYTEALAGLRKR---------QGVDI 715

Query: 428  GILQNFKDRLYEKDLPEDIDMDLFQKWLETATLANIATVFKDDATDCWKAHGDPTEIAIQ 487
                  +    E+D  + +++ L            +  V K+   D   A+    + A++
Sbjct: 716  EEEGARERAEIEEDKKQMVELLLKLGKNSQLDPHTVTFVSKELVQDLGGANSQEQKEAVE 775

Query: 488  VFATKMDLPHNALTGEKSTN------QSNENDQSSLSQHNEKPG---------------- 525
             F   + L H+ +  E   N      ++   D+++L +     G                
Sbjct: 776  HFMLSLALCHSVVVEENKNNPEKLDIKAQSPDEAALVETARDMGFSFVGRTKNGVIIEIQ 835

Query: 526  --SAQFEHIAEFPFDSTVKRMSSVYY-----NNHNETYNIYGKGAFESIISCCSSWYGKD 578
                +F  +    F+ST KRMS +        N      +  KGA   I S       ++
Sbjct: 836  GVQKEFRILNVLEFNSTRKRMSCIVKIPAADENSKPKALLLCKGADSVIYSRLDR--SRN 893

Query: 579  GVKITPLTDCDVETIRKNVYSLSNEGLRVLGFASKSFTKDQ-VNDDQLKNITS----NRA 633
              K+   T   +E         + EGLR L  A +    D+ +N ++ + + +    NR 
Sbjct: 894  DPKLLERTALHLE-------QFATEGLRTLCVAQREIDWDEYLNWNERRELAAASLDNRE 946

Query: 634  TA--------ESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQ 685
             A        E  LV LG   I D  ++    ++     AGI + +LTGD V TA  I  
Sbjct: 947  EALERVADAIERQLVLLGGTAIEDRLQDGVPDSISILADAGIKLWVLTGDKVETAINIGF 1006

Query: 686  EVGILPTNL------------YHYSQE-------IVDSMVMTGSQFDGLSEE----EVDD 722
               +L +++             H  ++       ++D  + T     G  EE      D 
Sbjct: 1007 SCNLLGSDMELLVIKSSGEDVEHLGEKDSDVVLALIDKYLETHFNMKGSPEELAAARKDH 1066

Query: 723  LP------------VLPLVI---------------------ARCSPQTKVRMIEALHRRK 749
             P             L L +                      R SP  K  +++ +    
Sbjct: 1067 TPPQSAFGVVIDGDALKLALHGEDIRRKFLLLCKNCKAVLCCRVSPSQKAAVVKLVKESL 1126

Query: 750  KFCTMT-GDGVNDSPSLKMANVGIAMGINGSDVSKEASDIVLSDDNFASILNAVEEGRRM 808
               T+  GDG ND   ++ A+VGI +       +  ++D  +    + + L  V  GR  
Sbjct: 1127 DVVTLAIGDGSNDVAMIQAADVGIGIAGEEGRQAVMSADYAIGQFRYLTRLVLV-HGRWS 1185

Query: 809  TDNIQKFVLQLLAENVAQALYLIIGLVFRDENGKSVFPLSPVEVLWIIVVTSCFPAMGLG 868
               + + + Q   +N+   L L    +  + +G  +F  + + + + +  TS  P + LG
Sbjct: 1186 YKRLAEMIPQFFYKNITFTLALFWFGICSNYDGSYLFEYTYL-MFYNLAFTS-LPVIFLG 1243

Query: 869  -LEKAAPDLMD-RPPHDSEVGIFTWEVIIDTF 898
             +++ A D++    P   +VGI   E   + F
Sbjct: 1244 IMDQDASDVLSVVVPQLYKVGILRTEWTQNKF 1275

>KLLA0E01650g complement(155975..160627) similar to sp|Q12674
            Saccharomyces cerevisiae YMR162c, start by similarity
          Length = 1550

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 71/322 (22%), Positives = 127/322 (39%), Gaps = 63/322 (19%)

Query: 600  LSNEGLRVLGFASK-----SFTKDQVNDDQLKNITSNRATA--------ESDLVFLGLIG 646
             S EGLR L ++ K      +   +    + K   +NR+T         E+DL  LG   
Sbjct: 947  FSTEGLRTLLYSYKWIPAEEYKAWEAKYHEAKTSLTNRSTQIAEVGGHIETDLELLGATA 1006

Query: 647  IYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPTNLYHYS-------- 698
            I D  +     A++K  +AGI + MLTGD     +  A  +G     +Y YS        
Sbjct: 1007 IEDKLQEGVPEAIQKIRRAGIKMWMLTGD----KRETAINIGYACKLIYDYSTVVILKKN 1062

Query: 699  -QEIVDSMVMTGSQF------------DGLSEEEVDDLPVL------------PLVIARC 733
               ++  M   G +             DG S    ++ P +             ++  R 
Sbjct: 1063 DDNLISKMTALGEELDTGKIAHCVLVIDGASLAVFENNPTMMSVFIELCTKTDSVICCRA 1122

Query: 734  SPQTKVRMIEALH-RRKKFCTMT-GDGVNDSPSLKMANVGIAMGINGSDVSKEASDIVLS 791
            SP  K  ++  +  + K   T+  GDG ND   ++ A++G+  GI G +  + +     S
Sbjct: 1123 SPSQKALIVTNIRLKNKDLVTLAIGDGANDIAMIQSADIGV--GITGKEGLQASRSSDYS 1180

Query: 792  DDNFASILNAV-EEGRRMTDNIQKFVLQLLAENVAQALYLIIGLVFRDE---NGKSVFPL 847
               F  +L  +   GR       KFVL    + V   L+ +  ++++ +   +G S++  
Sbjct: 1181 IAQFRYLLKLLFVHGRYNYVRTSKFVLCTFYKEV---LFYLTQMIYQRQTMFSGTSLY-- 1235

Query: 848  SPVEVLWIIVVTSCFPAMGLGL 869
             P  +     + +  P + +G+
Sbjct: 1236 EPWSLSMFNTLFTSLPVICIGM 1257

 Score = 35.4 bits (80), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 40/75 (53%), Gaps = 12/75 (16%)

Query: 323 SMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDS-----------LEALGAVNDICSDKT 371
           ++IP SL V   I  ++ + +M   ++ +  ++S           LE LG V+ I SDKT
Sbjct: 479 TLIPLSLYVTTEIIKAMQSKLM-EWDIDMYHIESDTPCESRTATILEELGQVSYIFSDKT 537

Query: 372 GTLTQGKMLARQIWI 386
           GTLT  KM+ R+  I
Sbjct: 538 GTLTDNKMIFRKFSI 552

>YMR162C (DNF3) [4117] chr13 complement(578950..583920) Member of
           the Drs2p-like family of the P-type ATPase superfamily
           of membrane transporters [4971 bp, 1656 aa]
          Length = 1656

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 87/353 (24%), Positives = 144/353 (40%), Gaps = 72/353 (20%)

Query: 149 GDICLVKVGDTIPADLRL-----------IETKNFDTDESLLTGESLP----VSKDANLV 193
           GD  L+   D +PADL L           +ET   D + +L + +  P    ++K A+ +
Sbjct: 305 GDFVLLTQDDWVPADLLLLTCDGENSECFVETMALDGETNLKSKQPHPELNKLTKAASGL 364

Query: 194 FGKEEETSVGD-RLNLA-FSSSAVVKGRAKGIVIKTALNSE----IGKIAKSLQGDSGLI 247
                + +V D  ++L  F  +  +K      ++K  L  +     G I ++ Q   G++
Sbjct: 365 ANINAQVTVEDPNIDLYNFEGNLELKNHRNDTIMKYPLGPDNVIYRGSILRNTQNVVGMV 424

Query: 248 SRDPSKSWLQNTWISTKKVTGAFLGTNVGTP-LHRKLSKLAVLLFWIAV---LFAII--V 301
                +         TK    A        P L RK++ + V + ++     LF+ +  V
Sbjct: 425 IFSGEE---------TKIRMNALKNPRTKAPKLQRKINMIIVFMVFVVATISLFSYLGHV 475

Query: 302 MASQKFDVDKRVAIYA--------------ICVALSMIPSSLVVVLTITMSVGAAVM--- 344
           +  +K+ +D+  A Y               I +  ++IP SL V + I   V + +M   
Sbjct: 476 LHKKKY-IDQNKAWYLFQADAGVAPTIMSFIIMYNTVIPLSLYVTMEIIKVVQSKMMEWD 534

Query: 345 -------VSRNVIVRKLDSLEALGAVNDICSDKTGTLTQGKMLARQI------WIPRFGT 391
                   +     R    LE LG V+ I SDKTGTLT  KM+ R+       W+     
Sbjct: 535 IDMYHAETNTPCESRTATILEELGQVSYIFSDKTGTLTDNKMIFRKFSLCGSSWL---HN 591

Query: 392 ITISNSDDPFNPNEGNVSLIPRFSPYEYSHNEDGDVGI-LQNFKDRLYEKDLP 443
           + + NS+D F  N  N + + R  P  ++ +    V I  QN  DRL   D P
Sbjct: 592 VDLGNSEDNFEDNRDNTNSL-RLPPKAHNGSSIDVVSIGDQNVLDRLGFSDAP 643

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 63/242 (26%), Positives = 94/242 (38%), Gaps = 50/242 (20%)

Query: 590  VETIRKNVYSLSNEGLRVLGFASKSFTKDQVND-----DQLKNITSNR--------ATAE 636
            +E   + +   S EGLR L +A K     Q  +      Q K   ++R        A  E
Sbjct: 1018 IERTLQAIDEFSTEGLRTLVYAYKWIDIGQYENWNKRYHQAKTSLTDRKIKVDEAGAEIE 1077

Query: 637  SDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIA---------QEV 687
              L  LG+  I D  ++  + A++K  +AGI + MLTGD   TA  I            V
Sbjct: 1078 DGLNLLGVTAIEDKLQDGVSEAIEKIRRAGIKMWMLTGDKRETAINIGYSCMLIKDYSTV 1137

Query: 688  GILPT-------NLYHYSQEIVDS--MVMTGSQFDGLSEEEVDDLPVL------------ 726
             IL T        +   SQE VDS  +       DG +    +  P              
Sbjct: 1138 VILTTTDENIISKMNAVSQE-VDSGNIAHCVVVIDGATMAMFEGNPTYMSVFVELCTKTD 1196

Query: 727  PLVIARCSPQTKVRMIEALHRRK-KFCTMT-GDGVNDSPSLKMANVGIAM----GINGSD 780
             ++  R SP  K  M+  +        T+  GDG ND   ++ A++G+ +    G+  S 
Sbjct: 1197 SVICCRASPSQKALMVSNIRNTDPNLVTLAIGDGANDIAMIQSADIGVGIAGKEGLQASR 1256

Query: 781  VS 782
            VS
Sbjct: 1257 VS 1258

>AGL041C [4270] [Homologous to ScYDR270W - NSH] (628428..632129) [3702
            bp, 1233 aa]
          Length = 1233

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 41/150 (27%), Positives = 63/150 (42%), Gaps = 41/150 (27%)

Query: 644  LIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPTNLYHYSQEIVD 703
             + + D  R E    V+  H+ GI   M++GD    A A+A EVGI      H       
Sbjct: 1013 FLAVRDELRPEAKEVVQALHERGIECWMISGDNSLAANAVALEVGI-----KH------- 1060

Query: 704  SMVMTGSQFDGLSEEEVDDLPVLPLVIARCSPQTKVRMIEALHR---RKKFCTMTGDGVN 760
                                     VIA   P+ K   I+ +     +     M GDG+N
Sbjct: 1061 -------------------------VIADVLPEGKAEKIQWIRETSGQGVAIAMVGDGMN 1095

Query: 761  DSPSLKMANVGIAMGINGSDVSKEASDIVL 790
            D+P++  A+VGI++  +GSD++  + D VL
Sbjct: 1096 DAPAIAAADVGISLA-SGSDLAMISCDFVL 1124

 Score = 38.9 bits (89), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 72/305 (23%), Positives = 119/305 (39%), Gaps = 68/305 (22%)

Query: 97  ISFVIAVNVLIGLVQEYKATKTMNSLKNLSSPNAHVI-----RNGKSETINSKDVVP-GD 150
           ++  + +  L+  + + K  KT+ SL +L      ++     R+ K ET  S +++  GD
Sbjct: 609 LTLFLLIGRLLESLSKSKMVKTLESLTSLKQRTGILMQADGARDFKKETSVSAEMLELGD 668

Query: 151 ICLVKVGDTIPADLRLIETKNFDTDESLLTGESLPVSKDANLVFGKEEETSVGDRLNLAF 210
             L+K G + PA   LI     + DES LTGES P++               GD++   F
Sbjct: 669 HILIKPGAS-PAVDALIVQGETEFDESSLTGESRPITHFP------------GDQI---F 712

Query: 211 SSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLISRDPSKSWLQNTWISTKKVTGAF 270
           + +  V               +   IAK        +S  P  S L +       ++   
Sbjct: 713 AGTVNV--------------GQCAVIAK--------VSTAPGNSLLDHV------ISAVR 744

Query: 271 LGTNVGTPLHRKLSKLAVLLFWIAVLFAII------------VMASQKFDVDKR-----V 313
            G   G P+ R    L        VL AI+            V++ +K D          
Sbjct: 745 DGQLRGAPIERIADVLTGYFVPFIVLLAILTWAIWLILGFAGVLSQEKLDGSVGGWPFWS 804

Query: 314 AIYAICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGA-VNDICSDKTG 372
             +AI V +   P  + +     + VGA +     ++ R   +   +G+ V  +C DKTG
Sbjct: 805 LEFAIAVFVIACPCGIGLAAPTALFVGANIAAKYGILARGGSAAFQMGSKVTTVCFDKTG 864

Query: 373 TLTQG 377
           TLT+G
Sbjct: 865 TLTKG 869

>Scas_576.8
          Length = 1591

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 187/896 (20%), Positives = 323/896 (36%), Gaps = 225/896 (25%)

Query: 144  KDVVPGDICLVKVGDTIPADLRLI-----------ETKNFDTDESLLTGESLPVSKD--- 189
            K+V  GDI  +   D IPAD+ L+           ETKN D + +L   ESL  S     
Sbjct: 415  KNVKVGDIVRIHNNDEIPADIILLSTSDSDGGCYLETKNLDGETNLKVRESLKCSHSIRN 474

Query: 190  ----ANLVFGKEEETSVGDRLNLAFSSSAVVKG--------RAKGIVIKTALNSEIGKIA 237
                A   F  E E   G   NL +S    VK         + + + I   L    G   
Sbjct: 475  SRDIARTKFWVESE---GPHANL-YSYQGNVKWVDSKDGDLKNEPVTINNLLLR--GCTL 528

Query: 238  KSLQGDSGLI--SRDPSKSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAV 295
            ++ +   G++  + D +K  L +    TKK       + +   L+  +S   + LF I  
Sbjct: 529  RNTKWAMGMVVFTGDDTKIMLNSGATPTKK-------SRISRELNLSVSLNFLFLFIICF 581

Query: 296  LFAIIVMASQKFDVDKR---------------------VAIY-AICVALSMIPSSLVVVL 333
            + AII       D DK                      V+ + A+ +  S++P SL + +
Sbjct: 582  ISAII----NGVDYDKHPRSRDFFEFGTVAGSASTNGFVSFWVAVILYQSLVPISLYISV 637

Query: 334  TITMSVGAAVMVSRNVIVR-KLDS---------LEALGAVNDICSDKTGTLTQGKMLARQ 383
             I  +  AA +    ++   KLD           + +G +  I SDKTGTLTQ  M  ++
Sbjct: 638  EIIKTAQAAFIYGDVLLYNAKLDYPCTPKSWNISDDMGQIEYIFSDKTGTLTQNVMEFKK 697

Query: 384  IWIP--RFGTITISNSDDPFNPNEG-NVSLIPRFSPYEYSHNEDGDVGILQNFKDRLYEK 440
              I    +G    + +       +G +V    R    E + + D  +  L+N       +
Sbjct: 698  CTINGISYGR-AYTEALAGLRKRQGIDVEEEGRREKEEIAKDRDTMINTLRNLSHN--SQ 754

Query: 441  DLPEDIDMDLFQKWLETATLANIATVFKDDATDCWKAHGDPTEIAIQVFATKMDLPHNAL 500
              P+DI                   + K+   D   A GD  +   + F   + L H+ L
Sbjct: 755  FYPDDITF-----------------ISKEFVNDLKGASGDMQQKCCEHFMLALALCHSVL 797

Query: 501  TGEKSTNQSNENDQSSLSQHNEKPGSA------------------------------QFE 530
                   + N++D   L    + P  A                              +F+
Sbjct: 798  V------EPNKHDSKKLDVKAQSPDEAALVCTARDVGFSFIGKTKTGLIIEVQGVQKEFQ 851

Query: 531  HIAEFPFDSTVKRMSSVYY----NNHNETYNIYGKGAFESIISCCSSWYGKDGVKITPLT 586
             +    F+ST KRMS +      N  +E   +      +SII      Y + G K    +
Sbjct: 852  ILNTLEFNSTRKRMSCIVKIPGANPDDEPRALLICKGADSII------YSRLGTKNGANS 905

Query: 587  DCDVETIRKNVYSLSNEGLRVLGFASKSFTKDQV----------------NDDQLKNITS 630
            +  +E    ++   + EGLR L  A +  +  +                  ++QL+ ++ 
Sbjct: 906  ENLLEKTALHLEQYATEGLRTLCIAQRELSWPEYLEWNKRYDIAAASVTNREEQLEAVSD 965

Query: 631  NRATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIA------ 684
                 E +L  LG   I D  ++    ++    QAGI + +LTGD V TA  I       
Sbjct: 966  E---IERELTLLGGTAIEDRLQDGVPESISILAQAGIKLWVLTGDKVETAINIGFSCNLL 1022

Query: 685  ---QEVGILPTN------LYHYSQEIVDSMV---------MTGSQFDGLSEEEVDDLP-- 724
                E+ ++ TN        +   EI +S++         +TGS+ +    ++  D P  
Sbjct: 1023 NNDMELLVVKTNGDDVQEFGNDPAEIAESLITKYLREKFGLTGSEMELADAKKNHDFPRG 1082

Query: 725  ---------VLPLVI---------------------ARCSPQTKVRMIEALHRRKKFCTM 754
                      L L +                      R SP  K  +++ +       T+
Sbjct: 1083 DFAVVIDGEALKLALNGESIRRKFLLLCKNCKAVLCCRVSPAQKAAVVKLVMTSLDVMTL 1142

Query: 755  T-GDGVNDSPSLKMANVGIAMGINGSDVSKEASDIVLSDDNFASILNAVEEGRRMTDNIQ 813
              GDG ND   ++ A+VG+ +       +   SD  +    + + L  V  GR     + 
Sbjct: 1143 AIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFRYLTRLVLV-HGRWSYRRLA 1201

Query: 814  KFVLQLLAENVAQALYLIIGLVFRDENGKSVFPLSPVEVLWIIVVTSCFPAMGLGL 869
            + +     +NV   L L    ++ + +G  +F  + + + + +  TS  P + +G+
Sbjct: 1202 EMIPAFFYKNVIFTLALFWYGIYNNFDGSYLFEYTFL-MFYNLAFTS-LPVIFMGI 1255

>AFL191W [3004] [Homologous to ScYMR162C (DNF3) - SH]
            complement(79156..83883) [4728 bp, 1575 aa]
          Length = 1575

 Score = 47.0 bits (110), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 61/218 (27%), Positives = 91/218 (41%), Gaps = 42/218 (19%)

Query: 636  ESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPTNLY 695
            E DL  LG IGI D  +     A+ K  +AGI + MLTGD   TA  I     +    ++
Sbjct: 997  ERDLTLLGTIGIEDKLQEGVPDAIDKLRRAGIKMWMLTGDKRETAINIGYSCRL----IH 1052

Query: 696  HYSQEIV--------DSMVMTGSQ-------------FDGLSEEEVD-DLPVLPLVIARC 733
             YS  I+         S + T +Q              DG +    + +L ++ L I  C
Sbjct: 1053 DYSTVIILAPNDENMASKITTITQEIEAGNVAHCVVVIDGATLTIFEGNLTLMTLFIELC 1112

Query: 734  -----------SPQTKVRMIEALHRR-KKFCTMT-GDGVNDSPSLKMANVGIAM-GINGS 779
                       SP  K  M+  + +  KK  T+  GDG ND   ++ A++G+ + G  G 
Sbjct: 1113 TKTDSVICCRSSPSQKALMVTKIRKTDKKLVTLAIGDGANDIAMIQSADIGVDITGKEGL 1172

Query: 780  DVSKEASDIVLSDDNFASILNAVEEGRRMTDNIQKFVL 817
              S+ +SD  ++   +   L  V  GR       KFVL
Sbjct: 1173 QASR-SSDYSIAQFRYLLKLLLV-HGRYNYIRTSKFVL 1208

 Score = 38.1 bits (87), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 37/150 (24%), Positives = 63/150 (42%), Gaps = 29/150 (19%)

Query: 263 TKKVTGAFLGTNVGTP-LHRKLSKLAVLLFWIAVLFAIIVMASQKF----DVDKRVAIYA 317
           TK    A     + +P L  +++ + + +  +  +F+ +    Q+F    +VD   A Y 
Sbjct: 372 TKIRMNAIKNPRIKSPKLQTQINLIVLFMILVVAIFSFLSFGLQRFFKNREVDSDRAWYL 431

Query: 318 ICVAL--------------SMIPSSLVVVLTITMSVGAAVM----------VSRNVIVRK 353
           + V                ++IP SL V + I   + + +M           +     R 
Sbjct: 432 MKVDAGLAPTIMSFIIMYNTLIPLSLYVTMEIIKDMQSRLMEWDIDMYHLETNTGCTSRT 491

Query: 354 LDSLEALGAVNDICSDKTGTLTQGKMLARQ 383
              LE LG V+ I SDKTGTLT  +M+ R+
Sbjct: 492 ATILEELGQVSYIFSDKTGTLTDNRMIFRK 521

>Kwal_23.3556
          Length = 1597

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 58/214 (27%), Positives = 85/214 (39%), Gaps = 34/214 (15%)

Query: 636  ESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGI------ 689
            E+ L  LG   I D  +   A A+ K  +AGI + MLTGD   TA  I     +      
Sbjct: 1016 ETSLHLLGATAIEDKLQEGVADAIDKIRRAGIKMWMLTGDKRETAINIGYSCNLIHDYST 1075

Query: 690  ----------LPTNLYHYSQEI-VDSMVMTGSQFDGLSEEEVDDLPVL------------ 726
                      + + L   SQEI   ++       DG +    +  P L            
Sbjct: 1076 VVILSAKDENISSKLTAVSQEIERGNIAHCVVVIDGSTLTTFESNPTLMSVFVELCTKTD 1135

Query: 727  PLVIARCSPQTKVRMIEALHRR-KKFCTMT-GDGVNDSPSLKMANVGIAM-GINGSDVSK 783
             ++  R SP  K  M+  +    KK  T+  GDG ND   ++ A++G+ + G  G   S+
Sbjct: 1136 SVICCRASPSQKALMVTHIRNTDKKLVTLAIGDGANDIAMIQSADIGVGIAGKEGLQASR 1195

Query: 784  EASDIVLSDDNFASILNAVEEGRRMTDNIQKFVL 817
             +SD  ++   F   L  V  GR       KFVL
Sbjct: 1196 -SSDYSIAQFRFLLKLLLV-HGRYNYVRTTKFVL 1227

 Score = 36.2 bits (82), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 32/97 (32%), Positives = 44/97 (45%), Gaps = 20/97 (20%)

Query: 323 SMIPSSLVVVLTITMSVGAAVM----------VSRNVIVRKLDSLEALGAVNDICSDKTG 372
           ++IP SL V + I  ++ + +M           +     R    LE LG V+ I SDKTG
Sbjct: 474 TLIPLSLYVTMEIIKAMQSKLMEWDIDMYHAETNTPCESRTATILEELGQVSYIFSDKTG 533

Query: 373 TLTQGKMLARQI------WI----PRFGTITISNSDD 399
           TLT  KM+ R +      WI    P    +T S S D
Sbjct: 534 TLTDNKMVFRALSVCGSSWIHDFDPAAEKLTKSESSD 570

>YER166W (DNF1) [1594] chr5 (512739..517454) Member of the haloacid
            dehalogenase or epoxide hydrolase family, has low
            similarity to S. cerevisiae Drs2p, which is a
            membrane-spanning Ca-ATPase (P-type) required for
            ribosome assembly and involved in late Golgi function
            [4716 bp, 1571 aa]
          Length = 1571

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 140/669 (20%), Positives = 240/669 (35%), Gaps = 150/669 (22%)

Query: 317  AICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVR-KLDS---------LEALGAVNDI 366
            A+ +  S++P SL + + I  +  AA +    ++   KLD           + LG V  I
Sbjct: 605  AVILYQSLVPISLYISVEIIKTAQAAFIYGDVLLYNAKLDYPCTPKSWNISDDLGQVEYI 664

Query: 367  CSDKTGTLTQGKMLARQIWIPRFGTITISNSDDPFNPNEGNVSLIPRFSPYEYSHNEDGD 426
             SDKTGTLTQ  M         F   TI+         E    L  R             
Sbjct: 665  FSDKTGTLTQNVM--------EFKKCTINGVSYGRAYTEALAGLRKR------------- 703

Query: 427  VGILQNFKDRLYEKDLPEDID--MDLFQKWLETATL--ANIATVFKDDATDCWKAHGDPT 482
             GI    + R  + ++ +D D  +D  +     +      +  V K+   D   A G+  
Sbjct: 704  QGIDVETEGRREKAEIAKDRDTMIDELRALSGNSQFYPEEVTFVSKEFVRDLKGASGEVQ 763

Query: 483  EIAIQVFATKMDLPHNALTGEKSTN------QSNENDQSSLSQHNEKPG----------- 525
            +   + F   + L H+ L      N      ++   D+++L       G           
Sbjct: 764  QRCCEHFMLALALCHSVLVEANPDNPKKLDLKAQSPDEAALVATARDVGFSFVGKTKKGL 823

Query: 526  -------SAQFEHIAEFPFDSTVKRMSSVY----YNNHNETYNIY-GKGAFESIISCCSS 573
                     +FE +    F+S+ KRMS +      N  +E   +   KGA   I S  S 
Sbjct: 824  IIEMQGIQKEFEILNILEFNSSRKRMSCIVKIPGLNPGDEPRALLICKGADSIIYSRLSR 883

Query: 574  WYGKDGVKITPLTDCDVETIRKNVYSLSNEGLRVLGFASKSFTKDQV------------- 620
              G +   I   T   +E         + EGLR L  A +  +  +              
Sbjct: 884  QSGSNSEAILEKTALHLE-------QYATEGLRTLCIAQRELSWSEYEKWNEKYDIAAAS 936

Query: 621  ---NDDQLKNITSNRATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFV 677
                +D+L+ +     + E +L+ LG   I D  ++     ++   +AGI + +LTGD V
Sbjct: 937  LANREDELEVVAD---SIERELILLGGTAIEDRLQDGVPDCIELLAEAGIKLWVLTGDKV 993

Query: 678  GTAKAIAQEVGILPTNLY---------------HYSQEIVDSMV---------MTGSQ-- 711
             TA  I     +L   +                    EIVD+++         +TGS+  
Sbjct: 994  ETAINIGFSCNLLNNEMELLVIKTTGDDVKEFGSEPSEIVDALLSKYLKEYFNLTGSEEE 1053

Query: 712  -FDGLSEEE--------VDDLPVLPLVI---------------------ARCSPQTKVRM 741
             F+   + E        V D   L L +                      R SP  K  +
Sbjct: 1054 IFEAKKDHEFPKGNYAIVIDGDALKLALYGEDIRRKFLLLCKNCRAVLCCRVSPSQKAAV 1113

Query: 742  IEALHRRKKFCTMT-GDGVNDSPSLKMANVGIAMGINGSDVSKEASDIVLSDDNFASILN 800
            ++ +       T+  GDG ND   ++ A+VGI +       +   SD  +    + + L 
Sbjct: 1114 VKLVKDSLDVMTLAIGDGSNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQFRYLARLV 1173

Query: 801  AVEEGRRMTDNIQKFVLQLLAENVAQALYLIIGLVFRDENGKSVFPLSPVEVLWIIVVTS 860
             V  GR     + + + +   +N+  AL L    ++ D +G  ++  + + + + +  TS
Sbjct: 1174 LV-HGRWSYKRLAEMIPEFFYKNMIFALALFWYGIYNDFDGSYLYEYTYM-MFYNLAFTS 1231

Query: 861  CFPAMGLGL 869
              P + LG+
Sbjct: 1232 -LPVIFLGI 1239

>CAGL0G08085g 763185..767921 highly similar to sp|Q12675 Saccharomyces
            cerevisiae YDR093w, hypothetical start
          Length = 1578

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 134/678 (19%), Positives = 246/678 (36%), Gaps = 169/678 (24%)

Query: 317  AICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIV--RKLDS---------LEALGAVND 365
            A+ +  S++P SL + + I +    A+ +  +V++   KLD           + LG +  
Sbjct: 612  AVILYQSLVPISLYISVEI-IKTAQAIFIYLDVMMYNEKLDYPCTPKSWNISDDLGQIEY 670

Query: 366  ICSDKTGTLTQGKMLARQIWIPRFGTITISNSDDPFNPNEGNVSLIPRFSPYEYSHNEDG 425
            I SDKTGTLTQ  M         F   TI+         E    L  R         +  
Sbjct: 671  IFSDKTGTLTQNVM--------EFKKCTINGVSYGRAYTEALAGLRKR---------QGV 713

Query: 426  DVGILQNFKDRLYEKDLPEDIDMDLFQKWLETATLANIATVFKDDAT--------DCWKA 477
            DV      +    ++D  E I+        +   LA  +  ++D+ T        D    
Sbjct: 714  DVAHESKIEKEGIKRDREEMIN--------KLQNLAKNSQFYEDEVTFVSKEFVDDLTGG 765

Query: 478  HGDPTEIAIQVFATKMDLPHNALTGEKSTNQSNENDQSSLSQHNEKPGSA---------- 527
             G   + + Q F   + L H+ LT      + ++ D + L    + P  A          
Sbjct: 766  SGSVQQKSCQHFMLALALCHSVLT------EPSKEDPAKLEIKAQSPDEAALVTTARDMG 819

Query: 528  --------------------QFEHIAEFPFDSTVKRMSSVYYNNHNETYNIYGKGAFESI 567
                                +F+ +    F+S+ KRMS +     ++       G  +++
Sbjct: 820  FSFLKKTKEGMVLEVQGIEKEFQILNILEFNSSRKRMSCIVKIPGDD-----ANGKPKAL 874

Query: 568  ISCCSSWYGKDGVKITPL--TDCDVETIRK----NVYSLSNEGLRVLGFASKSFTKDQVN 621
            + C     G D V  + L  T  + E++ +    ++   + EGLR L  A +  + ++  
Sbjct: 875  LIC----KGADSVIYSRLDKTGLNEESLLEKTALHLEQYATEGLRTLCLAQRELSWEEYE 930

Query: 622  D-------------DQLKNITSNRATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGIN 668
                          D+ + +       E  L+ LG   I D  ++    ++    +AGI 
Sbjct: 931  RWNKKYDIAAAAVVDREEELEKVSDEIERHLILLGGTAIEDRLQDGVPDSIALLGEAGIK 990

Query: 669  VHMLTGDFVGTAKAIA----------------------QEVGILPTNLYH--YSQEIVDS 704
            + +LTGD V TA  I                       +++G  P ++     SQ + D 
Sbjct: 991  LWVLTGDKVETAINIGFSCNLLNNDMELLVIKTTGPDVEDLGATPKDIVDTLISQYLHDK 1050

Query: 705  MVMTGSQ--------------------FDG------LSEEEVDDLPVL------PLVIAR 732
              M GS+                     DG      LS E++    +L       ++  R
Sbjct: 1051 FGMAGSEEELKKAKAEHDIPRGEFAVIIDGEALKYALSTEDMKRKFLLLCKNCKSVLCCR 1110

Query: 733  CSPQTKVRMIEALHRRKKFCTMT-GDGVNDSPSLKMANVGIAMGINGSDVSKEASDIVLS 791
             SP  K  +++ +       T+  GDG ND   ++ AN+G+ +       +  +SD  + 
Sbjct: 1111 VSPAQKAAVVKLVKNTLDVMTLAIGDGSNDVAMIQSANIGVGIAGEEGRQAVMSSDYAIG 1170

Query: 792  DDNFASILNAVEEGRRMTDNIQKFVLQLLAENVAQALYLIIGLVFRDENGKSVFPLSPVE 851
               + + L  V  G+     + + + Q   +N+   L L    ++ D +G  +F  + + 
Sbjct: 1171 QFRYLTRLLLV-HGKWCYKRLAEMIPQFFYKNMIFTLALFWFGIYNDYDGSYLFEYTYL- 1228

Query: 852  VLWIIVVTSCFPAMGLGL 869
              + +  TS  P + LG+
Sbjct: 1229 TFYNLAFTS-IPVILLGI 1245

>ACR086C [1133] [Homologous to ScYDR270W (CCC2) - SH]
           (511968..514400) [2433 bp, 810 aa]
          Length = 810

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 41/178 (23%), Positives = 75/178 (42%), Gaps = 40/178 (22%)

Query: 640 VFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPTNLYHYSQ 699
           V LG   + D  R +    V+     G  V M+TGD    A  ++  +GI   N++  S+
Sbjct: 578 VLLGRFDLSDSLREDAYEVVQALLSRGHYVGMVTGDNHEAAMHVSHALGIPLNNVF--SE 635

Query: 700 EIVDSMVMTGSQFDGLSEEEVDDLPVLPLVIARCSPQTKVRMIEALHRRKKFCTMTGDGV 759
            +                                 P+ K  ++  L ++  +    GDG+
Sbjct: 636 RL---------------------------------PEGKCDVLRQLRQKYDYVAFIGDGI 662

Query: 760 NDSPSLKMANVGIAMGINGSDVSKEASDIVLSDDNFA----SILNAVEEGRRMTDNIQ 813
           NDS +L  +++GI++  N SD+  +A+ IV+ D + A     IL A++  R   + ++
Sbjct: 663 NDSVALAESDLGISLSGN-SDIVADAAGIVVLDHSSAPPLTRILYAIDLARATFNRVK 719

 Score = 38.9 bits (89), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 50/88 (56%), Gaps = 5/88 (5%)

Query: 105 VLIGLVQEYKA-TKTMNSLKNL--SSPNAHVIR-NGKSETINSKDVVPGDICLVKVGDTI 160
           + +G + E +A  +  +SL  +  S+P+   IR +G    +  + +  GD+ +++ G  +
Sbjct: 225 ICVGKLLESRARARAADSLARMVSSAPSMCTIRESGSDREVEVELLQAGDVVVMRPGTKL 284

Query: 161 PADLRLIETKNFDTDESLLTGESLPVSK 188
           PAD  ++E +  + DESL+TGES  V K
Sbjct: 285 PADGTVLEGEA-EVDESLMTGESTLVPK 311

>Scas_636.16
          Length = 1554

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 138/669 (20%), Positives = 238/669 (35%), Gaps = 150/669 (22%)

Query: 317  AICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIV--RKLDS---------LEALGAVND 365
            A+ +  S++P SL + + I +    A+ +  +V++   +LD           + LG +  
Sbjct: 584  AVILYQSLVPISLYISVEI-IKTAQAIFIYLDVLLYNERLDYPCTPKSWSISDDLGQIEY 642

Query: 366  ICSDKTGTLTQGKMLARQIWIPRFGTITISNSDDPFNPNEGNVSLIPRFSPYEYSHNEDG 425
            I SDKTGTLTQ  M         F   TI+         E    L  R            
Sbjct: 643  IFSDKTGTLTQNVM--------EFKKCTINGVSYGRAYTEALAGLRKR------------ 682

Query: 426  DVGILQNFKDRLYEKDLPED--IDMDLFQKWLETATL--ANIATVFKDDATDCWKAHGDP 481
              GI    + R+  + + +D  I +D  +K    +      +  V K+ + D    +G+ 
Sbjct: 683  -QGIDTEKEGRIEREGIAQDREIMIDDLRKISNNSQFYPEELTFVSKEFSQDLLGNNGEV 741

Query: 482  TEIAIQVFATKMDLPHNALTGEKSTNQSNE-------NDQSSLSQHNEKPG--------- 525
             +   Q F   + L H+ L  E   N  N+        D+++L       G         
Sbjct: 742  QQKRCQHFMLALALCHSVLV-EPDKNDPNKLELTAQSPDETALVTTARDMGFSFIGKTKQ 800

Query: 526  ---------SAQFEHIAEFPFDSTVKRMSSVYY-----NNHNETYNIYGKGAFESIISCC 571
                       +F+ +    F+S+ KRMS +               +  KGA   I S  
Sbjct: 801  GLLVEVQGIQKEFQILNILEFNSSRKRMSCIVKLPPATEKDEPRALLICKGADSVIYSRL 860

Query: 572  SSWYGKDGVKITPLTDCDVETIRKNVYSLSNEGLRVLGFASKSFTKDQVND-DQLKNITS 630
            S   G +   +   T   +E         + EGLR L    +  +  +  + ++  NI +
Sbjct: 861  SRKPGYNDETLLEKTALHLE-------QYATEGLRTLCVGQREISWSEYQEWNEKYNIAA 913

Query: 631  NRATA------------ESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVG 678
                             E DLV LG   I D  ++    ++    +AGI + +LTGD V 
Sbjct: 914  ASLAGREEELDHVADLIERDLVLLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVE 973

Query: 679  TAKAIAQEVGILPTNLYHY---------------SQEIVDSMV---------MTGSQFDG 714
            TA  I     +L T++                    EIV+++V         MTGS+ + 
Sbjct: 974  TAINIGFSCNLLNTDMELLVIKTTGEDVKEFGDDPTEIVNALVSKYLMEKFNMTGSE-EE 1032

Query: 715  LSEEEVDDLP---------------------------------VLPLVIARCSPQTKVRM 741
            L+  + D  P                                    ++  R SP  K  +
Sbjct: 1033 LAAAKKDHSPPQGEFAIIIDGEALKIALTGDTMKRKFLLLCKNCKAVLCCRVSPAQKAAV 1092

Query: 742  IEALHRRKKFCTMT-GDGVNDSPSLKMANVGIAMGINGSDVSKEASDIVLSDDNFASILN 800
            ++ +       T+  GDG ND   ++ A+VG+ +       +   SD  +    + + L 
Sbjct: 1093 VKLVKDTLDVMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFRYVTRLV 1152

Query: 801  AVEEGRRMTDNIQKFVLQLLAENVAQALYLIIGLVFRDENGKSVFPLSPVEVLWIIVVTS 860
             V  G+     + + + Q   +NV   L L    V  D +G  +F  + +   + +  TS
Sbjct: 1153 LV-HGKWCYKRLAEMIPQFFYKNVIFTLALFWYGVHNDFDGSYLFEYTYL-TFYNLAFTS 1210

Query: 861  CFPAMGLGL 869
              P + LG+
Sbjct: 1211 -LPVIFLGI 1218

>YDR093W (DNF2) [945] chr4 (631276..636114) Member of the haloacid
            dehalogenase or epoxide hydrolase family, has low
            similarity to familial intrahepatic cholestasis 1 (human
            ATP8B1), which is an aminophospholipid ATPase transporter
            associated with familial intrahepatic cholestasis [4839
            bp, 1612 aa]
          Length = 1612

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 131/648 (20%), Positives = 240/648 (37%), Gaps = 156/648 (24%)

Query: 317  AICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVR--KLDS---------LEALGAVND 365
            A+ +  S++P SL + + I +    A+ +  +V++   KLD           + LG +  
Sbjct: 650  AVILYQSLVPISLYISVEI-IKTAQAIFIYTDVLLYNAKLDYPCTPKSWNISDDLGQIEY 708

Query: 366  ICSDKTGTLTQGKMLARQIWIP--RFGTITISNSDDPFNPNEG-NVSLIPRFSPYEYSHN 422
            I SDKTGTLTQ  M  ++  I    +G    + +       +G +V    R    E + +
Sbjct: 709  IFSDKTGTLTQNVMEFKKCTINGVSYGR-AYTEALAGLRKRQGVDVESEGRREKEEIAKD 767

Query: 423  EDGDVGILQNFKDRLYEKDLPEDIDMDLFQKWLETATLANIATVFKDDATDCWKAHGDPT 482
             +  +  L++  D    +  PED+                   V K+   D   + GD  
Sbjct: 768  RETMIDELRSMSDN--TQFCPEDLTF-----------------VSKEIVEDLKGSSGDHQ 808

Query: 483  EIAIQVFATKMDLPHNALTG------EKSTNQSNENDQSSLSQHNEKPGSA--------- 527
            +   + F   + L H+ L        +K   ++   D+S+L     + G +         
Sbjct: 809  QKCCEHFLLALALCHSVLVEPNKDDPKKLDIKAQSPDESALVSTARQLGYSFVGSSKSGL 868

Query: 528  ---------QFEHIAEFPFDSTVKRMSSVYYNNHNETYNIYG---KGAFESIISCCSSWY 575
                     +F+ +    F+S+ KRMS +          I G   K   ++++ C     
Sbjct: 869  IVEIQGVQKEFQVLNVLEFNSSRKRMSCII--------KIPGSTPKDEPKALLIC----K 916

Query: 576  GKDGVKITPL--TDCDVETIRKNVYSL---SNEGLRVLGFASKSFTKDQV---------- 620
            G D V  + L  T  D   + K    L   + EGLR L  A +  T  +           
Sbjct: 917  GADSVIYSRLDRTQNDATLLEKTALHLEEYATEGLRTLCLAQRELTWSEYERWVKTYDVA 976

Query: 621  ------NDDQLKNITSNRATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTG 674
                   +++L  +T      E +L+ LG   I D  ++    ++    +AGI + +LTG
Sbjct: 977  AASVTNREEELDKVTD---VIERELILLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTG 1033

Query: 675  DFVGTAKAIA----------------------QEVGILPTNLYH--YSQEIVDSMVMTGS 710
            D V TA  I                       +E G  P  + +   ++ + +   M+GS
Sbjct: 1034 DKVETAINIGFSCNVLNNDMELLVVKASGEDVEEFGSDPIQVVNNLVTKYLREKFGMSGS 1093

Query: 711  Q--------------------FDG------LSEEEVDDLPVL------PLVIARCSPQTK 738
            +                     DG      L+ EE+    +L       ++  R SP  K
Sbjct: 1094 EEELKEAKREHGLPQGNFAVIIDGDALKVALNGEEMRRKFLLLCKNCKAVLCCRVSPAQK 1153

Query: 739  VRMIEALHRRKKFCTMT-GDGVNDSPSLKMANVGIAMGINGSDVSKEASDIVLSDDNFAS 797
              +++ + +     T+  GDG ND   ++ A+VG+ +       +   SD  +    + +
Sbjct: 1154 AAVVKLVKKTLDVMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFRYVT 1213

Query: 798  ILNAVEEGRRMTDNIQKFVLQLLAENVAQALYLIIGLVFRDENGKSVF 845
             L  V  G+     + + + Q   +NV   L L    ++ + +G  +F
Sbjct: 1214 RLVLV-HGKWCYKRLAEMIPQFFYKNVIFTLSLFWYGIYNNFDGSYLF 1260

 Score = 32.7 bits (73), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 28/56 (50%), Gaps = 11/56 (19%)

Query: 144 KDVVPGDICLVKVGDTIPADLRL-----------IETKNFDTDESLLTGESLPVSK 188
           K+V  GDI  V   D IPAD+ L           +ETKN D + +L   +SL  SK
Sbjct: 444 KNVKVGDIVRVHNNDEIPADMILLSTSDVDGACYVETKNLDGETNLKVRQSLKCSK 499

>Scas_669.3
          Length = 1638

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 86/377 (22%), Positives = 145/377 (38%), Gaps = 71/377 (18%)

Query: 590  VETIRKNVYSLSNEGLRVLGFASKSFT-------KDQVNDDQLKNITSNRATA------- 635
            +E   + +   S EGLR L ++ K          +D+ +D ++    +NR +        
Sbjct: 992  IEKTIQAIDEFSTEGLRTLVYSYKWVDLQEYQQWEDRYHDAKIS--LTNRKSKIAEVGEE 1049

Query: 636  -ESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPTNL 694
             E DL  LG   I D  +   + A++K  +AGI + MLTGD   TA  I     +    +
Sbjct: 1050 IEQDLQLLGATAIEDKLQEGVSEAIEKIRRAGIKIWMLTGDKRETAINIGYSCKL----I 1105

Query: 695  YHYS---------QEIVDSMVMTGSQ------------FDGLSEEEVDDLPVL------- 726
            Y YS         + I+  M     +             DG +    +  P L       
Sbjct: 1106 YDYSTVVILAKGDENIISKMNAISQEVDSGNVAHCVIIIDGSTLAMFEGNPTLMSVFIEL 1165

Query: 727  -----PLVIARCSPQTKVRMIEALHR-RKKFCTMT-GDGVNDSPSLKMANVGIAMGINGS 779
                  ++  R SP  K  M+  +    K   T+  GDG ND   ++ A++GI +G    
Sbjct: 1166 CTKTDSVICCRASPSQKSLMVTNIRNSNKNLVTLAIGDGANDIAMIQSADIGIGIGGKEG 1225

Query: 780  DVSKEASDIVLSDDNFASILNAVEEGRRMTDNIQKFVLQLLAENVAQALYLIIGLVFRDE 839
              +   +D  ++   F   L  V  GR       KF+L    + +   L  +I   +   
Sbjct: 1226 LQASRTADYSIAQFRFILKLLLV-HGRYNYIRTAKFILCTFFKEITFYLTQLIFQRYTMF 1284

Query: 840  NGKSVFPLSPVEVLWIIVVTSCFPAMGLGL-EK--------AAPDL--MDRPPHDSEVGI 888
            +G S++   P  +     + +  P + +G+ EK          P+L  M R      + I
Sbjct: 1285 SGSSLY--EPWSLSMFNTLFTSLPVLCIGMFEKDLKPMTLLTIPELYSMGRLSQGFNLII 1342

Query: 889  FTWEVIIDTFAYGIIMT 905
            F  E +I   AY +++T
Sbjct: 1343 FG-EWVIQAAAYALLIT 1358

 Score = 35.4 bits (80), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 37/74 (50%), Gaps = 10/74 (13%)

Query: 323 SMIPSSLVVVLTITMSVGAAVM----------VSRNVIVRKLDSLEALGAVNDICSDKTG 372
           ++IP SL V + I  ++ + +M           +     R    LE LG V+ + SDKTG
Sbjct: 496 TIIPLSLYVTMEIIKAMQSKMMEWDIDMYHSETNTPCESRTATILEELGQVSYMFSDKTG 555

Query: 373 TLTQGKMLARQIWI 386
           TLT  KM+ R+  I
Sbjct: 556 TLTDNKMIFRKFSI 569

>Scas_227.0d
          Length = 307

 Score = 35.4 bits (80), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 37/80 (46%), Gaps = 4/80 (5%)

Query: 536 PFDSTVKRMSSVYYNNHNETYNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDVETIRK 595
           PF+ST K    +     +  Y  + KGA E + + C S    D   +T     + + I K
Sbjct: 190 PFESTRKWGGIIVKYKESNLYRFFIKGAAEIVSNNCHSKRNSDDSIVT----LNKDQINK 245

Query: 596 NVYSLSNEGLRVLGFASKSF 615
            + +L+N+ LR L  A + F
Sbjct: 246 EIENLANDALRALSLAHRDF 265

>KLLA0C17644g 1557138..1561868 similar to sp|P32660 Saccharomyces
            cerevisiae YER166w, start by similarity
          Length = 1576

 Score = 35.4 bits (80), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 185/897 (20%), Positives = 324/897 (36%), Gaps = 192/897 (21%)

Query: 125  LSSPNAHVIRNGKSETINSKDVVPGDICLVKVGDTIPADLRL-----------IETKNFD 173
            L  P+  V+ + K      K V  GDI  V   D IPAD+ L           +ETKN D
Sbjct: 425  LLDPSLPVLPDCKFAKDYWKSVSVGDIVRVHNNDEIPADIILLSSSDSDGACYVETKNLD 484

Query: 174  TDESLLTGESLPVS----KDANLVFGKEEETSVGDRLNLAFSSSAVVK--GRAKGIVIKT 227
             + +L   +SL  S       N+   K +  S G   NL +S    +K   R  G+    
Sbjct: 485  GETNLKVRQSLKCSHMIRNSRNITRTKFKVESEGPHSNL-YSYQGNLKWVDRETGLEKNE 543

Query: 228  ALNSE----IGKIAKSLQGDSGLIS-RDPSKSWLQNTWISTKKVTGAFLGTNVGTPLHRK 282
             +N       G   ++ +   G++    P    + N  ++  KV+      N+   ++  
Sbjct: 544  PVNINNLLLRGCTLRNTKWAMGIVVFTGPDTKIMLNAGVTPTKVSRISRELNLSVFMNFA 603

Query: 283  LSKLAVLLFWIAVLFAIIVM---ASQKFDVDKRVA-------IYAICVAL----SMIPSS 328
            L  L VL F   ++  +       S+ +     +A       + +  VAL    S++P S
Sbjct: 604  L--LFVLCFAAGIVNGVYYRTDNTSRNYFEFGSIAGSAAANGVVSFWVALILYQSVVPIS 661

Query: 329  LVVVLTITMSVGAAVMVSRNVIV--RKLDS---------LEALGAVNDICSDKTGTLTQG 377
            L + + I +    A+ +  +V +   +LD           + LG +  I SDKTGTLTQ 
Sbjct: 662  LYISIEI-IKTAQALFIYGDVALYNERLDYPCTPKSWTISDDLGQIEYIFSDKTGTLTQN 720

Query: 378  KMLARQIWIPRFGTITISNSDDPFNPNEGNVSLIPRFSPYEYSHNEDGDVGILQNFKDRL 437
             M         F   TI+         E    L  R              GI    +  L
Sbjct: 721  VM--------EFKKCTINGVSYGRAYTEALAGLRKR-------------QGIDVEEEGAL 759

Query: 438  YEKDLPEDIDMDL--FQKWLETATL--ANIATVFKDDATDCWKAHGDPTEIAIQVFATKM 493
             ++ + +D ++ L   +   E + L   N+  V K+   D   A+G+  +   + F   +
Sbjct: 760  EKEGIAQDKEIMLANLKILGENSQLRPENVTFVSKEFVQDTAGANGETQKKCNENFMLAL 819

Query: 494  DLPHNALTGEKSTN------QSNENDQSSLSQHNEKPG------------------SAQF 529
             L H  L  E   +      ++   D+++L       G                    ++
Sbjct: 820  ALCHTVLVEENKDDPEIMDFKAQSPDEAALVGTARDMGFSFVGRTKNGVIVDIQGVQKEY 879

Query: 530  EHIAEFPFDSTVKRMSSVYY---NNHNETYNIYGKGAFESIISCCSSWYGKDGVKITPLT 586
              +    F+ST KRMS +      N NE           +++ C     G D +  + L+
Sbjct: 880  RLLNVLEFNSTRKRMSCILKIPSENPNEEP--------RALLIC----KGADSIIYSRLS 927

Query: 587  -DCDVETIRKNVYSL---SNEGLRVLGFASKSFTKDQVND-------------DQLKNIT 629
             + D + + K    L   + EGLR L  A +  +  +  +             D+   + 
Sbjct: 928  KNNDEKLLEKTALHLEQYATEGLRTLCIAQRELSWKEYQEWNEKHEIAAAALVDREDEME 987

Query: 630  SNRATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGI 689
                  E +L  LG   I D  ++    ++    +AGI + +LTGD V TA  I     +
Sbjct: 988  KVADVIERELTLLGGTAIEDRLQDGVPDSIATLGEAGIKLWVLTGDKVETAINIGFSCNL 1047

Query: 690  LPTNLY---------------HYSQEIVDSMV---------MTGSQFDGLSEEEVDDLPV 725
            L   +                    EIV +++         M+GS  +    ++V + P 
Sbjct: 1048 LNNEMELLVIKASGDDVDIYGSKPAEIVKNLILKYLQEKFQMSGSYEELEEAKKVHEPPT 1107

Query: 726  ------------------------LPLVIARC--------SPQTKVRMIEALHRRKKFCT 753
                                      L+  RC        SP  K  +++ +       T
Sbjct: 1108 GNFGVIIDGDALKLALRNDDVKREFLLLCKRCKAVLCCRVSPAQKAAVVKLVKNTLDVMT 1167

Query: 754  MT-GDGVNDSPSLKMANVGIAMGINGSDVSKEASDIVLSDDNFASILNAVEEGRRMTDNI 812
            +  GDG ND   ++ A++G+ +       +  +SD  +    + + L  V  GR     +
Sbjct: 1168 LAIGDGSNDVAMIQSADIGVGIAGEEGRQAVMSSDYAIGQFRYLTRLVLV-HGRWSYKRM 1226

Query: 813  QKFVLQLLAENVAQALYLIIGLVFRDENGKSVFPLSPVEVLWIIVVTSCFPAMGLGL 869
             + +     +NV   L L    V+ + +G  +F  + +  L+ +  TS  P + LG+
Sbjct: 1227 AEMIPLFFYKNVIFTLSLFWYGVYNNYDGSYLFEYTYL-TLFNLAFTS-LPVIFLGI 1281

>Scas_505.4
          Length = 1025

 Score = 35.4 bits (80), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 60/251 (23%), Positives = 102/251 (40%), Gaps = 33/251 (13%)

Query: 728 LVIARCSPQTKVRMIEALHRRKKFCTMT-GDGVNDSPSLKMANVGIAM-GINGSDVSKEA 785
           +V  R SP  K  +++ + R+     +  GDG ND   ++ A+VG+ + G+ G   ++ A
Sbjct: 589 VVCCRVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSA 648

Query: 786 SDIVLSDDNFASILNAVEEGRRMTDNIQKFVLQLLAENVAQALYLI-IGLVFRDE-NGKS 843
            DI +    F   L  V  G      I   +L    +N   ALY+     VF +  +G+S
Sbjct: 649 -DIAVGQFRFLKKLLLV-HGSWSYQRISVAILYSFYKNT--ALYMTQFWFVFANAFSGQS 704

Query: 844 VFPLSPVEVLWIIVVTSCFPAMGLGL--EKAAPDLMDRPPHDSEVG---------IFTWE 892
           +  +    + +  V  + FP   +G+  +  +  L++R P   ++G         IF W 
Sbjct: 705 I--MESWTMSYYNVFFTVFPPFVIGVFDQFVSSRLLERYPQLYKLGQQGKFFSVRIF-WG 761

Query: 893 VIIDTFAYGIIMTGSCMASFTGSLYGINSGRLGHDCD------GTYNSSCRDVYRSRSAA 946
            I++ F +  ++    M  +    YG+     G   D        Y SS   V     AA
Sbjct: 762 WIVNGFYHSAVVYIGTMLFYR---YGMALNMHGEVADHWSWGIAVYTSSILIVL--GKAA 816

Query: 947 FATMTWCALIL 957
             T  W    L
Sbjct: 817 LVTNQWTKFTL 827

 Score = 30.8 bits (68), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 50/227 (22%), Positives = 87/227 (38%), Gaps = 31/227 (13%)

Query: 91  WITGGVISFVIAVNVLIGLVQEYKATKTMNSLKNLSSPNAHVIRNGKSETINSK--DVVP 148
           + T G +  V+ V+     +++    K  NS K L++    +      + I  +  D+  
Sbjct: 287 YTTVGTLMVVLIVSAFKESIED---IKRANSDKELNNSKTEIYSEENGDFIERRWIDIRA 343

Query: 149 GDICLVKVGDTIPADLRLIETKNFDTDESLLTGESLPVSKDANLVF--GKEEETSVGDRL 206
           GD+  VK  + IPADL +I +      E L   E+  +  + NL     + E   + D  
Sbjct: 344 GDVIRVKSEEAIPADLIVISSSE---PEGLCYIETANLDGETNLKIKQARPETAEMMDSR 400

Query: 207 NLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLISRDPSK-----------SW 255
            L            KG VI    NS +     +L+ ++  I   P +           SW
Sbjct: 401 KL---------NNFKGKVISEQPNSSLYTYEGTLEFNNRKIPLSPEQMILRGATLRNTSW 451

Query: 256 LQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAIIVM 302
           +    I T   T   +     TP+ R   +  + L  +A+   +IV+
Sbjct: 452 MFGLVIFTGHET-KLMRNATATPIKRTAVERVINLQIVALFGVLIVL 497

>YOR273C (TPO4) [5059] chr15 complement(834449..836428) Polyamine
            transport protein, member of the multidrug-resistance
            12-spanner (DHA12) family of the major facilitator
            superfamily (MFS-MDR) [1980 bp, 659 aa]
          Length = 659

 Score = 34.3 bits (77), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 35/81 (43%), Gaps = 9/81 (11%)

Query: 991  FLFWSIIFGFVSAFPVVYIPVINDKVFLHKPIGAEWGLAIAFTIAFWIGAELYKCGKRRY 1050
            F+F +I+FGF  A+ V+Y      +   H  +G      I   +  WIGA  Y    R+Y
Sbjct: 328  FIF-AILFGFFEAYAVIY------RGVYHMSMGISGLPFIGIGVGLWIGAFFYLYIDRKY 380

Query: 1051 F--KTQRAHNPENDLESNNKR 1069
               K      P  + E  +KR
Sbjct: 381  LFPKPPAGTQPLTEKERTSKR 401

>AER339C [2840] [Homologous to ScYOR273C (TPO4) - SH]
            (1259842..1261563) [1722 bp, 573 aa]
          Length = 573

 Score = 34.3 bits (77), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 39/89 (43%), Gaps = 15/89 (16%)

Query: 991  FLFWSIIFGFVSAFPVVYIPVINDKVFLHKPIGAEWGLAIAFTIAFWIGAELYKCGKRRY 1050
            F+F S++F F  A+P ++      +   H  +G      I  ++  W+G  LY    R+Y
Sbjct: 310  FVF-SVLFAFFEAYPTIF------RGVYHFTMGQTGLTFIGISVGLWLGMMLYVWYDRKY 362

Query: 1051 F------KTQRAHNPEN--DLESNNKRDP 1071
            F       T    NP++  D     +RDP
Sbjct: 363  FFPPAPPGTPLLANPQSIRDQPMRGRRDP 391

>YGR208W (SER2) [2158] chr7 (911886..912815) Phosphoserine
           phosphatase, involved in synthesis of serine from
           3-phosphoglycerate [930 bp, 309 aa]
          Length = 309

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 28/116 (24%), Positives = 48/116 (41%), Gaps = 19/116 (16%)

Query: 660 KKFHQAGINVHMLTGDFVGTAKAIAQEVGI--LPTNLYHYSQEIVDSMVMTGSQFDGLSE 717
           K  H+    + +L+G F+  A  I  ++G+     NL     E+     +TG        
Sbjct: 173 KFLHKKNCKLAVLSGGFIQFAGFIKDQLGLDFCKANLL----EVDTDGKLTGKTLG---- 224

Query: 718 EEVDDLPVLPLVIARCSPQTKVRMIEALHRRKKFCTMTGDGVNDSPSLKMANVGIA 773
                    P+V  +C  +T +++    +   +   M GDG ND P++  A  GIA
Sbjct: 225 ---------PIVDGQCKSETLLQLCNDYNVPVEASCMVGDGGNDLPAMATAGFGIA 271

>CAGL0K00825g complement(86502..87389) similar to sp|P42941
           Saccharomyces cerevisiae YGR208w Phosphoserine
           phosphatase, start by similarity
          Length = 295

 Score = 32.3 bits (72), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 50/114 (43%), Gaps = 19/114 (16%)

Query: 662 FHQAGINVHMLTGDFVGTAKAIAQEVGI--LPTNLYHYSQEIVDSMVMTGSQFDGLSEEE 719
             Q GI + +L+G F+  A  I  ++ +     NL     E+ DS V+TG          
Sbjct: 168 LKQHGIKLAVLSGGFIQFASYIKDQLSLDYARANLL----EMDDSGVLTGE--------- 214

Query: 720 VDDLPVLPLVIARCSPQTKVRMIEALHRRKKFCTMTGDGVNDSPSLKMANVGIA 773
                +  +V  +C  +T  ++ +      +   M GDG ND PS+ ++  GIA
Sbjct: 215 ----VIGEIVDGQCKAETIKQLCKDWSIDLENVCMIGDGGNDLPSMHVSGYGIA 264

>Scas_536.7
          Length = 1051

 Score = 32.3 bits (72), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 27/49 (55%), Gaps = 6/49 (12%)

Query: 388 RFGTIT---ISNSDDPFNP---NEGNVSLIPRFSPYEYSHNEDGDVGIL 430
           R GT+T    SN+  PFNP   NE N +L     P   + +EDGD+G L
Sbjct: 474 RGGTVTDSTTSNTPAPFNPENPNEVNKTLASAPHPLSNTFDEDGDLGTL 522

>Scas_463.3
          Length = 315

 Score = 31.6 bits (70), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 24/46 (52%)

Query: 728 LVIARCSPQTKVRMIEALHRRKKFCTMTGDGVNDSPSLKMANVGIA 773
           +V  +C  +T + + E      +   M GDG ND P++ +A  GIA
Sbjct: 228 IVDGQCKAETLLELCEKYQCPVEASCMVGDGGNDLPAMSVAGFGIA 273

>YLR057W (YLR057W) [3474] chr12 (255307..257856) Member of the
           glycosyl hydrolase 47 family of alpha-mannosidases, has
           a region of low similarity to a region of
           alpha1,2-mannosidase (human MAN1B1), which acts in the
           first mannose trimming step in synthesizing Asn-linked
           oligosaccharides [2550 bp, 849 aa]
          Length = 849

 Score = 32.0 bits (71), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 44/100 (44%), Gaps = 8/100 (8%)

Query: 650 PPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVG-----ILPTNLYHYSQEIVDS 704
           P  NE    ++K +   +    L G  +G +  +    G     ILP++L   S+ I +S
Sbjct: 539 PTTNELDVTIRKSYDVSLYSCRLGG-ILGLSSRVPHRGGVNTKYILPSSLLEMSEIITES 597

Query: 705 MVMTGSQFDGLSEEEVDDLPVLPLVIARC--SPQTKVRMI 742
             M   +FDGL  ++ +  P        C  + +TK RMI
Sbjct: 598 CFMLMEEFDGLLPQKFELDPCTDETNGNCEFNGETKSRMI 637

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.134    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 35,129,784
Number of extensions: 1553336
Number of successful extensions: 4664
Number of sequences better than 10.0: 95
Number of HSP's gapped: 4625
Number of HSP's successfully gapped: 194
Length of query: 1072
Length of database: 16,596,109
Length adjustment: 112
Effective length of query: 960
Effective length of database: 12,718,893
Effective search space: 12210137280
Effective search space used: 12210137280
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)