Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YDR037W (KRS1)59158130170.0
Scas_661.2862158327910.0
CAGL0K12012g59158227630.0
Sklu_2357.258858127340.0
Kwal_27.1054159158127210.0
AGR037C58958127070.0
KLLA0F18392g58858326720.0
CAGL0J10230g5434846545e-78
Scas_633.285924806384e-75
KLLA0F04796g5174606326e-75
Kwal_23.47175274946143e-72
YNL073W (MSK1)5764995702e-65
AER362W5254735523e-63
CAGL0D06556g5534792148e-18
ADL039C5564852148e-18
YLL018C (DPS1)5574832131e-17
Scas_347.35524822076e-17
Sklu_2189.35585031979e-16
KLLA0D03839g5554821906e-15
Kwal_27.122356501991622e-11
Sklu_2265.35604881497e-10
Sklu_1963.16551421452e-09
YHR019C (DED81)5544721417e-09
Kwal_14.23034752671408e-09
KLLA0A08426g5544741399e-09
YPL104W (MSD1)6581351311e-07
KLLA0E24486g6452601283e-07
KLLA0A11484g4743781273e-07
AGR206C6511291212e-06
AEL020W5523381193e-06
CAGL0H05907g6591471151e-05
Scas_700.66581931141e-05
CAGL0A02112g5484931095e-05
Scas_607.145553391085e-05
Kwal_0.375428286960.001
CAGL0K07656g49764780.20
KLLA0C18612g2140113790.23
AFR516W49950770.31
Scas_707.1449950770.31
KLLA0F25234g49950760.34
Kwal_47.1799849950750.44
YFL022C (FRS2)50350740.72
Scas_628.24487339701.8
Scas_717.11128081702.3
KLLA0F24200g65263692.6
CAGL0L08030g46739692.7
ADR179C33226665.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YDR037W
         (581 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YDR037W (KRS1) [890] chr4 (525435..527210) Lysyl-tRNA synthetase...  1166   0.0  
Scas_661.28                                                          1079   0.0  
CAGL0K12012g 1159164..1160939 highly similar to sp|P15180 Saccha...  1068   0.0  
Sklu_2357.2 YDR037W, Contig c2357 1101-2867                          1057   0.0  
Kwal_27.10541                                                        1052   0.0  
AGR037C [4347] [Homologous to ScYDR037W (KRS1) - SH] (775332..77...  1047   0.0  
KLLA0F18392g 1693928..1695694 highly similar to sp|P15180 Saccha...  1033   0.0  
CAGL0J10230g complement(998449..1000080) similar to sp|P32048 Sa...   256   5e-78
Scas_633.28                                                           250   4e-75
KLLA0F04796g complement(466476..468029) similar to sp|P32048 Sac...   248   6e-75
Kwal_23.4717                                                          241   3e-72
YNL073W (MSK1) [4517] chr14 (488385..490115) Lysyl-tRNA syntheta...   224   2e-65
AER362W [2863] [Homologous to ScYNL073W (MSK1) - SH] complement(...   217   3e-63
CAGL0D06556g 623770..625431 highly similar to sp|P04802 Saccharo...    87   8e-18
ADL039C [1702] [Homologous to ScYLL018C (DPS1) - SH] (620628..62...    87   8e-18
YLL018C (DPS1) [3401] chr12 complement(109901..111574) Aspartyl-...    87   1e-17
Scas_347.3                                                             84   6e-17
Sklu_2189.3 YLL018C, Contig c2189 5672-7348 reverse complement         80   9e-16
KLLA0D03839g 324274..325941 highly similar to sp|P04802 Saccharo...    78   6e-15
Kwal_27.12235                                                          67   2e-11
Sklu_2265.3 YHR019C, Contig c2265 4970-6652                            62   7e-10
Sklu_1963.1 YPL104W, Contig c1963 1525-3492 reverse complement         60   2e-09
YHR019C (DED81) [2305] chr8 complement(141886..143550) Asparagin...    59   7e-09
Kwal_14.2303                                                           59   8e-09
KLLA0A08426g complement(745048..746712) similar to sp|P38707 Sac...    58   9e-09
YPL104W (MSD1) [5340] chr16 (355695..357671) Aspartyl-tRNA synth...    55   1e-07
KLLA0E24486g complement(2173560..2175497) similar to sp|P15179 S...    54   3e-07
KLLA0A11484g 992734..994158 similar to sp|P25345 Saccharomyces c...    54   3e-07
AGR206C [4517] [Homologous to ScYPL104W (MSD1) - SH] (1144536..1...    51   2e-06
AEL020W [2486] [Homologous to ScYHR019C (DED81) - SH] complement...    50   3e-06
CAGL0H05907g complement(579444..581423) similar to sp|P15179 Sac...    49   1e-05
Scas_700.6                                                             49   1e-05
CAGL0A02112g 216596..218242 highly similar to sp|P38707 Saccharo...    47   5e-05
Scas_607.14                                                            46   5e-05
Kwal_0.375                                                             42   0.001
CAGL0K07656g 761388..762881 highly similar to sp|P15625 Saccharo...    35   0.20 
KLLA0C18612g 1646511..1652933 similar to sp|P25655 Saccharomyces...    35   0.23 
AFR516W [3708] [Homologous to ScYFL022C (FRS2) - SH] complement(...    34   0.31 
Scas_707.14                                                            34   0.31 
KLLA0F25234g complement(2349192..2350691) highly similar to sp|P...    34   0.34 
Kwal_47.17998                                                          33   0.44 
YFL022C (FRS2) [1661] chr6 complement(93497..95008) Phenylalanyl...    33   0.72 
Scas_628.24                                                            32   1.8  
Scas_717.11                                                            32   2.3  
KLLA0F24200g 2257007..2258965 similar to sp|P53918 Saccharomyces...    31   2.6  
CAGL0L08030g 875106..876509 similar to sp|P25345 Saccharomyces c...    31   2.7  
ADR179C [1920] [Homologous to ScYML015C (TAF40) - SH] (1017982.....    30   5.3  

>YDR037W (KRS1) [890] chr4 (525435..527210) Lysyl-tRNA synthetase,
           cytoplasmic [1776 bp, 591 aa]
          Length = 591

 Score = 1166 bits (3017), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 562/581 (96%), Positives = 562/581 (96%)

Query: 1   MSQQDNVKAAAEGVANLHLDEATGEMVSKSELKKRIKQRQVEXXXXXXXXXXXXXXXXXX 60
           MSQQDNVKAAAEGVANLHLDEATGEMVSKSELKKRIKQRQVE                  
Sbjct: 1   MSQQDNVKAAAEGVANLHLDEATGEMVSKSELKKRIKQRQVEAKKAAKKAAAQPKPASKK 60

Query: 61  XTDLFADLDPSQYFETRSRQIQELRKTHEPNPYPHKFHVSISNPEFLAKYAHLKKGETLP 120
            TDLFADLDPSQYFETRSRQIQELRKTHEPNPYPHKFHVSISNPEFLAKYAHLKKGETLP
Sbjct: 61  KTDLFADLDPSQYFETRSRQIQELRKTHEPNPYPHKFHVSISNPEFLAKYAHLKKGETLP 120

Query: 121 EEKVSIAGRIHAKRESGSKLKFYVLHGDGVEVQLMSQLQDYCDPDSYEKDHDLLKRGDIV 180
           EEKVSIAGRIHAKRESGSKLKFYVLHGDGVEVQLMSQLQDYCDPDSYEKDHDLLKRGDIV
Sbjct: 121 EEKVSIAGRIHAKRESGSKLKFYVLHGDGVEVQLMSQLQDYCDPDSYEKDHDLLKRGDIV 180

Query: 181 GVEGYVGRTQPKKGGEGEVSVFVSRVQLLTPCLHMLPADHFGFKDQETRYRKRYLDLIMN 240
           GVEGYVGRTQPKKGGEGEVSVFVSRVQLLTPCLHMLPADHFGFKDQETRYRKRYLDLIMN
Sbjct: 181 GVEGYVGRTQPKKGGEGEVSVFVSRVQLLTPCLHMLPADHFGFKDQETRYRKRYLDLIMN 240

Query: 241 KDARNRFITRSEIIRYIRRFLDQRKFIEVETPMMNVIAGGATAKPFITHHNDLDMDMYMR 300
           KDARNRFITRSEIIRYIRRFLDQRKFIEVETPMMNVIAGGATAKPFITHHNDLDMDMYMR
Sbjct: 241 KDARNRFITRSEIIRYIRRFLDQRKFIEVETPMMNVIAGGATAKPFITHHNDLDMDMYMR 300

Query: 301 IAPELFLKQLVVGGLDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTELM 360
           IAPELFLKQLVVGGLDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTELM
Sbjct: 301 IAPELFLKQLVVGGLDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTELM 360

Query: 361 FSEMVKEITGSYIIKYHPDPADPAKELELNFSRPWKRINMIEELEKVFNVKFPSGDQLHT 420
           FSEMVKEITGSYIIKYHPDPADPAKELELNFSRPWKRINMIEELEKVFNVKFPSGDQLHT
Sbjct: 361 FSEMVKEITGSYIIKYHPDPADPAKELELNFSRPWKRINMIEELEKVFNVKFPSGDQLHT 420

Query: 421 AETGEFLKKILVDNKLECPPPLTNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAKYSR 480
           AETGEFLKKILVDNKLECPPPLTNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAKYSR
Sbjct: 421 AETGEFLKKILVDNKLECPPPLTNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAKYSR 480

Query: 481 DQPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLVDETFCNAL 540
           DQPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLVDETFCNAL
Sbjct: 481 DQPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLVDETFCNAL 540

Query: 541 EYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFPTLKPDVL 581
           EYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFPTLKPDVL
Sbjct: 541 EYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFPTLKPDVL 581

>Scas_661.28
          Length = 621

 Score = 1079 bits (2791), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 515/583 (88%), Positives = 539/583 (92%), Gaps = 2/583 (0%)

Query: 1   MSQQDNVKAAAEGVANLHLDEATGEMVSKSELKKRIKQRQVEXXXXXXXXXXXXX--XXX 58
           MSQ++ V+  AE VANLHLDEATGEMVSKSELKKRIKQRQVE                  
Sbjct: 31  MSQEEAVQKVAENVANLHLDEATGEMVSKSELKKRIKQRQVEAKKAAKKAAAQPKPESKK 90

Query: 59  XXXTDLFADLDPSQYFETRSRQIQELRKTHEPNPYPHKFHVSISNPEFLAKYAHLKKGET 118
              TDLFADLDPSQYFE RSRQIQELRKT  PNPYPHKF VSISNPEFL KYA+L++GET
Sbjct: 91  KKNTDLFADLDPSQYFEARSRQIQELRKTQSPNPYPHKFKVSISNPEFLKKYAYLQRGET 150

Query: 119 LPEEKVSIAGRIHAKRESGSKLKFYVLHGDGVEVQLMSQLQDYCDPDSYEKDHDLLKRGD 178
           LP EKV+IAGRIHAKRESGSKLKFYVLHGDGVEVQLMSQLQDY +   YEKDHDLLKRGD
Sbjct: 151 LPNEKVAIAGRIHAKRESGSKLKFYVLHGDGVEVQLMSQLQDYNNEADYEKDHDLLKRGD 210

Query: 179 IVGVEGYVGRTQPKKGGEGEVSVFVSRVQLLTPCLHMLPADHFGFKDQETRYRKRYLDLI 238
           IVGVEGYVGRTQPKKGGEGE+SVFVSR++LLTPCLHMLPADHFGFKDQETRYRKRYLDLI
Sbjct: 211 IVGVEGYVGRTQPKKGGEGEISVFVSRIELLTPCLHMLPADHFGFKDQETRYRKRYLDLI 270

Query: 239 MNKDARNRFITRSEIIRYIRRFLDQRKFIEVETPMMNVIAGGATAKPFITHHNDLDMDMY 298
           MNKDAR RFI RS+IIR+IRRFLDQR+FIEVETPMMNVIAGGATAKPF+THHNDLDMDMY
Sbjct: 271 MNKDARGRFIKRSQIIRFIRRFLDQREFIEVETPMMNVIAGGATAKPFVTHHNDLDMDMY 330

Query: 299 MRIAPELFLKQLVVGGLDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTE 358
           MRIAPELFLK+LVVGG+DRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTE
Sbjct: 331 MRIAPELFLKELVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTE 390

Query: 359 LMFSEMVKEITGSYIIKYHPDPADPAKELELNFSRPWKRINMIEELEKVFNVKFPSGDQL 418
           LMFSEMVKEITGSYIIKYHPDP +P KE+ELNF+RPWKR+NMIEELEK FNV FP+GDQL
Sbjct: 391 LMFSEMVKEITGSYIIKYHPDPNNPEKEMELNFTRPWKRMNMIEELEKRFNVTFPAGDQL 450

Query: 419 HTAETGEFLKKILVDNKLECPPPLTNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAKY 478
           HTAETGEFLKK+L DNK+ECPPPLTNARMLDKLVGELED CINPTFIFGHPQMMSPLAKY
Sbjct: 451 HTAETGEFLKKVLADNKMECPPPLTNARMLDKLVGELEDVCINPTFIFGHPQMMSPLAKY 510

Query: 479 SRDQPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLVDETFCN 538
           SRD PGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLVDETFCN
Sbjct: 511 SRDTPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLVDETFCN 570

Query: 539 ALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFPTLKPDVL 581
           ALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFPTLKPDVL
Sbjct: 571 ALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFPTLKPDVL 613

>CAGL0K12012g 1159164..1160939 highly similar to sp|P15180
           Saccharomyces cerevisiae YDR037w KRS1 lysyl-tRNA
           synthetase, start by similarity
          Length = 591

 Score = 1068 bits (2763), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 505/582 (86%), Positives = 534/582 (91%), Gaps = 1/582 (0%)

Query: 1   MSQQDNVKAAAEGVANLHLDEATGEMVSKSELKKRIKQRQVEXXXXXXXXXXXXXXXXXX 60
           MSQ++  KAA EGVANLHLDE TGEMVSKSELKKR+K RQVE                  
Sbjct: 1   MSQEEATKAATEGVANLHLDEVTGEMVSKSELKKRMKARQVEAKKAAKKASAQPKPEPKK 60

Query: 61  X-TDLFADLDPSQYFETRSRQIQELRKTHEPNPYPHKFHVSISNPEFLAKYAHLKKGETL 119
              DL ADLDPSQYFE RSRQI ELRKTH PNPYPHKF VSISNPEFLAKYAHLK+GETL
Sbjct: 61  KKNDLLADLDPSQYFEARSRQILELRKTHSPNPYPHKFQVSISNPEFLAKYAHLKRGETL 120

Query: 120 PEEKVSIAGRIHAKRESGSKLKFYVLHGDGVEVQLMSQLQDYCDPDSYEKDHDLLKRGDI 179
           P E VSIAGRIHAKRESGSKLKFYVLHGDGVEVQ+MSQLQDY D ++YE DHDL+KRGDI
Sbjct: 121 PNEIVSIAGRIHAKRESGSKLKFYVLHGDGVEVQVMSQLQDYADAEAYENDHDLIKRGDI 180

Query: 180 VGVEGYVGRTQPKKGGEGEVSVFVSRVQLLTPCLHMLPADHFGFKDQETRYRKRYLDLIM 239
           VGVEGYVGRTQPKKGGEGE+SVFV R++LLTPCLHMLPADHFGFKDQETRYRKRYLDLIM
Sbjct: 181 VGVEGYVGRTQPKKGGEGEISVFVKRIELLTPCLHMLPADHFGFKDQETRYRKRYLDLIM 240

Query: 240 NKDARNRFITRSEIIRYIRRFLDQRKFIEVETPMMNVIAGGATAKPFITHHNDLDMDMYM 299
           NKD+R RFITRS+II+YIR+FLD R FIEVETPMMNVIAGGATAKPF+THHNDLDMDM+M
Sbjct: 241 NKDSRKRFITRSKIIKYIRKFLDNRDFIEVETPMMNVIAGGATAKPFVTHHNDLDMDMFM 300

Query: 300 RIAPELFLKQLVVGGLDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTEL 359
           RIAPELFLK+LVVGG+DRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTEL
Sbjct: 301 RIAPELFLKELVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTEL 360

Query: 360 MFSEMVKEITGSYIIKYHPDPADPAKELELNFSRPWKRINMIEELEKVFNVKFPSGDQLH 419
           +FSEMVKEI GSY+IKYHPDP +P KE+ELNF+RPWKRINMIEELEK FNV FP+GDQLH
Sbjct: 361 LFSEMVKEINGSYVIKYHPDPNNPEKEMELNFARPWKRINMIEELEKRFNVTFPAGDQLH 420

Query: 420 TAETGEFLKKILVDNKLECPPPLTNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAKYS 479
           T ETGEFL+K+L DN LECPPP+TNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAKYS
Sbjct: 421 TKETGEFLQKVLKDNNLECPPPITNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAKYS 480

Query: 480 RDQPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLVDETFCNA 539
           RDQPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQL+DETFCNA
Sbjct: 481 RDQPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLIDETFCNA 540

Query: 540 LEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFPTLKPDVL 581
           LEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFPTLKPDVL
Sbjct: 541 LEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFPTLKPDVL 582

>Sklu_2357.2 YDR037W, Contig c2357 1101-2867
          Length = 588

 Score = 1057 bits (2734), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 499/581 (85%), Positives = 533/581 (91%)

Query: 1   MSQQDNVKAAAEGVANLHLDEATGEMVSKSELKKRIKQRQVEXXXXXXXXXXXXXXXXXX 60
           MSQ++  KAA E VANLHLDE TGE VSKSELKKRIKQRQ+E                  
Sbjct: 1   MSQEEATKAATESVANLHLDEVTGEKVSKSELKKRIKQRQIEAKKAAKKANAQPKPETKK 60

Query: 61  XTDLFADLDPSQYFETRSRQIQELRKTHEPNPYPHKFHVSISNPEFLAKYAHLKKGETLP 120
             D FADLDPSQYFE RSRQIQELRK+H PNPYPHKFHVSIS P+FL KY +LK+GETLP
Sbjct: 61  KVDTFADLDPSQYFEARSRQIQELRKSHLPNPYPHKFHVSISLPDFLKKYENLKRGETLP 120

Query: 121 EEKVSIAGRIHAKRESGSKLKFYVLHGDGVEVQLMSQLQDYCDPDSYEKDHDLLKRGDIV 180
            EKVSIAGRIHAKRESGSKLKFYVLHGDGVEVQ+MSQLQDY   ++YE+DH LLKRGDIV
Sbjct: 121 NEKVSIAGRIHAKRESGSKLKFYVLHGDGVEVQVMSQLQDYHSEEAYEQDHGLLKRGDIV 180

Query: 181 GVEGYVGRTQPKKGGEGEVSVFVSRVQLLTPCLHMLPADHFGFKDQETRYRKRYLDLIMN 240
           GVEGYVGRTQPKKGGEGE+SVFVSR++LLTPCLHMLPADHFGFKDQETRYRKRYLDLIMN
Sbjct: 181 GVEGYVGRTQPKKGGEGEISVFVSRIELLTPCLHMLPADHFGFKDQETRYRKRYLDLIMN 240

Query: 241 KDARNRFITRSEIIRYIRRFLDQRKFIEVETPMMNVIAGGATAKPFITHHNDLDMDMYMR 300
           KDAR+RFITRS+II +IR+FLD+R FIEVETPMMNVIAGGATAKPF+THHNDL+MDM+MR
Sbjct: 241 KDARSRFITRSKIITFIRKFLDERSFIEVETPMMNVIAGGATAKPFVTHHNDLNMDMFMR 300

Query: 301 IAPELFLKQLVVGGLDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTELM 360
           IAPELFLKQLVVGG+DRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTEL+
Sbjct: 301 IAPELFLKQLVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTELL 360

Query: 361 FSEMVKEITGSYIIKYHPDPADPAKELELNFSRPWKRINMIEELEKVFNVKFPSGDQLHT 420
           FSEMVKEITGSY+IKYHP+P +P  E+ELNF+RPWKRINMIEELEK FNVKFP+GDQLHT
Sbjct: 361 FSEMVKEITGSYVIKYHPNPQNPELEMELNFARPWKRINMIEELEKRFNVKFPAGDQLHT 420

Query: 421 AETGEFLKKILVDNKLECPPPLTNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAKYSR 480
           AETGEFLK IL +NK+EC PPLTNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAKYSR
Sbjct: 421 AETGEFLKNILTENKMECTPPLTNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAKYSR 480

Query: 481 DQPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLVDETFCNAL 540
           D PGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDE QL+DETFCNAL
Sbjct: 481 DVPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEVQLIDETFCNAL 540

Query: 541 EYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFPTLKPDVL 581
           EYGLPPTGGWGCG+DRLAMFLTDSNTIREVLLFPTLKPDVL
Sbjct: 541 EYGLPPTGGWGCGVDRLAMFLTDSNTIREVLLFPTLKPDVL 581

>Kwal_27.10541
          Length = 591

 Score = 1052 bits (2721), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 498/581 (85%), Positives = 532/581 (91%), Gaps = 1/581 (0%)

Query: 1   MSQQDNVKAAAEGVANLHLDEATGEMVSKSELKKRIKQRQVEXXXXXXXXXXXXXXX-XX 59
           MSQ++ VK+A + +ANLHLDEATGEMVSKSELKKR KQRQVE                  
Sbjct: 1   MSQEEAVKSANDAIANLHLDEATGEMVSKSELKKRAKQRQVEAKKAAKKASAQPKPEPKK 60

Query: 60  XXTDLFADLDPSQYFETRSRQIQELRKTHEPNPYPHKFHVSISNPEFLAKYAHLKKGETL 119
              D FADLDPSQYFE RSRQIQEL+KT  PNPYPHKFHVSI   EFL KYAHL++GETL
Sbjct: 61  KANDAFADLDPSQYFEARSRQIQELKKTQSPNPYPHKFHVSIGLSEFLQKYAHLQRGETL 120

Query: 120 PEEKVSIAGRIHAKRESGSKLKFYVLHGDGVEVQLMSQLQDYCDPDSYEKDHDLLKRGDI 179
           PEEKVSIAGR+HAKRESGSKLKFYVLHGDGVEVQLMSQLQDY    +YE DHDL+KRGDI
Sbjct: 121 PEEKVSIAGRVHAKRESGSKLKFYVLHGDGVEVQLMSQLQDYGSESAYEADHDLIKRGDI 180

Query: 180 VGVEGYVGRTQPKKGGEGEVSVFVSRVQLLTPCLHMLPADHFGFKDQETRYRKRYLDLIM 239
           +GVEGYVGRTQPKKGGEGE+SVFVSR+QLLTPCLH+LPADHFGFKDQETRYRKRYLDLIM
Sbjct: 181 IGVEGYVGRTQPKKGGEGEISVFVSRIQLLTPCLHILPADHFGFKDQETRYRKRYLDLIM 240

Query: 240 NKDARNRFITRSEIIRYIRRFLDQRKFIEVETPMMNVIAGGATAKPFITHHNDLDMDMYM 299
           NKDAR RFITRS+II YIR+FLD+R FIEVETPMMNVIAGGATAKPF+THHNDL+MDM+M
Sbjct: 241 NKDARPRFITRSKIISYIRKFLDERNFIEVETPMMNVIAGGATAKPFVTHHNDLNMDMFM 300

Query: 300 RIAPELFLKQLVVGGLDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTEL 359
           RIAPELFLK+LVVGG++RVYEIGRQFRNEGIDMTHNPEFTTCEFYQA+ADVYDLMDMTE+
Sbjct: 301 RIAPELFLKELVVGGMERVYEIGRQFRNEGIDMTHNPEFTTCEFYQAFADVYDLMDMTEV 360

Query: 360 MFSEMVKEITGSYIIKYHPDPADPAKELELNFSRPWKRINMIEELEKVFNVKFPSGDQLH 419
           +FSEMVKEITGSY+IKYHPDP DPAKELELNF+RPWKRINMIEELEK  NVKFP+GD+LH
Sbjct: 361 LFSEMVKEITGSYVIKYHPDPRDPAKELELNFARPWKRINMIEELEKRLNVKFPAGDELH 420

Query: 420 TAETGEFLKKILVDNKLECPPPLTNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAKYS 479
           TAETGEFLK++L +N LECPPPLTNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAK S
Sbjct: 421 TAETGEFLKRVLKENNLECPPPLTNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAKKS 480

Query: 480 RDQPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLVDETFCNA 539
           RD PGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLVDETFCNA
Sbjct: 481 RDIPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLVDETFCNA 540

Query: 540 LEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFPTLKPDV 580
           LEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFPTLKPD 
Sbjct: 541 LEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFPTLKPDT 581

>AGR037C [4347] [Homologous to ScYDR037W (KRS1) - SH]
           (775332..777101) [1770 bp, 589 aa]
          Length = 589

 Score = 1047 bits (2707), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 496/581 (85%), Positives = 530/581 (91%)

Query: 1   MSQQDNVKAAAEGVANLHLDEATGEMVSKSELKKRIKQRQVEXXXXXXXXXXXXXXXXXX 60
           MS++  V+  AE VANLHLDE TGEMVSKSELKKRIKQRQVE                  
Sbjct: 1   MSEEAAVQQVAENVANLHLDEVTGEMVSKSELKKRIKQRQVEAKKAAKKATSKPKPEPKK 60

Query: 61  XTDLFADLDPSQYFETRSRQIQELRKTHEPNPYPHKFHVSISNPEFLAKYAHLKKGETLP 120
             +  ADLDPS+YFE RSRQIQELRKT EPNPYPHKF+V+I  P FL KYAHL++GETLP
Sbjct: 61  KVENMADLDPSKYFEARSRQIQELRKTQEPNPYPHKFNVTIGLPAFLNKYAHLQRGETLP 120

Query: 121 EEKVSIAGRIHAKRESGSKLKFYVLHGDGVEVQLMSQLQDYCDPDSYEKDHDLLKRGDIV 180
           EE+VSIAGRIHAKRESGSKL+FYVLH DGVEVQ+MSQLQDY   ++YE+DH LLKRGDIV
Sbjct: 121 EERVSIAGRIHAKRESGSKLRFYVLHADGVEVQVMSQLQDYHSEEAYEQDHGLLKRGDIV 180

Query: 181 GVEGYVGRTQPKKGGEGEVSVFVSRVQLLTPCLHMLPADHFGFKDQETRYRKRYLDLIMN 240
           GVEGYVGRTQPKKGGEGE+SVFVSR+QLLTPCLHMLPADHFGFKDQETRYRKRYLDLIMN
Sbjct: 181 GVEGYVGRTQPKKGGEGEISVFVSRIQLLTPCLHMLPADHFGFKDQETRYRKRYLDLIMN 240

Query: 241 KDARNRFITRSEIIRYIRRFLDQRKFIEVETPMMNVIAGGATAKPFITHHNDLDMDMYMR 300
           KDAR RFITRS+II YIR+FLD R FIEVETPMMNVIAGGATAKPF+THHNDLDM MYMR
Sbjct: 241 KDARGRFITRSKIITYIRKFLDNRDFIEVETPMMNVIAGGATAKPFVTHHNDLDMQMYMR 300

Query: 301 IAPELFLKQLVVGGLDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTELM 360
           IAPELFLKQLVVGG+DRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTEL+
Sbjct: 301 IAPELFLKQLVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTELL 360

Query: 361 FSEMVKEITGSYIIKYHPDPADPAKELELNFSRPWKRINMIEELEKVFNVKFPSGDQLHT 420
           FSEMVKEITG Y IK+HPDP DP+KE ++NF+RPWKRINMIEELEK FNV FP+GDQLHT
Sbjct: 361 FSEMVKEITGDYKIKFHPDPNDPSKEYDINFARPWKRINMIEELEKRFNVTFPAGDQLHT 420

Query: 421 AETGEFLKKILVDNKLECPPPLTNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAKYSR 480
           AETGEFLKKIL DNK++CPPPLTNARMLDKLVGELEDTCI+PTFIFGHPQMMSPLAK+SR
Sbjct: 421 AETGEFLKKILSDNKMDCPPPLTNARMLDKLVGELEDTCIDPTFIFGHPQMMSPLAKHSR 480

Query: 481 DQPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLVDETFCNAL 540
           DQPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQL+DETFCNAL
Sbjct: 481 DQPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLIDETFCNAL 540

Query: 541 EYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFPTLKPDVL 581
           EYGLPPTGGWGCG+DRLAMFLTDSNTIREVLLFPTLKPDVL
Sbjct: 541 EYGLPPTGGWGCGVDRLAMFLTDSNTIREVLLFPTLKPDVL 581

>KLLA0F18392g 1693928..1695694 highly similar to sp|P15180
           Saccharomyces cerevisiae YDR037w KRS1 lysyl-tRNA
           synthetase, cytosolic, start by similarity
          Length = 588

 Score = 1033 bits (2672), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 499/583 (85%), Positives = 525/583 (90%), Gaps = 2/583 (0%)

Query: 1   MSQQDNVKAAAEGVANLHLDEATGEMVSKSELKKRIKQRQVEXXXXXXXXXXXXXX--XX 58
           MSQ   V AA E VAN+HLDE TGEMVSKSELKKRIKQRQVE                  
Sbjct: 1   MSQPHEVAAATEAVANMHLDELTGEMVSKSELKKRIKQRQVEAKKAAKKATAKPTPEPKK 60

Query: 59  XXXTDLFADLDPSQYFETRSRQIQELRKTHEPNPYPHKFHVSISNPEFLAKYAHLKKGET 118
              TD FADLDPSQYFE RSRQI ELRKTH PNPYPHKF VS++ PEFL+KYA+LK+GET
Sbjct: 61  KANTDAFADLDPSQYFEARSRQINELRKTHSPNPYPHKFQVSVTLPEFLSKYANLKRGET 120

Query: 119 LPEEKVSIAGRIHAKRESGSKLKFYVLHGDGVEVQLMSQLQDYCDPDSYEKDHDLLKRGD 178
           LPEEKVSIAGRIHAKRESGSKLKFYVLHGDGVEVQ+MSQLQDY    SYE DH L+KRGD
Sbjct: 121 LPEEKVSIAGRIHAKRESGSKLKFYVLHGDGVEVQVMSQLQDYHTESSYEDDHSLIKRGD 180

Query: 179 IVGVEGYVGRTQPKKGGEGEVSVFVSRVQLLTPCLHMLPADHFGFKDQETRYRKRYLDLI 238
           IVGVEGYVGRT PKKGGEGE+SVFVSR+QLLTPCLHMLP DHFGFKDQE RYRKRYLDLI
Sbjct: 181 IVGVEGYVGRTSPKKGGEGEISVFVSRIQLLTPCLHMLPTDHFGFKDQELRYRKRYLDLI 240

Query: 239 MNKDARNRFITRSEIIRYIRRFLDQRKFIEVETPMMNVIAGGATAKPFITHHNDLDMDMY 298
           MNKDARNRFITRS+II Y+R+FLD R FIEVETPMMNVIAGGATAKPF+THHNDLDMDMY
Sbjct: 241 MNKDARNRFITRSKIISYVRKFLDTRNFIEVETPMMNVIAGGATAKPFVTHHNDLDMDMY 300

Query: 299 MRIAPELFLKQLVVGGLDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTE 358
           MRIAPELFLK+LVVGG+DRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTE
Sbjct: 301 MRIAPELFLKELVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTE 360

Query: 359 LMFSEMVKEITGSYIIKYHPDPADPAKELELNFSRPWKRINMIEELEKVFNVKFPSGDQL 418
           +M SEMVKEITGSY+IKYHPDP D  KELELNF+RPWKRINMIEELE  F+V FP+GDQL
Sbjct: 361 IMISEMVKEITGSYVIKYHPDPNDETKELELNFTRPWKRINMIEELENRFHVTFPAGDQL 420

Query: 419 HTAETGEFLKKILVDNKLECPPPLTNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAKY 478
           HTAETGEFLKK+L DNK++C PPLTNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAKY
Sbjct: 421 HTAETGEFLKKVLKDNKMDCAPPLTNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAKY 480

Query: 479 SRDQPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLVDETFCN 538
           SRDQPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQA QK QGDDEAQLVDETFCN
Sbjct: 481 SRDQPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQANQKAQGDDEAQLVDETFCN 540

Query: 539 ALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFPTLKPDVL 581
           ALEYGLPPTGGWGCGIDRLAMFL DSNTIREVLLFPTLKP+V+
Sbjct: 541 ALEYGLPPTGGWGCGIDRLAMFLADSNTIREVLLFPTLKPEVV 583

>CAGL0J10230g complement(998449..1000080) similar to sp|P32048
           Saccharomyces cerevisiae YNL073w MSK1, hypothetical
           start
          Length = 543

 Score =  256 bits (654), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 168/484 (34%), Positives = 271/484 (55%), Gaps = 26/484 (5%)

Query: 106 FLAKYAHLKKGE-TLPEEKVSIAGRIHAKRESGSKLKFYVLHGDGVE-VQLMSQLQDYCD 163
           FL KY    + +     +K+S+ GRI + R SG K+ F  L  DG+  +QL+   ++  +
Sbjct: 67  FLKKYGSTSEDQLNKINQKISLCGRIKSIRFSGKKMAFIDLV-DGIHGIQLILNCREIGN 125

Query: 164 PDSYEKDHDLLKRGDIVGVEGYVGRTQPKKGGEGEVSVFVSRVQLLTPCLHM-LPADHFG 222
             ++E +   L++GD V   G     +  K     +S+  + +  +     M LP     
Sbjct: 126 SATFESELSFLRKGDYVMTTGL---PRLSKSRMKNISLRCTDLPKILSVAQMPLPPKLI- 181

Query: 223 FKDQETRYRKRYLDLIMNKDARNRFITRSEIIRYIRRFLDQRKFIEVETPMMNVIAGGAT 282
             D       + +D  +N     R   RS I++ IR FL++R FIEVETP+++  + GA 
Sbjct: 182 --DTVKSNSNKVVDYQINGFQNIRI--RSSILKSIRNFLEERDFIEVETPILSSKSNGAV 237

Query: 283 AKPFITHHNDLDMDMYMRIAPELFLKQLVVGGLDRVYEIGRQFRNEGIDMTHNPEFTTCE 342
           AKPF++   D D  + +R+APEL+LK+L++ G ++V+EIG+ FRNEGID +HNPEFTT E
Sbjct: 238 AKPFMSSSKDFD-KLMLRVAPELWLKRLIISGCNKVFEIGKSFRNEGIDGSHNPEFTTLE 296

Query: 343 FYQAYADVYDLMDMTELMFSEMVKEITGSYIIK-YHPDPADPAKELELNFSRPWKRINMI 401
           FYQ+Y  + DL+ + E +F +++ ++T +  IK Y P+     +++  + +  +KR+  +
Sbjct: 297 FYQSYLTMEDLIKLNEDLFKKIITDLTNNLTIKQYLPESLLELEDILKSNNWKFKRVEFL 356

Query: 402 EELEKVFNVKFPSGDQLHTAETGEFLKKILVDNKLEC---PPPLTNARMLDKLVGEL--E 456
             L K   V      Q+   ++ + L+ I    K +        +++++L++L  EL  E
Sbjct: 357 PTLSKELGVDL---SQVKIEDSKQLLEVIPQKYKGQFFGKSSSYSSSQILNRLCSELIEE 413

Query: 457 DTC--INPTFIFGHPQMMSPLAKYSRDQPGLCERFEVFVATKEICNAYTELNDPFDQRAR 514
             C   +PT I+ HP ++SPLAK + D     +RFE+F+  +E  NAY E N P  Q  +
Sbjct: 414 KYCNSSHPTIIYHHPAVISPLAKSNPDDSRTTKRFELFIKGREYSNAYEEENCPQVQLEK 473

Query: 515 FEEQARQK-DQGD-DEAQLVDETFCNALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLL 572
           FE+QAR K D GD D    +D+ + NA+++G+PP GG+G GIDRL M +T    I +VL 
Sbjct: 474 FEQQARMKEDYGDNDTLSSIDQEYINAMKWGMPPIGGFGLGIDRLCMLITGCQRIEQVLP 533

Query: 573 FPTL 576
           F TL
Sbjct: 534 FGTL 537

>Scas_633.28
          Length = 592

 Score =  250 bits (638), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 171/480 (35%), Positives = 264/480 (55%), Gaps = 52/480 (10%)

Query: 124 VSIAGRIHAKRESGSKLKFYVLHGDGVEVQL-----MSQLQDYCDPDSYEKDHDLLKRGD 178
           + + GRI   R SG K+ F  L      V++     +++L+     + +++   LLK+GD
Sbjct: 126 LQLNGRIKNIRYSGKKIAFIDLFDSRYNVKIQVILNLNKLKQETSEERFQEVVQLLKKGD 185

Query: 179 IVGVEGYVGRTQPK------KGGEGEVSVFVSRVQLLTPCLHMLPADHFGFKDQETRYRK 232
            +   G  G ++ +      KG +  V        LL+   + LP+     KD+    + 
Sbjct: 186 YIKAFGIPGFSESRSHTLSLKGTKLPV--------LLSAAQYPLPSQ---LKDELKARKN 234

Query: 233 RYLDLIMNKDARNRFITRSEIIRYIRRFLDQRKFIEVETPMMNVIAGGATAKPFITHHND 292
           R LD  +N    +  + RS IIR +R FLD+++FIEVETP+++  + GA A+PFIT    
Sbjct: 235 RVLDYQVN--GVSSLLLRSNIIRLLRSFLDKQEFIEVETPILSSKSNGANARPFITKSGS 292

Query: 293 LDMDMYMRIAPELFLKQLVVGGLDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYD 352
           L+ ++ +RIAPEL+LK+L++ GLDRVYEIG+ FRNEG+D THNPEFT  EFY+ Y  + D
Sbjct: 293 LNENLELRIAPELWLKRLIISGLDRVYEIGKVFRNEGVDSTHNPEFTLLEFYERYLSMTD 352

Query: 353 LMDMTELMFSEMVK--EITGSYIIKYHPDPA--DPAKELELNFSRPWK--RINMIEELEK 406
           L++ +E +F  ++   E+  S   +YH  PA  +  + LE      WK  RI  +  L +
Sbjct: 353 LIEKSEDLFKHILVNLELKKS---EYHFSPAFDNLYRTLE---QANWKFRRIEFLPTLSQ 406

Query: 407 VFNVKFPSGDQLHTAETGEFLKKILVDNKLEC-----PPPLTNARMLDKLVGELEDT--- 458
             N+ F   D L+ AE  + L+ +   ++ E      P  L++ ++L+KL     ++   
Sbjct: 407 ELNIDFSLID-LNDAE--KLLESLPAHSRKELFENVPPGELSSQQILNKLCSFYLESRYC 463

Query: 459 -CINPTFIFGHPQMMSPLAKYSRDQPGLCERFEVFVATKEICNAYTELNDPFDQRARFEE 517
             I+PT IF HP+++SPLAK       + +RFE+F+  KE  NAY E N P  Q   F+ 
Sbjct: 464 DTIHPTIIFHHPRIISPLAKAHPSNQQITKRFEMFINGKEYINAYEEENCPQLQEKNFQL 523

Query: 518 QARQ----KDQGDDEAQLVDETFCNALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLF 573
           Q       K++ +DE    DE F NA++ G+PP GG+G G+DRL M L +   I +VL F
Sbjct: 524 QQFSKETIKNKENDELISPDEGFINAMKSGMPPVGGFGLGVDRLCMLLMNKGRIEDVLPF 583

>KLLA0F04796g complement(466476..468029) similar to sp|P32048
           Saccharomyces cerevisiae YNL073w MSK1 lysyl-tRNA
           synthetase, mitochondrial, hypothetical start
          Length = 517

 Score =  248 bits (632), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 161/460 (35%), Positives = 250/460 (54%), Gaps = 28/460 (6%)

Query: 125 SIAGRIHAKRESGSKLKFYVLHGDGVEVQLMSQLQDY-CDPDSYEKDHDLLKRGDIVGVE 183
           ++ G+I   R SG K+ F  L  D   +Q++  L +       ++      K GD + V 
Sbjct: 72  TLRGKITNMRFSGKKIGFINLLNDEKSLQVIVNLSNLPMSVGEFQAHMRKFKIGDHIQVT 131

Query: 184 GYVGRTQPKKGGEGEVSVFV-SRVQLLTPCLHMLPADHFGFKDQETRYRKRYLDLIMNKD 242
           G+ G +Q     +G +S+ V S +++L+P    +P       D   R   + LD ++N  
Sbjct: 132 GFPGVSQK----QGTLSLKVNSELKMLSPAQIPIPPKLL---DSSKRNSNKTLDYLVN-- 182

Query: 243 ARNRFITRSEIIRYIRRFLDQRKFIEVETPMMNVIAGGATAKPFITHHNDLDMD--MYMR 300
                  R  + + IR +L +++FIEVETP+++  + GA AKPFITH   +D +    +R
Sbjct: 183 GTEAIYIRHLVTKRIREWLYKQEFIEVETPIISSKSNGANAKPFITHCTAIDKEQPFELR 242

Query: 301 IAPELFLKQLVVGGLDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTELM 360
           IAPEL+LK+L +GG+++++EIG+ FRNEGID THNPEFTT EFYQ Y ++  L++M+E +
Sbjct: 243 IAPELWLKRLCIGGMNKIFEIGKVFRNEGIDSTHNPEFTTLEFYQCYINMEQLIEMSESL 302

Query: 361 FSEMVKEITGSYIIKYHPDPADPAKELELNFSRPWKRINMIEELEKVFNVKFPSGDQLHT 420
              + + I         P   +   +++ N  + +KR+  +  L +   + F + D  + 
Sbjct: 303 LIYVCQGID-------KPKAQELLDQIKANNGK-FKRLEFLPTLTQKTGIDFDNMDLNNA 354

Query: 421 AETGEFLKKILVDNKLECPPPLTNARMLDKLVGE-LEDTC--INPTFIFGHPQMMSPLAK 477
               E L+K  +        P    ++LD+L G+ +E  C  + PT I+ HP ++SPLAK
Sbjct: 355 ELLKEKLRKANISISESSVSP---QQILDELCGKYIESQCDTLLPTIIYHHPTVLSPLAK 411

Query: 478 YSRDQPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQ-GDDEAQLVDETF 536
              +   + +RFE+F+  KE  NAY E N P  Q  +F  Q   K Q  DDE   VD  +
Sbjct: 412 TDSNNVQITKRFEIFINRKEYMNAYEEENCPDLQLEKFTNQLASKTQFKDDEMMAVDLPY 471

Query: 537 CNALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFPTL 576
             A++YG+PP GG+G GIDRL M L D+  I EVL F TL
Sbjct: 472 VQAMKYGMPPIGGFGLGIDRLCMLLADTQRIEEVLSFGTL 511

>Kwal_23.4717
          Length = 527

 Score =  241 bits (614), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 169/494 (34%), Positives = 264/494 (53%), Gaps = 51/494 (10%)

Query: 105 EFLAKYAHLKKGETLPEEKVSIAGRIHAKRESGSKLKFYVLHGDGVEVQLM--SQLQDYC 162
           EF  KY  L + +  P+    +  RI + R SG  + F  +      VQL+    +    
Sbjct: 57  EFKQKYQALHEDQ--PQSSEVLRARIDSVRISGKNMCFVDVSNARNSVQLILNYNVMKTA 114

Query: 163 DPDS-------YEKDHDLLKRGDIVGVEGYVGRTQPKKGGEGEVSVFVSRV-QLLTPCLH 214
            P S       ++   DL + GD +   G+ G +Q     E  +S+  +++ ++L P L 
Sbjct: 115 MPSSALTREQFFQHVQDL-RPGDHIQACGFPGLSQ----RERTLSLKCTKLTEILAPALL 169

Query: 215 MLPADHFGFKDQETRYRKRYLDLIMNKDARNRFITRSEIIRYIRRFLDQRKFIEVETPMM 274
            +P       D   R   R LD ++N       + R ++   IR FL+ R F+EVETP++
Sbjct: 170 AVPPK---LTDPAKRNTNRVLDYLVN--GHETLVVRHQVNTAIREFLNMRGFLEVETPVL 224

Query: 275 NVIAGGATAKPFITHHNDLDMDMYMRIAPELFLKQLVVGGLDRVYEIGRQFRNEGIDMTH 334
           +  A GA A+PF T     + ++ +R+APEL+LK+LVV G++RVYE+G+ FRNEG+D TH
Sbjct: 225 SSKANGAAAEPFSTRTKATNAELELRVAPELWLKRLVVAGVNRVYELGKVFRNEGVDATH 284

Query: 335 NPEFTTCEFYQAYADVYDLMDMTELMFSEMVKEITGSYIIKYHPDPADPAKELE---LNF 391
           NPEFTT EFYQ+YA + +L++++E ++  ++  +   +           A+EL+   L  
Sbjct: 285 NPEFTTLEFYQSYASMDELIELSEQLYLHVLNRVDNRF-----------ARELKNELLAN 333

Query: 392 SRPWKRINMIEELEKVFNVKFPSGDQLHTAET---GEFLKKILVDNKLECPPPLTNARML 448
           +  +KR+  +  L +   V F   D LH ++        K I +D   + P      ++L
Sbjct: 334 AGKFKRVEFLPTLLRETGVDFTQID-LHNSDLISRALIAKNIHMDTTGKSP-----QQIL 387

Query: 449 DKLVGELEDT--CIN--PTFIFGHPQMMSPLAKYSRDQPGL-CERFEVFVATKEICNAYT 503
           D L G   +   C +  PT I+ HP +MSPLAK + D   L  +RFEVF+  KE  NAY 
Sbjct: 388 DMLCGRFIENKYCTSSLPTVIYHHPTVMSPLAKGNPDDNMLTTKRFEVFINGKEYINAYE 447

Query: 504 ELNDPFDQRARFE-EQARQKDQGDDEAQLVDETFCNALEYGLPPTGGWGCGIDRLAMFLT 562
           E N P +Q  +FE +++ Q+  GD E+  VD ++  A+++G+PP GG+G GIDRL M LT
Sbjct: 448 EENCPQEQLQKFELQKSAQETYGDRESLAVDYSYVEAMKWGMPPIGGFGLGIDRLCMLLT 507

Query: 563 DSNTIREVLLFPTL 576
            +  I  VL F T+
Sbjct: 508 GNKRIERVLSFGTI 521

>YNL073W (MSK1) [4517] chr14 (488385..490115) Lysyl-tRNA synthetase,
           mitochondrial [1731 bp, 576 aa]
          Length = 576

 Score =  224 bits (570), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 164/499 (32%), Positives = 251/499 (50%), Gaps = 40/499 (8%)

Query: 103 NPEFLAKYAHLKKGETLPEEKVSIAGRIHAKRESGSKLKFYVLHGDGVEVQLMSQLQDYC 162
           N  FL   A L   E  P   +SI GRI + R SG K+ F  L+     ++  +QLQ   
Sbjct: 81  NERFLGNPATLHH-EDNPNLLLSINGRIKSIRFSGQKIVFIDLYNGSSGLKNDTQLQLIV 139

Query: 163 ----------DPDSYEKDHDLLKRGDIVGVEGYVGRTQPKKGGEGEVSVFVSRVQLLTPC 212
                     D  ++ +  + LK+GD +   GY G +Q +      +S+  +++ ++   
Sbjct: 140 NYNKIGGSSEDKANFSEYMNFLKKGDYIKALGYPGFSQSR---VKMLSLICNKLPIVLSV 196

Query: 213 LHM-LPADHFGFKDQETRYRKRYLDLIMNKDARNRFITRSEIIRYIRRFLDQRKFIEVET 271
             + LP+      D+      R +D  +N       + R+ II+ +R+FLD R F+EVET
Sbjct: 197 SQLPLPSR---LNDETKIKSNRVVDYQLN--GTQTLLVRARIIKLLRKFLDDRNFVEVET 251

Query: 272 PMMNVIAGGATAKPFITHHNDLDMDMYMRIAPELFLKQLVVGGLDRVYEIGRQFRNEGID 331
           P+++  + GA AKPFIT   D D  + +RIAPEL+LK+L++ GL +VYEIG+ FRNEGID
Sbjct: 252 PILSSKSNGAMAKPFITSSKDFD-HLELRIAPELWLKRLIISGLQKVYEIGKVFRNEGID 310

Query: 332 MTHNPEFTTCEFYQAYADVYDLMDMTELMFSEMVKEITGSYIIKYHPDPADPAKELELNF 391
            THN EF+T EFY+ Y  + D++  TE +F  ++  +   +     P P   + EL L  
Sbjct: 311 STHNAEFSTLEFYETYMSMDDIVTRTEDLFKFLITNLQKFFQDTRLPVPKTFS-ELHLAL 369

Query: 392 S-RPWK--RINMIEELEKVFNVKFPSGDQLHTAETGEFLKKILVDNKLECPPPLTNARML 448
           S   WK  ++  +  L K   +   +   L   +  E LK +  D   +  P   N   L
Sbjct: 370 SENNWKFRKVEFLPTLNKELGIDLMNSG-LDINKPSELLKALPKDIAKKYFPSADNTGQL 428

Query: 449 DKL--VGELEDTCIN--------PTFIFGHPQMMSPLAKYSRDQPGLCERFEVFVATKEI 498
             L  + +L D  +         PT I+  P ++SPLAK       + +RFEVF+  KE 
Sbjct: 429 SSLQILNKLSDVFLEQRHCQSTLPTVIYHQPAILSPLAKTDPQNKQVTKRFEVFIKGKEY 488

Query: 499 CNAYTELNDPFDQRARFEEQARQKDQGDDEAQ----LVDETFCNALEYGLPPTGGWGCGI 554
            NAY E N P  Q  +F +Q +  +   ++ +    ++D  +   ++YG+PP GG+G GI
Sbjct: 489 INAYEEENCPQLQLQKFLQQKQINELTGNKTETLSPVIDYQYVETMKYGMPPVGGFGLGI 548

Query: 555 DRLAMFLTDSNTIREVLLF 573
           DRL M   D   I EVL F
Sbjct: 549 DRLCMLFCDKKRIEEVLPF 567

>AER362W [2863] [Homologous to ScYNL073W (MSK1) - SH]
           complement(1309431..1311008) [1578 bp, 525 aa]
          Length = 525

 Score =  217 bits (552), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 156/473 (32%), Positives = 238/473 (50%), Gaps = 44/473 (9%)

Query: 120 PEEKVSIAGRIHAKRESGSKLKFYVLHGDGVEVQLMSQ----LQDYCDPDSYEKDHDLLK 175
           PE    I G+I   R  G  + F  L   G  +QLM               ++     L+
Sbjct: 75  PERTYVINGQIRGIRVVGRSMCFVDLQQQGSALQLMVNHSLVRAQLVAKRPFQNAIAGLR 134

Query: 176 RGDIVGVEGYVGRTQPKKGGEGEVSVFVSRVQLLTPCLHMLPADHFG----FKDQETRYR 231
            GD V   G+ G ++ ++     +S+   +V        ML A          D+  R +
Sbjct: 135 LGDHVQPTGFPGLSKTER----TLSLKCRKVP------RMLAAAQIAIPQRLTDRVKRQQ 184

Query: 232 KRYLDLIMNKDARNRFITRSEIIRYIRRFLDQRKFIEVETPMMNVIAGGATAKPFITHHN 291
            R LD ++N      F  R + +  +R +L++R F+EVETPM++  + GA A PF+TH  
Sbjct: 185 NRTLDYLVNGLKVLEF--RHKALTALRAYLNRRGFLEVETPMLSAKSSGANATPFVTHLR 242

Query: 292 DLD-MDMYMRIAPELFLKQLVVGGLDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADV 350
             D   + +RIAPEL+LK+L VGG  RVYEIG+ FRNEGID THNPEFTT E YQ YA +
Sbjct: 243 GQDKQALELRIAPELWLKRLCVGGAQRVYEIGKVFRNEGIDATHNPEFTTLELYQCYAPL 302

Query: 351 YDLMDMTELMFSEMVKEITGSYIIKYHPDPADPAKELELNFSRPWKRINMIEELEKVFNV 410
            +L+++ +++  ++   +         P       E+  N    ++R+  +  L +   V
Sbjct: 303 DELLELAQVLLRDICVAVD-------TPVSRQLLAEMAQNGG-AFRRVEFLPTLSRETGV 354

Query: 411 KFPSGDQLHTAETGEFLKKILVDNKLECPPPLTN-ARMLDKLVGE-LED---TCINPTFI 465
            + + D   +      ++  L    ++ P  + +  ++L+KL  + +ED     + PT I
Sbjct: 355 DWAAVDLADSTA----IRVALSGAGIDVPESIVSPQQILNKLCADYIEDRYCQSLLPTAI 410

Query: 466 FGHPQMMSPLAKYSRDQPGL-CERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQ 524
             HP +MSPLAK +    GL   RFE+FV  +E+ NAY E N P +Q  + + Q R ++Q
Sbjct: 411 LHHPAVMSPLAKSA----GLVANRFELFVCGRELINAYEEENCPQEQLKKMQLQQRHREQ 466

Query: 525 -GDDEAQLVDETFCNALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFPTL 576
             D E+  +D  +  A++YG+PP GG G GIDRL M L     I EVL F  L
Sbjct: 467 FHDQESMQIDHHYIEAMKYGMPPIGGLGLGIDRLCMLLLAKARIEEVLPFGCL 519

>CAGL0D06556g 623770..625431 highly similar to sp|P04802
           Saccharomyces cerevisiae YLL018c DPS1, start by
           similarity
          Length = 553

 Score = 87.0 bits (214), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 118/479 (24%), Positives = 196/479 (40%), Gaps = 59/479 (12%)

Query: 121 EEKVSIAGRIHAKRESGSKLKFYVLHGDGVEVQLMSQLQDYCDPDSYE--KDHDLLKRGD 178
           +++V    R+H  R+ G+ L F  L      +Q + +     +  S    K    L    
Sbjct: 101 DKEVLFRARVHNTRQQGATLAFLTLRQQSSLIQALVKADKAGEKISKNMVKWAGSLNLES 160

Query: 179 IVGVEGYVGRT-QPKKGGE-GEVSVFVSRVQLLTPCLHMLP------------ADHFGFK 224
           IV V G V    +P K     ++ + V+++  ++     LP            A+  G  
Sbjct: 161 IVLVRGIVKVVDEPIKSATIQDLEIHVTQIHTISETPETLPILIEDASRSEAEAEAAGLP 220

Query: 225 --DQETRYRKRYLDLIMNKDARNRFITRSE--IIRYIRRFLDQRKFIEVETPMMNVIAGG 280
             + +TR   R +DL   +   N+ I R +  +    R FL  +KF+EV TP M   A  
Sbjct: 221 VVNLDTRLDNRVIDL---RTVTNQAIFRIQHGVCALFREFLANKKFVEVHTPKMLGAASE 277

Query: 281 ATAKPF-ITHHNDLDMDMYMRIAPELFLKQLVVGGLDRVYEIGRQFRNEGIDM-THNPEF 338
             A  F +T+        Y+  +P+   +QL+V   ++V+EIG  FR E  +   H  EF
Sbjct: 278 GGANVFEVTYFKG---KAYLAQSPQFNKQQLIVADFEKVFEIGPVFRAENSNTHRHMTEF 334

Query: 339 TTCEFYQAYADVY-DLMDMTELMFSEMVKEITGSYIIKYH-PDPADPAKELELNFSRPWK 396
           T  +   A+ + Y +++D+   +F  +  E+   Y  +        P +E +L       
Sbjct: 335 TGLDMEMAFEEHYHEVLDVLSELFVFLFTELKKRYAKEIELVRKQYPVEEFKLPKDGKMV 394

Query: 397 RINMIEELEKVFNVKFPSGD-QLHTAETGEFLKKILVDNKLECPPPLTNARMLDKLVGEL 455
           RI   E ++ +       GD +  + E  +FL K LV  K +     T+  +LDK   E 
Sbjct: 395 RITYKEGIQMLKEAGKDIGDFEDLSTENEKFLGK-LVREKYD-----TDFYILDKFPLE- 447

Query: 456 EDTCINPTFIFGHPQMMSPLAKYSRDQPGLCERFEVFVATKEICNAYTELNDPFDQRARF 515
               I P +    P+            P     ++ F+  +EI +    ++D    +   
Sbjct: 448 ----IRPFYTMPDPE-----------DPRYSNSYDFFMRGEEILSGAQRIHD---HKMLM 489

Query: 516 EEQARQKDQGDDEAQLVDETFCNALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFP 574
           E   R K  G D      + +C+   YG PP  G G G++R+ MF  D   IR   LFP
Sbjct: 490 E---RMKVHGLDPEDPGLKDYCDGFSYGCPPHAGGGIGLERVVMFFLDLKNIRRASLFP 545

>ADL039C [1702] [Homologous to ScYLL018C (DPS1) - SH]
           (620628..622298) [1671 bp, 556 aa]
          Length = 556

 Score = 87.0 bits (214), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 117/485 (24%), Positives = 198/485 (40%), Gaps = 74/485 (15%)

Query: 122 EKVSIAGRIHAKRESGSKLKFYVLHGDGVEVQ-LMSQLQDYCDPDSYEKDHDLLKRGDIV 180
           ++V +  R+H  R+ G+ L F +L      +Q L+    +        K    L    IV
Sbjct: 106 KEVLLRSRVHTVRQQGATLAFLMLRQRSSLIQALVKANAEGTVSKQMVKWAGSLNLESIV 165

Query: 181 GVEGYVGRTQP--KKGGEGEVSVFVSRVQLLTPCLHMLP------------ADHFGFK-- 224
            V G V + +   K     +  + ++++  ++     LP            A+  G    
Sbjct: 166 LVRGVVRKVEEPVKSATVQDFEIQITQLHTISETPQQLPILIEDASRSEAEAEAAGLPVV 225

Query: 225 DQETRYRKRYLDLIMNKDARNRFITR--SEIIRYIRRFLDQRKFIEVETPMMNVIAGGAT 282
           + +TR   R +DL   +   N+ I R  + +    R F   R F E+ TP +        
Sbjct: 226 NLDTRLDARVIDL---RTVTNQAIFRIKAGVCGLFREFFQSRNFTEIHTPKLLASPSEGG 282

Query: 283 AKPFITHHNDLDMDMYMRIAPELFLKQLVVGGLDRVYEIGRQFRNEGIDM-THNPEFTTC 341
           A  F   +     + Y+  +P+ + +QL+    +RV+E+   FR E  +   H  EFT  
Sbjct: 283 ANVFEVKY--FKGNAYLAQSPQFYKQQLIAADFERVFEVAPVFRAENSNTHRHMTEFTGV 340

Query: 342 E----FYQAYADVYDLM-DMTELMFSEM-------VKEITGSYIIKYHPDPADPAKELEL 389
           +    F + Y +V ++M +M   +F+E+       + ++   Y ++    PAD  K + L
Sbjct: 341 DLEMAFEEHYHEVIEVMGEMFMFVFTELKKRFAREIAQVRKQYPVEEFKFPAD-GKMVIL 399

Query: 390 NFSRPWKRINMIEELEKVFNVKFPSGDQLHTAETGEFLKKILVDNKLECPPPLTNARMLD 449
           ++    + I M+ E  K    +    D L T E   FL K LV  K +     T+  +LD
Sbjct: 400 HYK---EGIAMLREAGK----EIGDFDDLST-ENERFLGK-LVREKYD-----TDFYILD 445

Query: 450 KLVGELEDTCINPTFIFGHPQMMSPLAKYSRDQPGLCERFEVFVATKEICNAYTELNDPF 509
           K   EL      P +    P             P     ++ F+  +EI +    ++DP 
Sbjct: 446 KFPAEL-----RPFYTMPDPA-----------DPRYSNSYDFFMRGEEIMSGAQRIHDPE 489

Query: 510 DQRARFEEQARQKDQGDDEAQLVDETFCNALEYGLPPTGGWGCGIDRLAMFLTDSNTIRE 569
             R R +    Q +    +A   D  +C+A  YG PP  G G G++R+ MF  D   IR 
Sbjct: 490 LLRERMKHHGLQPE----DAGFKD--YCDAFTYGCPPHAGGGIGLERIVMFYLDLKNIRR 543

Query: 570 VLLFP 574
             LFP
Sbjct: 544 ATLFP 548

>YLL018C (DPS1) [3401] chr12 complement(109901..111574)
           Aspartyl-tRNA synthetase, cytoplasmic [1674 bp, 557 aa]
          Length = 557

 Score = 86.7 bits (213), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 118/483 (24%), Positives = 203/483 (42%), Gaps = 68/483 (14%)

Query: 121 EEKVSIAGRIHAKRESGSKLKFYVLHGDGVEVQ-LMSQLQDYCDPDSYEKDHDLLKRGDI 179
           +++V    R+H  R+ G+ L F  L      +Q L+   ++     +  K    L    I
Sbjct: 106 DKEVLFRARVHNTRQQGATLAFLTLRQQASLIQGLVKANKEGTISKNMVKWAGSLNLESI 165

Query: 180 VGVEGYVGRT-QPKKGGEGE-VSVFVSRVQLLTPCLHMLP------------ADHFGFK- 224
           V V G V +  +P K    + + + ++++  ++     LP            A+  G   
Sbjct: 166 VLVRGIVKKVDEPIKSATVQNLEIHITKIYTISETPEALPILLEDASRSEAEAEAAGLPV 225

Query: 225 -DQETRYRKRYLDLIMNKDARNRFITRSE--IIRYIRRFLDQRKFIEVETP-MMNVIAGG 280
            + +TR   R +DL   +   N+ I R +  +    R +L  +KF EV TP ++   + G
Sbjct: 226 VNLDTRLDYRVIDL---RTVTNQAIFRIQAGVCELFREYLATKKFTEVHTPKLLGAPSEG 282

Query: 281 ATAKPFITHHNDLDMDMYMRIAPELFLKQLVVGGLDRVYEIGRQFRNEGIDM-THNPEFT 339
            ++   +T+        Y+  +P+   +QL+V   +RVYEIG  FR E  +   H  EFT
Sbjct: 283 GSSVFEVTYFKG---KAYLAQSPQFNKQQLIVADFERVYEIGPVFRAENSNTHRHMTEFT 339

Query: 340 TCE----FYQAYADVYD-LMDMTELMFSEMVKEITGS--YIIKYHPDPADPAKELELNFS 392
             +    F + Y +V D L ++   +FSE+ K        + K +P      +E +L   
Sbjct: 340 GLDMEMAFEEHYHEVLDTLSELFVFIFSELPKRFAHEIELVRKQYP-----VEEFKLPKD 394

Query: 393 RPWKRINMIEELEKVFNVKFPSGD-QLHTAETGEFLKKILVDNKLECPPPLTNARMLDKL 451
               R+   E +E +       GD +  + E  +FL K LV +K +     T+  +LDK 
Sbjct: 395 GKMVRLTYKEGIEMLRAAGKEIGDFEDLSTENEKFLGK-LVRDKYD-----TDFYILDKF 448

Query: 452 VGELEDTCINPTFIFGHPQMMSPLAKYSRDQPGLCERFEVFVATKEICNAYTELNDPFDQ 511
             E     I P +    P             P     ++ F+  +EI +    ++D    
Sbjct: 449 PLE-----IRPFYTMPDPA-----------NPKYSNSYDFFMRGEEILSGAQRIHD---- 488

Query: 512 RARFEEQARQKDQGDDEAQLVDETFCNALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVL 571
            A  +E+ +      ++  L D  +C+   YG PP  G G G++R+ MF  D   IR   
Sbjct: 489 HALLQERMKAHGLSPEDPGLKD--YCDGFSYGCPPHAGGGIGLERVVMFYLDLKNIRRAS 546

Query: 572 LFP 574
           LFP
Sbjct: 547 LFP 549

>Scas_347.3
          Length = 552

 Score = 84.3 bits (207), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 113/482 (23%), Positives = 192/482 (39%), Gaps = 68/482 (14%)

Query: 122 EKVSIAGRIHAKRESGSKLKFYVLHGDGVEVQLMSQLQ-DYCDPDSYEKDHDLLKRGDIV 180
           ++V    R+H  R+ G+ L F         +Q + ++Q D        K    L    IV
Sbjct: 102 KEVVFRARVHNTRQQGATLSFLTFRQQHDLIQGLVKVQKDGSVSKQMVKWAGSLNLESIV 161

Query: 181 GVEGYVGRTQP--KKGGEGEVSVFVSRVQLLTPCLHMLP------------ADHFGFK-- 224
            V+G V R +   K     ++ + ++ +  ++     LP            A+  G    
Sbjct: 162 VVKGIVKRVEEPIKSATVQDLEIHITDIHSISETPETLPILLEDASRSEAEAEAAGLPVV 221

Query: 225 DQETRYRKRYLDL--IMNKDARNRFITRSEIIRYIRRFLDQRKFIEVETPMMNVIAGGAT 282
           + +TR   R +DL  + N+     F  +S + +  R +L   KF EV TP +        
Sbjct: 222 NLDTRLDARVIDLRTVTNQAI---FKIQSGVCQLFREYLSGLKFTEVHTPKLLGAPSEGG 278

Query: 283 AKPFITHHNDLDMDMYMRIAPELFLKQLVVGGLDRVYEIGRQFRNEGIDM-THNPEFTTC 341
           A  F   +       Y+  +P+   +QL+V   ++V+EIG  FR E  +   H  EFT  
Sbjct: 279 ASVFEVSY--FKGKAYLAQSPQFNKQQLIVADFEKVFEIGPVFRAENSNTHRHMTEFTGL 336

Query: 342 E----FYQAYADVYDLM-DMTELMFSEMVKEITGSYIIKYHPDPADPAKELELNFSRPWK 396
           +    F + Y +V D++ D+   +F+E+ K  +    I     P +       +F  P  
Sbjct: 337 DMEMAFEEHYHEVLDVLSDLFVFIFTELKKRFSKEIEIVRKQYPVE-------DFKLPAD 389

Query: 397 RINMIEELEKVFNVKFPSGDQL---HTAETGEFLKKILVDNKLECPPPLTNARMLDKLVG 453
                    K+  +++  G Q+      E G+F       + L       N + L KLV 
Sbjct: 390 G--------KMVRIQYKEGIQMLKDAGKEIGDF-------DDLST----ENEKFLGKLVR 430

Query: 454 ELEDTCINPTFIFGHPQMMSPLAKY-SRDQPGLCERFEVFVATKEICNAYTELNDPFDQR 512
           E  DT       F  P  + P       + P     ++ F+  +EI +    ++D     
Sbjct: 431 EKYDTDFYILDKF--PLAIRPFYTMPDAEDPRYSNSYDFFMRGEEILSGAQRIHD----H 484

Query: 513 ARFEEQARQKDQGDDEAQLVDETFCNALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLL 572
           A  +E+ +      ++  L D  +C+   YG PP  G G G++R+ MF  D   IR   L
Sbjct: 485 ALLQERMKVHGLSSEDPGLKD--YCDGFSYGCPPHAGGGIGLERVVMFFLDLKNIRRASL 542

Query: 573 FP 574
           FP
Sbjct: 543 FP 544

>Sklu_2189.3 YLL018C, Contig c2189 5672-7348 reverse complement
          Length = 558

 Score = 80.5 bits (197), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 112/503 (22%), Positives = 203/503 (40%), Gaps = 86/503 (17%)

Query: 109 KYAHLKKGETLPEEKVSIAGRIHAKRESGSKLKFYVLHGDGVEVQ-LMSQLQDYCDPDSY 167
           K+A L + +   E  V    R+H  R+ G+ L F  L      +Q L+   ++       
Sbjct: 97  KFADLSENDDGKE--VVFRARVHNSRQQGATLNFLTLRQQAELIQALVKSNKEGTVSKQM 154

Query: 168 EKDHDLLKRGDIVGVEGYVGRTQP--KKGGEGEVSVFVSRVQLLTPCLHMLP-------- 217
            K    +    IV V G V + +   K      + + ++++  ++     +P        
Sbjct: 155 VKWTSSINLESIVLVHGIVRKVEEPIKSATVQNLEIHITKIFTISETPQQMPILLEDASR 214

Query: 218 ----ADHFGFK--DQETRYRKRYLDL--IMNKDARNRFITRSEIIRYIRRFLDQRKFIEV 269
               A+  G    + +TR   R +DL  + N+     F  +S +    R FL  R F E+
Sbjct: 215 SEAEAEAAGLPVVNLDTRLDARVIDLRTVTNQAI---FKIQSGVCELFREFLRNRDFTEI 271

Query: 270 ETPMMNVIAGGATAKPF-ITHHNDLDMDMYMRIAPELFLKQLVVGGLDRVYEIGRQFRNE 328
            TP +        A  F +T+      + Y+  +P+++ ++L+    +RV+E+G  FR E
Sbjct: 272 HTPKLLGSPSEGGANVFEVTYFKG---NSYLAQSPQIYKQELIAADFERVFEVGPVFRAE 328

Query: 329 GIDM-THNPEFTTCEFYQAYADVYD-LMDMTELMFSEMVKEITGSYIIKYHPDPADPAKE 386
             +   H  EFT  +   A+ + YD ++D+   +F  +  E+                  
Sbjct: 329 NSNTHRHMTEFTGLDLEMAFEEHYDEVLDVLSELFVFIFTELK----------------- 371

Query: 387 LELNFSRPWKRINMIEELEKVFNVKFPSGDQ---LHTAETGEFLKKI--LVDNKLECPPP 441
                SR  K I ++ +   V + K P   +   LH  +    L++    VD+  +    
Sbjct: 372 -----SRYSKEIALVRKQYPVEDFKLPKDGKMVRLHFKDGIAMLREAGKQVDDFEDLS-- 424

Query: 442 LTNARMLDKLVGELEDT----------CINPTFIFGHPQMMSPLAKYSRDQPGLCERFEV 491
             N ++L KLV E  DT           + P +    P+     ++YS         ++ 
Sbjct: 425 TENEKLLGKLVREKYDTDFYILDKFPLAVRPFYTMPDPED----SRYSNS-------YDF 473

Query: 492 FVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLVDETFCNALEYGLPPTGGWG 551
           F+  +EI +    ++D        +E+ +  +   ++  L D  +C+A  YG PP  G G
Sbjct: 474 FMRGEEILSGAQRIHDS----EFLKERMKVHELSPEDPGLKD--YCDAFTYGCPPHAGGG 527

Query: 552 CGIDRLAMFLTDSNTIREVLLFP 574
            G++R+ MF  D   IR   LFP
Sbjct: 528 IGLERVVMFYLDLKNIRRASLFP 550

>KLLA0D03839g 324274..325941 highly similar to sp|P04802
           Saccharomyces cerevisiae YLL018c DPS1 aspartyl-tRNA
           synthetase, cytosolic, start by similarity
          Length = 555

 Score = 77.8 bits (190), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 115/482 (23%), Positives = 194/482 (40%), Gaps = 70/482 (14%)

Query: 123 KVSIAGRIHAKRESGSKLKFYVLHGDGVEVQ-LMSQLQDYCDPDSYEKDHDLLKRGDIVG 181
           +V    R+H  R+ G+ L F  L      +Q L+   ++        K    +    IV 
Sbjct: 106 EVVFRARVHNSRQQGATLAFLTLRQQAELIQGLVKANKEGTVSKQMVKWVGSINLESIVV 165

Query: 182 VEGYVGRTQP--KKGGEGEVSVFVSRVQLLTPCLHMLP------------ADHFGFK--D 225
           V G V + +   K      + V ++++  ++     LP            A+  G    +
Sbjct: 166 VHGIVKKVEEPIKSATVQNLEVHITKIYTISETPEQLPILIEDASRSEAEAEAAGLPVVN 225

Query: 226 QETRYRKRYLDLIMNKDARNRFITR--SEIIRYIRRFLDQRKFIEVETP-MMNVIAGGAT 282
            +TR   R +DL   +   N+ I R  S +    R FL  +KF EV TP ++   + G +
Sbjct: 226 LDTRLDSRVIDL---RTVTNQAIFRIQSGVCALFREFLTNKKFTEVHTPKLLGAPSEGGS 282

Query: 283 AKPFITHHNDLDMDMYMRIAPELFLKQLVVGGLDRVYEIGRQFRNEGIDM-THNPEFTTC 341
               +T+        Y+  +P+L+ +QL+    +RV+E+   FR E  +   H  EFT  
Sbjct: 283 NVFEVTYFKG---KSYLAQSPQLYKQQLIAADFERVFEVAPVFRAENSNTHRHMTEFTGL 339

Query: 342 EFYQAYADVYD-----LMDMTELMFSEM----VKEITGSYIIKYHPDPADPAKELELNFS 392
           +   A+ + YD     L ++   +FS++     KEI  + + K +P      +E +L   
Sbjct: 340 DLEMAFEEHYDEVVDTLAELFVFIFSQLKTRYAKEI--ALVRKQYP-----VEEFKLPKD 392

Query: 393 RPWKRINMIEELEKVFNVKFPSGDQLHTAETGEFLKKILVDNKLECPPPLTNARMLDKLV 452
               RI   E +  +        D    +   E L   LV +K E     T+  +LDK  
Sbjct: 393 GKMVRIPFKEGIALLREAGKDVDDFEDLSTENEKLLGKLVRDKYE-----TDFYILDKF- 446

Query: 453 GELEDTCINPTFIFGHPQMMSPLAKYSRDQPGLCERFEVFVATKEICNAYTELNDPFDQR 512
                  I P +    P    P  +YS         ++ F+  +EI +    ++D     
Sbjct: 447 ----PLAIRPFYTM--PDAEDP--RYSNS-------YDFFMRGEEILSGAQRIHDA---- 487

Query: 513 ARFEEQARQKDQGDDEAQLVDETFCNALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLL 572
              +E+    +   ++  L D  +C A  YG PP  G G G++R+ MF  D   IR   L
Sbjct: 488 DLLKERMNAHEVHPEDPGLKD--YCEAFTYGCPPHAGGGIGLERVVMFYLDLKNIRRASL 545

Query: 573 FP 574
           FP
Sbjct: 546 FP 547

>Kwal_27.12235
          Length = 650

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 52/199 (26%), Positives = 93/199 (46%), Gaps = 7/199 (3%)

Query: 178 DIVGVEGYVGRTQPKKGGEG-EVSVFVSRVQLLTPCLHMLPADHFGFKDQETRY-RKRYL 235
           D+V +EG +   + K+     E  + +S+++ L       P+    FK+Q       RYL
Sbjct: 96  DVVQIEGQLSLKRAKQESSAPEYEIKLSKLRTLNKAGKK-PSQLLHFKEQGNYPPEHRYL 154

Query: 236 DLIMNKDARNRFITRSEIIRYIRRFLDQRKFIEVETPMMNVIAGGATAKPFITHHNDL-D 294
            L + K  +     R EI  YIR+ L+ + F E+ETP++         +  +   N L D
Sbjct: 155 QLRLPK-YQTYLRKRHEIATYIRKHLNSKMFSEIETPILFKSTPEGAREFLVPARNKLSD 213

Query: 295 MDMYMRI--APELFLKQLVVGGLDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYD 352
              +  +  +P+ + + L+ GG+ R Y++ R FR+E +     PEFT  +   A+A    
Sbjct: 214 KPTFYALPQSPQQYKQLLMAGGVSRYYQLARCFRDEDLRSDRQPEFTQVDLEMAFASGSQ 273

Query: 353 LMDMTELMFSEMVKEITGS 371
           +MD+ E   +     ++ S
Sbjct: 274 VMDVVESTITNTWNSLSSS 292

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 32/111 (28%), Positives = 49/111 (44%), Gaps = 9/111 (8%)

Query: 468 HPQMMSPLAKYSR--DQPGLC--ERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKD 523
           HP  M  L   S+    P LC  + ++  V   E+    T ++DP  Q   F+   +   
Sbjct: 514 HPFTMVQLKDLSKLSSNPLLCTGQHYDFVVNGTELGGGSTRIHDPELQNFIFKNILKI-- 571

Query: 524 QGDDEAQLVDETFCNALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFP 574
               E + + E    A E G PP  G+  G DRL   +  ++ IR+V+ FP
Sbjct: 572 ---SEPEKLFEHLLTAFESGTPPHAGFAIGFDRLCAMICGTDNIRDVIAFP 619

>Sklu_2265.3 YHR019C, Contig c2265 4970-6652
          Length = 560

 Score = 62.0 bits (149), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 116/488 (23%), Positives = 194/488 (39%), Gaps = 78/488 (15%)

Query: 108 AKYAHLKKGETLPEEKVSIAGRIHAKRESGSKLKFYVLH-GDG-VEVQLMSQLQDYCDPD 165
           A+   + K  T    ++ ++G IH  R S   L F VL  G G ++  L   L       
Sbjct: 122 AEKVKISKSYTTIGSRIKVSGWIHRLR-SNKSLCFVVLRDGTGFLQAVLAGDL-----AK 175

Query: 166 SYEKDHDLLKRGDIVGVEGYVGRTQPKKGGEGEVSVFVSRVQLLTPCLHMLPA--DHFGF 223
           +Y+     L+    V + G + +    K   G V + V   ++++    + P+  D F  
Sbjct: 176 AYQTSTLTLE--STVTLYGTISKLPEGKTAPGGVELAVDYYEIVS----LAPSGEDAFTN 229

Query: 224 KDQETRYRKRYLD---LIMNKDARNRFI-TRSEIIRYIRRFLDQRKFIEVETPMM--NVI 277
           K QE       LD   L +  +  +  +  R+ ++R IRR  ++ +  EV  P M    +
Sbjct: 230 KVQEGADPSLLLDQRHLALRGETLSAVMKVRASLLRAIRRAYEEEQLTEVTPPCMVQTQV 289

Query: 278 AGGATAKPFITHHNDLDMDMYMRIAPELFLKQLVVGGLDRVYEIGRQFRNEGIDM-THNP 336
            GG+T    +   +    + Y+  + +L+L +  +  L  VY I   FR E      H  
Sbjct: 290 EGGST----LFKLDYYGEEAYLTQSSQLYL-ETCLASLGDVYCIQESFRAEKSHTRRHLS 344

Query: 337 EFTTCEFYQAYADVYDLMDMTELMFSEMVK-----EITGSYIIKYHPD---PADPAKELE 388
           E+T  E    + D  DL+   E + ++ V+      I G  I + +PD   P  P K LE
Sbjct: 345 EYTHIEAELCFLDFDDLLSHIERVITKSVQYVLEDPIAGPLIKQLNPDFQAPQLPFKRLE 404

Query: 389 LNFSRPWKRINMIEELEKVFNVKFPSGDQLHTAETGEFLKKILVDNKLECPPPLTNARML 448
              +  W + + I+  +     +F  GD +  AE  E                       
Sbjct: 405 YKDAIEWLKEHGIKNED---GEEFKFGDDI--AEAAE----------------------- 436

Query: 449 DKLVGELEDTCINPTFIFGHP-QMMSPLAKYSRDQPGLCERFEVFVAT-KEICNAYTELN 506
                ++ DT   P  +   P ++ S   K   D P + E  +V + T  EI      ++
Sbjct: 437 ----RKMTDTIGVPILLTRFPVEIKSFYMKRCTDDPSVTESVDVLMPTVGEITGGSMRID 492

Query: 507 DPFDQRARFEEQARQKDQGDDEAQLVDETFCNALEYGLPPTGGWGCGIDRLAMFLTDSNT 566
              +  A F      K +G D A      F +   YG  P GG+G G +R+  +L D  T
Sbjct: 493 SIEELMAGF------KREGIDPAAYY--WFIDQRRYGSCPHGGYGLGTERILAWLCDRFT 544

Query: 567 IREVLLFP 574
           +R+  L+P
Sbjct: 545 VRDCSLYP 552

>Sklu_1963.1 YPL104W, Contig c1963 1525-3492 reverse complement
          Length = 655

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 42/142 (29%), Positives = 72/142 (50%), Gaps = 4/142 (2%)

Query: 233 RYLDLIMNKDARNRFITRSEIIRYIRRFLDQRKFIEVETPMM-NVIAGGATAKPFITHHN 291
           RYL L + K  +N   TR E  + IR+ LD  +F EVETPM+      GA      T  +
Sbjct: 152 RYLQLRLPK-YQNFLRTRYEASKLIRKDLDTYRFTEVETPMLFKSTPEGAREFLVPTRRS 210

Query: 292 DLDMDMYMRI--APELFLKQLVVGGLDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYAD 349
           +     +  +  +P+ + + L+  G+ R ++I R FR+E +     PEFT  +   A+A 
Sbjct: 211 ESKHPTFYALPQSPQQYKQLLMASGVHRYFQIARCFRDEDLRSDRQPEFTQVDLEMAFAS 270

Query: 350 VYDLMDMTELMFSEMVKEITGS 371
             ++MD+ E M ++    ++ +
Sbjct: 271 GNEVMDVVEDMVTKAWSNLSSN 292

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/111 (25%), Positives = 49/111 (44%), Gaps = 9/111 (8%)

Query: 468 HPQMMSPLAKYSRDQ----PGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKD 523
           HP  M  L  Y +        L + +++ V+  E+    T ++DP  Q   F+E  +   
Sbjct: 519 HPFTMVKLDDYKKLSNEAISCLGQHYDLVVSGVELGGGSTRIHDPELQNYIFKEILKIH- 577

Query: 524 QGDDEAQLVDETFCNALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFP 574
               + + +      A E G PP  G+  G DR+   +  + +IR+V+ FP
Sbjct: 578 ----QPERLFGHLLTAFEMGTPPHAGFAIGFDRMCAMMCGTESIRDVIAFP 624

>YHR019C (DED81) [2305] chr8 complement(141886..143550)
           Asparaginyl-tRNA synthetase, cytoplasmic [1665 bp, 554
           aa]
          Length = 554

 Score = 58.9 bits (141), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 113/472 (23%), Positives = 182/472 (38%), Gaps = 74/472 (15%)

Query: 122 EKVSIAGRIHAKRESGSKLKFYVLH-GDG-VEVQLMSQLQDYCDPDSYEKDHDLLKRGDI 179
           ++V ++G IH  R S  K+ F VL  G G ++  L   L           +  +   G I
Sbjct: 130 QRVKVSGWIHRLR-SNKKVIFVVLRDGSGFIQCVLSGDLALAQQTLDLTLESTVTLYGTI 188

Query: 180 VGVEGYVGRTQPKKGGEGEVSVFVSRVQLLTPCLHMLPADHFGFKDQETRYRKRYLD--- 236
           V +    G+T P   G  E++V    V  L P       D F  K  E       LD   
Sbjct: 189 VKLPE--GKTAP---GGVELNVDYYEVVGLAPG----GEDSFTNKIAEGSDPSLLLDQRH 239

Query: 237 LIMNKDARNRFI-TRSEIIRYIRRFLDQRKFIEVETPMM--NVIAGGATAKPFITHHNDL 293
           L +  DA +  +  R+ +++ +RR  D+    EV  P M    + GG+T    +   N  
Sbjct: 240 LALRGDALSAVMKVRAALLKSVRRVYDEEHLTEVTPPCMVQTQVEGGST----LFKMNYY 295

Query: 294 DMDMYMRIAPELFLKQLVVGGLDRVYEIGRQFRNEGIDMT-HNPEFTTCEFYQAYADVYD 352
             + Y+  + +L+L +  +  L  VY I   FR E      H  E+T  E   A+    D
Sbjct: 296 GEEAYLTQSSQLYL-ETCLASLGDVYTIQESFRAEKSHTRRHLSEYTHIEAELAFLTFDD 354

Query: 353 LMDMTELMFSEMVK-----EITGSYIIKYHPD---PADPAKELELNFSRPWKRINMIEEL 404
           L+   E +  + V+      I G  + + +P+   P  P   L+   +  W   + I+  
Sbjct: 355 LLQHIETLIVKSVQYVLEDPIAGPLVKQLNPNFKAPKAPFMRLQYKDAITWLNEHDIKNE 414

Query: 405 EKVFNVKFPSGDQLHTAETGEFLKKILVDNKLECPPPLTNARMLDKLVGELEDTCINPTF 464
           E      F  GD +  AE  E                            ++ DT   P F
Sbjct: 415 E---GEDFKFGDDI--AEAAE---------------------------RKMTDTIGVPIF 442

Query: 465 IFGHP-QMMSPLAKYSRDQPGLCERFEVFVA-TKEICNAYTELNDPFDQRARFEEQARQK 522
           +   P ++ S   K   D P + E  +V +    EI      ++D  +  A F+ +    
Sbjct: 443 LTRFPVEIKSFYMKRCSDDPRVTESVDVLMPNVGEITGGSMRIDDMDELMAGFKREGIDT 502

Query: 523 DQGDDEAQLVDETFCNALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFP 574
           D            F +  +YG  P GG+G G +R+  +L D  T+R+  L+P
Sbjct: 503 D--------AYYWFIDQRKYGTCPHGGYGIGTERILAWLCDRFTVRDCSLYP 546

>Kwal_14.2303
          Length = 475

 Score = 58.5 bits (140), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 63/267 (23%), Positives = 112/267 (41%), Gaps = 32/267 (11%)

Query: 124 VSIAGRIHAKRESGSKLKFYVLHGDGVEVQ-LMSQLQDYCDPDSYEKDHDLLKRGDIVGV 182
           V +  R+H  R+ G+ L F  L      +Q L+    +        K    +    IV V
Sbjct: 121 VVLRARVHNSRQQGATLVFLTLRQQANLIQALVKSNAEGTISKQMVKWTGSISPESIVLV 180

Query: 183 EGYVGRTQP--KKGGEGEVSVFVSRVQLLTPCLHMLP------------ADHFGFK--DQ 226
            G V + +   K      + + ++++  ++     LP            A+  G    + 
Sbjct: 181 HGVVKKVEEPIKSATVQNLEIHITQIFTISEAPQQLPILIEDASRSDAEAEAAGLPVVNL 240

Query: 227 ETRYRKRYLDLIMNKDARNRFITR--SEIIRYIRRFLDQRKFIEVETPMMNVIAGGATAK 284
           +TR   R +DL   + A N+ I R  S +    R FL QRKF+E+ TP +        A 
Sbjct: 241 DTRLDARVIDL---RTATNQAIFRIQSGVCELFREFLTQRKFVEIHTPKLLGAPSEGGAN 297

Query: 285 PF-ITHHNDLDMDMYMRIAPELFLKQLVVGGLDRVYEIGRQFRNEGIDM-THNPEFTTCE 342
            F +T+        Y+  +P+ + ++L+    +RV+E+   FR E  +   H  EFT  +
Sbjct: 298 VFEVTYFKG---KSYLAQSPQFYKQELIAADFERVFEVAPVFRAENSNTHRHMTEFTGLD 354

Query: 343 FYQAYADVYD-----LMDMTELMFSEM 364
              A+ + YD     L D+   +F+++
Sbjct: 355 LEMAFEEHYDEVIDVLSDLFVFIFTQL 381

>KLLA0A08426g complement(745048..746712) similar to sp|P38707
           Saccharomyces cerevisiae YHR019c DED81
           asparaginyl-tRNA-synthetase, start by similarity
          Length = 554

 Score = 58.2 bits (139), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 105/474 (22%), Positives = 191/474 (40%), Gaps = 76/474 (16%)

Query: 121 EEKVSIAGRIHAKRESGSKLKFYVLHGDG-VEVQLMSQLQDYCDPDSYEKDHDLLKRGDI 179
           +++V ++G +H  R + S +   +  G G ++  L   L       SY+  +  L+    
Sbjct: 129 DKRVKVSGWVHRLRNNKSVVFIILRDGTGFLQTVLTGDL-----ARSYQIVNLTLE--TT 181

Query: 180 VGVEGYVGRTQPKKGGEGEVSVFVSRVQLLTPCLHMLPADHFGFKD--QETRYRKRYLD- 236
           + + G +      K   G V +FV   +++ P     P+    F +  QE       LD 
Sbjct: 182 ITLYGTIKVVPESKSAPGGVELFVDYFEIVGPA----PSGENAFTNRVQENADPSILLDQ 237

Query: 237 --LIMNKDARNRFI-TRSEIIRYIRRFLDQRKFIEVETPMM--NVIAGGATAKPFITHHN 291
             L++  +  +  +  R+ +++ IRR  D+    EV  P M    + GG+T    +   +
Sbjct: 238 RHLMLRGETLSAVMKVRAALMKSIRRVYDEEGLTEVNPPCMVQTQVEGGST----LFKLD 293

Query: 292 DLDMDMYMRIAPELFLKQLVVGGLDRVYEIGRQFRNEGIDM-THNPEFTTCEFYQAYADV 350
               + ++  + +L+L +  +  L  VY I   FR E      H  E+T  E    + D 
Sbjct: 294 YYGEEAFLTQSSQLYL-ETCLAALGDVYCIQESFRAEKSHTRRHLSEYTHIEAELCFLDF 352

Query: 351 YDLMDMTELMFSEMVK-----EITGSYIIKYHPD---PADPAKELELNFSRPWKRINMIE 402
            DL+   E + ++ ++      + G  + K +P+   P  P K +E   +  W + + I+
Sbjct: 353 DDLLSHIERVITKTIQYVLEDPVAGPLVKKLNPNFQAPQLPFKRMEYKDAIEWLKEHGIK 412

Query: 403 ELEKVFNVKFPSGDQLHTAETGEFLKKILVDNKLECPPPLTNARMLDKLVGELEDTCINP 462
             E   + +F  GD +  AE  E                            ++ DT   P
Sbjct: 413 NEE---DKEFQFGDDI--AEAAE---------------------------RKMTDTIGVP 440

Query: 463 TFIFGHP-QMMSPLAKYSRDQPGLCERFEVFVAT-KEICNAYTELNDPFDQRARFEEQAR 520
             +   P ++ S   K   D   + E  +V + T  EI      ++D  +  A F     
Sbjct: 441 ILLTRFPLEIKSFYMKRCDDDKRVTESVDVLMPTVGEITGGSMRIDDTEELMAGF----- 495

Query: 521 QKDQGDDEAQLVDETFCNALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFP 574
            K +G D A      F +  +YG  P GG+G G +R+  +L D  T+R+  L+P
Sbjct: 496 -KREGIDPAPYY--WFIDQRKYGTCPHGGYGLGTERILAWLCDRFTVRDCSLYP 546

>YPL104W (MSD1) [5340] chr16 (355695..357671) Aspartyl-tRNA
           synthetase, mitochondrial [1977 bp, 658 aa]
          Length = 658

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 41/135 (30%), Positives = 67/135 (49%), Gaps = 7/135 (5%)

Query: 233 RYLDLIMNKDARNRFITRSEIIRYIRRFLDQRKFIEVETPMMNVIAGGATAKPFI----T 288
           RYL L  N   ++    RS I + IR   +   F EVETPM+   A    A+ F+    T
Sbjct: 152 RYLQL-RNPKYQDFLKKRSSISKEIRNSFNNFDFTEVETPML-FKATPEGAREFLVPTRT 209

Query: 289 HHNDLDMDMY-MRIAPELFLKQLVVGGLDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAY 347
             +D     Y +  +P+ + + L+  G+++ Y++ R FR+E +     PEFT  +   A+
Sbjct: 210 KRSDGKPSFYALDQSPQQYKQLLMASGVNKYYQMARCFRDEDLRADRQPEFTQVDMEMAF 269

Query: 348 ADVYDLMDMTELMFS 362
           A+  D+M + E   S
Sbjct: 270 ANSEDVMKIIEKTVS 284

 Score = 46.2 bits (108), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 50/111 (45%), Gaps = 9/111 (8%)

Query: 468 HPQMMSPLAKYSR--DQPGLC--ERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKD 523
           HP  M  L  Y +    P  C    +++ V   E+    T ++DP  Q   FE+  +   
Sbjct: 520 HPFTMVKLKDYEKLEKTPEKCLGRHYDLVVNGVELGGGSTRIHDPRLQDYIFEDILKI-- 577

Query: 524 QGDDEAQLVDETFCNALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFP 574
              D A  +     NA + G PP  G+  G DR+   + ++ +IR+V+ FP
Sbjct: 578 ---DNAYELFGHLLNAFDMGTPPHAGFAIGFDRMCAMICETESIRDVIAFP 625

>KLLA0E24486g complement(2173560..2175497) similar to sp|P15179
           Saccharomyces cerevisiae YPL104w MSD1 aspartate--tRNA
           ligase, mitochondrial, start by similarity
          Length = 645

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 62/260 (23%), Positives = 111/260 (42%), Gaps = 25/260 (9%)

Query: 123 KVSIAGRIHAK-RESGSKLKFYVLHG-DGVEVQLMSQLQDYCDPDSYEKDHDLLKRGDIV 180
           KV + G I AK ++ G  L F  L   +G ++QL+       D  S+ K+  +     I+
Sbjct: 46  KVVLNGWIDAKPKKVGKNLIFGTLRDPNGEKIQLV-------DSQSFLKESQVEDVVQII 98

Query: 181 GVEGYVGRTQPKKGGEGEVSVFVSRVQLLTPC------LHMLPADHFGFKDQETRYRKRY 234
           G      +TQ +     E  + +  +Q L         L  L AD   F  +      RY
Sbjct: 99  GELSEKKQTQ-QSTVNIEYELKIIELQKLNQANKKPSQLQDLKADDGAFPPE-----YRY 152

Query: 235 LDLIMNKDARNRFITRSEIIRYIRRFLDQRKFIEVETPMMNVIAGGATAKPFITHHNDLD 294
           L L + K  +N    R E  + +R  LD   F EVETP++         +  +     +D
Sbjct: 153 LQLRLPK-YQNNLKLRYEASKNVRTVLDSLNFTEVETPLLFKSTPEGAREFLVPTRGKID 211

Query: 295 MDMYMRI---APELFLKQLVVGGLDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVY 351
            +        +P+ + + L+  G++R +++ R FR+E +     PEFT  +   A++   
Sbjct: 212 GEASFYALPQSPQQYKQLLIASGVNRYFQVARCFRDEDLRSDRQPEFTQVDLEMAFSSGK 271

Query: 352 DLMDMTELMFSEMVKEITGS 371
           D+ ++ E + +    ++  S
Sbjct: 272 DVREVVEKVITSTWNKLHAS 291

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/111 (31%), Positives = 51/111 (45%), Gaps = 9/111 (8%)

Query: 468 HPQMMSPLAKYSR--DQPGLC--ERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKD 523
           HP  M  L  Y++    P  C  E +++ V   E+    T ++DP  Q   F E    K+
Sbjct: 511 HPFTMVNLRDYNKLESDPLSCHGEHYDLVVNGVELGGGSTRIHDPELQNYIFHEILNIKN 570

Query: 524 QGDDEAQLVDETFCNALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFP 574
             D    L+     NA + G PP  G+  G DR+   L  S +IR+V+ FP
Sbjct: 571 PEDLFGHLL-----NAFKMGTPPHAGFAIGFDRMCAMLCGSESIRDVIAFP 616

>KLLA0A11484g 992734..994158 similar to sp|P25345 Saccharomyces
           cerevisiae YCR024c asn-tRNA synthetase, mitochondrial,
           start by similarity
          Length = 474

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 88/378 (23%), Positives = 149/378 (39%), Gaps = 58/378 (15%)

Query: 203 VSRVQLLTPCLHMLPADHFGFKDQETRYRKRYLDLIMNKDARNRFITRSEIIRYIRRFLD 262
           V   Q   P L  LP         E ++R  YL  ++      RF  R ++   + + LD
Sbjct: 139 VQNKQTSLPTLRKLP---------EFKHRTTYLSNLL------RF--RHKVESQLTKTLD 181

Query: 263 QRKFIEVETPMMNVIAGGATAKPFITHHNDLDMDMYMRIAPELFLKQLVVGGLDRVYEIG 322
              F  V  P++  I      + F    +  D  + + ++ +L L+ L++G L RVY + 
Sbjct: 182 GLDFTMVRPPILTSIDCEGAGEMFNLKQDHWDEIVNLTVSSQLHLEVLMMG-LGRVYCLQ 240

Query: 323 RQFRNEGIDMT-HNPEFTTCEFYQAYADVYD-LMDMTELMFSEMVKEITGSY-IIKYHPD 379
             FR E  D   H  EF   E   ++ D  + LMD+ ELM   +V  ++ +  + KY P 
Sbjct: 241 PCFRAEKSDTNRHLCEFWMLEVEASFVDKNESLMDLVELMVKSVVLSLSETKDLPKYFPV 300

Query: 380 PAD-PAKELELNFSRPWKRINMIEELEKVFN--VKFPSGDQLHTAETGEFLKKILVDNKL 436
             +           + WKRI   + +E + +  VKF      H    G+ L         
Sbjct: 301 GCNIDITSRWAKLLQDWKRITYTDAVEALLSSGVKFE-----HDLAWGKDLNS------- 348

Query: 437 ECPPPLTNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAKYSRDQPGLCERFEV-FVAT 495
                  + R L    G        P F+  +P+         R      E F++ F   
Sbjct: 349 ------EHERWLCDHFG-------GPVFVTNYPRDCKAFYMKLRPDGTTVECFDLLFPEI 395

Query: 496 KEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLVDETFCNALEYGLPPTGGWGCGID 555
            EI       +D +D     +++  ++D   ++     + + N  + G  P GG+G GI+
Sbjct: 396 GEIVGGSVREDD-YDT---LKQEIERRDMASNQL----DWYLNLRKEGTVPHGGFGIGIE 447

Query: 556 RLAMFLTDSNTIREVLLF 573
           RL  +L  +  IR+ + F
Sbjct: 448 RLVSYLYGNPNIRDSIPF 465

>AGR206C [4517] [Homologous to ScYPL104W (MSD1) - SH]
           (1144536..1146491) [1956 bp, 651 aa]
          Length = 651

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 34/129 (26%), Positives = 61/129 (47%), Gaps = 3/129 (2%)

Query: 246 RFITRSEIIRYIRRFLDQRKFIEVETPMM-NVIAGGATAKPFITHHNDLDMDMYMRI--A 302
           R   R    + +R  L++  F+EVETP++      GA      T H      ++  +  +
Sbjct: 164 RMKMRHNASKTVRASLEKLGFMEVETPLLFKSTPEGAREFLVPTRHKQGKDPLFYALPQS 223

Query: 303 PELFLKQLVVGGLDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTELMFS 362
           P+ + + L+ GG+ + Y++ R FR+E +     PEFT  +   A+A+  D+M + E    
Sbjct: 224 PQQYKQLLMAGGVSKYYQLARCFRDEDLRSDRQPEFTQVDLEMAFANGDDVMRVVESTVL 283

Query: 363 EMVKEITGS 371
               E+  S
Sbjct: 284 NTWNEVALS 292

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 50/111 (45%), Gaps = 9/111 (8%)

Query: 468 HPQMMSPLAKYSR--DQPGLC--ERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKD 523
           HP  M  L  Y +  ++P  C  + ++  V   E+    T ++DP  QR  F +  +  +
Sbjct: 513 HPFTMVRLQDYQKLSEKPLSCLGQHYDFVVNGVELGGGSTRVHDPVLQRYIFNQILKINN 572

Query: 524 QGDDEAQLVDETFCNALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFP 574
           +      L++     A   G PP  G+  G DR+   +    +IR+V+ FP
Sbjct: 573 EDQVFGHLLE-----AFSMGTPPHAGFAIGFDRMVAMMCAKESIRDVIAFP 618

>AEL020W [2486] [Homologous to ScYHR019C (DED81) - SH]
           complement(598366..600024) [1659 bp, 552 aa]
          Length = 552

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 77/338 (22%), Positives = 130/338 (38%), Gaps = 56/338 (16%)

Query: 249 TRSEIIRYIRRFLDQRKFIEVETPMM--NVIAGGATAKPFITHHNDLDMDMYMRIAPELF 306
            R+  +R IRR  +    +EV  P M    + GG+T    +   +    + ++  + +L+
Sbjct: 251 VRAAFLRAIRRVYEDEGLLEVTPPCMVQTQVEGGST----LFKLDYYGEEAFLTQSSQLY 306

Query: 307 LKQLVVGGLDRVYEIGRQFRNEGIDM-THNPEFTTCEFYQAYADVYDLMDMTELMFSEMV 365
           L +  +  L  V+ I   FR E      H  E+T  E    + D   L+  TE + + +V
Sbjct: 307 L-ETCLPALGDVFCIQESFRAEKSHTRRHLSEYTHIEAELGFVDFDQLLRHTERVITSLV 365

Query: 366 K-----EITGSYIIKYHPD---PADPAKELELNFSRPWKRINMIEELEKVFNVKFPSGDQ 417
           +      + G  + + +PD   P  P   LE   +  W   + I+  E     +F  GD 
Sbjct: 366 RYVLEDPVAGPLVKQLNPDFVPPQMPFMRLEYKDAITWLNEHGIKNEE---GEEFKFGDD 422

Query: 418 LHTAETGEFLKKILVDNKLECPPPLTNARMLDKLVGELEDTCINPTFIFGHP-QMMSPLA 476
           +  AE  E                            ++ DT   P F+   P ++ S   
Sbjct: 423 I--AEAAER---------------------------KMTDTIGKPIFLTRFPLELKSFYM 453

Query: 477 KYSRDQPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLVDETF 536
           K   D P + E F+V + T       +   D  D     E  A  K +G +        F
Sbjct: 454 KRCADDPRVTESFDVLMPTVGEVTGGSMRIDSLD-----ELMAGFKREGVNPEPYY--WF 506

Query: 537 CNALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFP 574
            +   YG  P GG+G G +R+  +L +   +R+  L+P
Sbjct: 507 SDQRRYGSCPHGGYGLGTERILAWLCNRYPVRDCSLYP 544

>CAGL0H05907g complement(579444..581423) similar to sp|P15179
           Saccharomyces cerevisiae YPL104w MSD1, hypothetical
           start
          Length = 659

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 38/147 (25%), Positives = 71/147 (48%), Gaps = 16/147 (10%)

Query: 233 RYLDLIMNKDAR--NRFITRSEIIRYIRRFLDQRKFIEVETPMMNVIAGGATAKPFIT-- 288
           RY+ L   + AR  N   TR E+ + +R+ LDQ  F E+ETP +   A    A+ F+   
Sbjct: 151 RYIQL---RTARYQNYLRTRYEVSKTLRQILDQDGFTEIETPTL-FKATPEGAREFMVPT 206

Query: 289 ------HHNDLDMDMYMRI--APELFLKQLVVGGLDRVYEIGRQFRNEGIDMTHNPEFTT 340
                    D  + M+  +  +P+ + + L+  G+ + ++  R +R+E +     PEFT 
Sbjct: 207 RVSAKIKQVDKIVPMFYALTQSPQQYKQLLMASGVPKYFQFARCYRDEDLRADRQPEFTQ 266

Query: 341 CEFYQAYADVYDLMDMTELMFSEMVKE 367
            +   ++A   D+M + E   + + K+
Sbjct: 267 LDMEMSFASQKDVMSVIEKCITSVWKK 293

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 52/111 (46%), Gaps = 9/111 (8%)

Query: 468 HPQMMSPLAKYSR--DQPGLC--ERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKD 523
           HP  M  L  Y +    P  C  + +++ +   E+    T ++DP  Q+  FE   +  +
Sbjct: 520 HPFTMVQLQDYDKLTTNPIDCLGQHYDLVMNGIELGGGSTRIHDPELQKFMFENVLKISN 579

Query: 524 QGDDEAQLVDETFCNALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFP 574
                 Q++     +A E G PP  G+  G DR+   L  +++IR+V+ FP
Sbjct: 580 -----YQILFGHLLSAFETGTPPHAGFAIGYDRMCAMLCGTDSIRDVIPFP 625

>Scas_700.6
          Length = 658

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 44/193 (22%), Positives = 89/193 (46%), Gaps = 10/193 (5%)

Query: 174 LKRGDIVGVEGYVGRTQPKKGGEGE----VSVFVSRVQLLTPCLHMLPADHFGFKDQETR 229
           L R D++ V G + + + K     E      + V ++ +L    +  P+    FK ++  
Sbjct: 99  LNREDVIQVNGTLMKKKEKSVSSAENIFEYEIQVEKISVLNSS-NEKPSQLHEFK-KDGN 156

Query: 230 YRKRYLDLIMNKDARNRFI-TRSEIIRYIRRFLDQRKFIEVETPMM-NVIAGGAT--AKP 285
           Y   Y  L +       F+  R +I   +R+ L++ +F+E+ETP++      GA     P
Sbjct: 157 YPPEYRFLQLRHHKYQEFLRKRYQISCKLRQLLNEEEFLEIETPILFKPTPEGAREFLVP 216

Query: 286 FITHHNDLDMDMYMRIAPELFLKQLVVGGLDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQ 345
             T  N       +  +P+ + + L+  G+ + +++ R FR+E +     PEFT  +   
Sbjct: 217 TRTKENSTPSFYSLTQSPQQYKQLLMASGVFKYFQVARCFRDEDLRADRQPEFTQIDMEM 276

Query: 346 AYADVYDLMDMTE 358
           ++++  D+M + E
Sbjct: 277 SFSNGEDVMALLE 289

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 51/111 (45%), Gaps = 9/111 (8%)

Query: 468 HPQMMSPLAKYSR--DQPGLC--ERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKD 523
           HP  M  L  Y +    P  C  + +++ +   E+    T ++DP  Q   FE   + ++
Sbjct: 522 HPFTMVQLQDYEKLNSNPSQCRGQHYDLVINGVELGGGSTRVHDPILQDYIFENILKIEN 581

Query: 524 QGDDEAQLVDETFCNALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFP 574
             +    L+      A E G PP  G+  G DR+   L+ + +IR+V+ FP
Sbjct: 582 AEELFGHLL-----RAFEMGTPPHAGFAIGFDRMCAMLSGTESIRDVIAFP 627

>CAGL0A02112g 216596..218242 highly similar to sp|P38707
           Saccharomyces cerevisiae YHR019c DED81
           asparaginyl-tRNA-synthetase, hypothetical start
          Length = 548

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 112/493 (22%), Positives = 189/493 (38%), Gaps = 78/493 (15%)

Query: 102 SNPEFLAKYAHLKKGETLPEEKVSIAGRIHAKRESGSKLKFYVLHGDGVEVQLMSQLQDY 161
           S PE  AK   + +   L  ++V I+G IH  R S  K+ F VL  DG        LQ  
Sbjct: 106 SLPE--AKKCKIGQSYELVGQRVKISGWIHRLR-SNKKVMFIVLR-DG-----YGYLQSV 156

Query: 162 CDPDSYEKDHDL-LKRGDIVGVEGYVGRTQPKKGGEGEVSVFVSRVQLLTPCLHMLPADH 220
              D       L L     V + G + +    K   G V + V   +++     + P+  
Sbjct: 157 LTGDLAIAQQSLDLTIESTVTLYGTITKVPEGKSAPGGVELLVDYYEVV----GLAPSGD 212

Query: 221 FGF-------KDQETRYRKRYLDLIMNKDARNRFITRSEIIRYIRRFLDQRKFIEVETPM 273
             F        D      +R+L L   +        R+ +++ IRR   +    EV  P 
Sbjct: 213 EAFTNKIAEGADPSLLLDQRHLAL-RGETLSAVMKVRAALMKSIRRVYTEESLTEVTPPC 271

Query: 274 M--NVIAGGATAKPFITHHNDLDMDMYMRIAPELFLKQLVVGGLDRVYEIGRQFRNEGID 331
           M    + GG+T    +   +      Y+  + +L+L +  +  L  VY +   FR E   
Sbjct: 272 MVQTQVEGGST----LFKLDYYGEQAYLTQSSQLYL-ETCLPSLGDVYCVQESFRAEKSH 326

Query: 332 MT-HNPEFTTCEFYQAYADVYDLMDMTELMFSEMVK-----EITGSYIIKYHPD---PAD 382
              H  E+T  E   A+    +L+D  E +  + V+      I G  + + +PD   P  
Sbjct: 327 TRRHLSEYTHIEAELAFLTFEELLDHIERVLCKTVQYILEDPIAGPLVKQLNPDFQAPKM 386

Query: 383 PAKELELNFSRPWKRINMIEELEKVFNVKFPSGDQLHTAETGEFLKKILVDNKLECPPPL 442
           P   LE   +  W + + I+  +     +F  GD +  A   +    I V        P+
Sbjct: 387 PFMRLEYKDAIEWLKEHDIKNED---GEEFKFGDDIAEAAERKMTDTIGV--------PI 435

Query: 443 TNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAKYSRDQPGLCERFEVFVAT-KEICNA 501
               +L K   E++         F  P+         +D   + E  +V + T  EI   
Sbjct: 436 ----LLTKFPAEIKS--------FYMPR--------CKDDNRVTESVDVLMPTVGEITGG 475

Query: 502 YTELNDPFDQRARFEEQARQKDQGDDEAQLVDETFCNALEYGLPPTGGWGCGIDRLAMFL 561
              +N   +  A F     +++  D +A      F +  +YG  P GG+G G +R+  +L
Sbjct: 476 SMRINTEEELLAGF-----KRENIDPKAYY---WFIDQRKYGTCPHGGYGLGTERILAWL 527

Query: 562 TDSNTIREVLLFP 574
            +  T+R+  L+P
Sbjct: 528 CNRFTVRDCSLYP 540

>Scas_607.14
          Length = 555

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 75/339 (22%), Positives = 136/339 (40%), Gaps = 58/339 (17%)

Query: 249 TRSEIIRYIRRFLDQRKFIEVETPMM--NVIAGGATAKPFITHHNDLDMDMYMRIAPELF 306
            R+ ++R +RR  ++   +EV  P M    + GG+T    +   +    + ++  + +L+
Sbjct: 254 VRAALLRAVRRVYEEEGLLEVTPPCMVQTQVEGGST----LFKLDYYGEEAFLTQSSQLY 309

Query: 307 LKQLVVGGLDRVYEIGRQFRNEGIDMT-HNPEFTTCEFYQAYADVYDLMDMTELMFSEMV 365
           L +  +  L  V+ +   FR E      H  E+T  E   A+    +L++  E +  + V
Sbjct: 310 L-ETCLPALGDVFCVQESFRAEKSHTRRHLSEYTHIEAELAFLTFEELLEHIETLIVKSV 368

Query: 366 K-----EITGSYIIKYHPD---PADPAKELELNFSRPWKRINMIEELEKVFNVKFPSGDQ 417
           +      + G  + + HP    P  P   LE   +  W + + I+  E   + KF  GD 
Sbjct: 369 QYVMEDPVAGPIVNQLHPHFVPPKGPFMRLEYKDAITWLQEHNIKN-EDGEDFKF--GDD 425

Query: 418 LHTAETGEFLKKILVDNKLECPPPLTNARMLDKLVGELEDTCINPTFIFGHP-QMMSPLA 476
           +  AE  E                            ++ DT   P  +   P ++ S   
Sbjct: 426 I--AEAAE---------------------------RKMTDTLNVPILLTRFPVEIKSFYM 456

Query: 477 KYSRDQPGLCERFEVFVAT-KEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLVDET 535
              +D P + E  +V + T  EI      ++D  +  A F      K +G D        
Sbjct: 457 PKCKDDPRVTESVDVLMPTVGEITGGSMRISDIDELMAGF------KREGIDPKPYY--W 508

Query: 536 FCNALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFP 574
           F +  +YG  P GG+G G +R+  +L +  T+R+  L+P
Sbjct: 509 FIDQRKYGTCPHGGYGLGTERILAWLCNRFTVRDCSLYP 547

>Kwal_0.375
          Length = 428

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 67/286 (23%), Positives = 122/286 (42%), Gaps = 32/286 (11%)

Query: 97  FHVSISNPEFL---AKYAHLKKGETLPEEKVSIAGRIHAKRESGSKLKFYVLH-GDG-VE 151
            ++SI   E L    KY  +K  + + +++V ++G IH +R S S L F VL  G G ++
Sbjct: 103 LNISIKQDESLPDATKYKIIKSYDAI-DQRVKVSGWIHRQRSSKS-LVFIVLRDGTGYLQ 160

Query: 152 VQLMSQLQDYCDPDSYEKDHDLLKRGDIVGVEGYVGRTQPKKGGEGEVSVFVSRVQLLTP 211
             L   L       +   +  +   G +  +    G+T P     G V + V   ++++ 
Sbjct: 161 AVLTGDLARAHQTSTLTLESSITLYGKVCKLPE--GKTAP-----GGVELLVDYYEIIS- 212

Query: 212 CLHMLPA--DHFGFKDQETRYRKRYLD---LIMNKDARNRFI-TRSEIIRYIRRFLDQRK 265
              + P+  D F  K  E       LD   L +  +  +  +  R+ ++R +RRF DQ  
Sbjct: 213 ---LAPSGDDAFTNKIAEGADPSLLLDQRHLALRGETLSAVMKVRAALLRSVRRFYDQEG 269

Query: 266 FIEVETPMM--NVIAGGATAKPFITHHNDLDMDMYMRIAPELFLKQLVVGGLDRVYEIGR 323
             EV  P M    + GG+T      +      + Y+  + +L+L +  +  L  VY I  
Sbjct: 270 LTEVTPPCMVQTQVEGGSTLFKLGYYGE----EAYLTQSSQLYL-ETCLASLGDVYSIQE 324

Query: 324 QFRNEGIDM-THNPEFTTCEFYQAYADVYDLMDMTELMFSEMVKEI 368
            FR E      H  E+T  E    +    +++   E + +++V+ +
Sbjct: 325 SFRAEKSHTRRHLSEYTHIEAELCFLSFDEMLVHIEKLITQVVQSV 370

>CAGL0K07656g 761388..762881 highly similar to sp|P15625
           Saccharomyces cerevisiae YFL022c Phenylalanyl-tRNA
           synthetase alpha chain, start by similarity
          Length = 497

 Score = 34.7 bits (78), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 34/64 (53%), Gaps = 7/64 (10%)

Query: 317 RVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVY--DLMDMTELMFSEMVKEITGSYII 374
           R++ I R FRNE +D TH  EF   E   A  ++   DL+   E  F++M   +TG   +
Sbjct: 345 RLFSIDRVFRNEAVDATHLAEFHQVEGVLADYNITLGDLIKFMEDFFAKM--GVTG---L 399

Query: 375 KYHP 378
           K+ P
Sbjct: 400 KFKP 403

>KLLA0C18612g 1646511..1652933 similar to sp|P25655 Saccharomyces
            cerevisiae YCR093w CDC39 nuclear protein singleton, start
            by similarity
          Length = 2140

 Score = 35.0 bits (79), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 25/113 (22%), Positives = 49/113 (43%), Gaps = 15/113 (13%)

Query: 154  LMSQLQDYCDPDSYEKDHDLLKRGDIVGVEGYVGRTQPKKGGEGEVSVFVSRVQLLTPCL 213
            L+SQ++DY +   +   +D   +  IV +  ++ R+  K     +VS      Q +   L
Sbjct: 1430 LVSQIKDYSEDVEFNLQNDSTIKNTIVEILSFISRSNQKDQLSLKVS------QAVVNSL 1483

Query: 214  HMLPADHFGFKDQETRYRKRYLDLIMNKDARNRFITRSEIIRYIRRFLDQRKF 266
                     F   E++  +  L L++ K      + R +++ ++   LD RKF
Sbjct: 1484 ---------FGSNESKLCRDVLSLLLEKLCSLSIVARKDVVWWLVYALDPRKF 1527

>AFR516W [3708] [Homologous to ScYFL022C (FRS2) - SH]
           complement(1358569..1360068) [1500 bp, 499 aa]
          Length = 499

 Score = 34.3 bits (77), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 317 RVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVY--DLMDMTELMFSEM 364
           R++ I R FRNE +D TH  EF   E   A  ++   DL+   E  F++M
Sbjct: 347 RLFSIDRVFRNEAVDATHLAEFHQVEGVLADYNITLGDLIQFMEDFFAKM 396

>Scas_707.14
          Length = 499

 Score = 34.3 bits (77), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 317 RVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVY--DLMDMTELMFSEM 364
           R++ I R FRNE +D TH  EF   E   A  ++   DL+   E  F++M
Sbjct: 347 RLFSIDRVFRNEAVDATHLAEFHQVEGVLADYNITLGDLIKFMEEFFAKM 396

>KLLA0F25234g complement(2349192..2350691) highly similar to
           sp|P15625 Saccharomyces cerevisiae YFL022c FRS2
           phenylalanine--tRNA ligase beta chain, cytosolic
           singleton, start by similarity
          Length = 499

 Score = 33.9 bits (76), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 317 RVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVY--DLMDMTELMFSEM 364
           R++ I R FRNE +D TH  EF   E   A  ++   DL+   E  F++M
Sbjct: 347 RLFSIDRVFRNEAVDATHLAEFHQVEGVLADYNITLGDLIQFMEDFFAKM 396

>Kwal_47.17998
          Length = 499

 Score = 33.5 bits (75), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 26/50 (52%), Gaps = 2/50 (4%)

Query: 317 RVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVY--DLMDMTELMFSEM 364
           R++ I R FRNE +D TH  EF   E   A  ++   DL+   E  F +M
Sbjct: 347 RLFSIDRVFRNEAVDATHLAEFHQVEGVLADYNITLGDLIQFMEGFFEKM 396

>YFL022C (FRS2) [1661] chr6 complement(93497..95008)
           Phenylalanyl-tRNA synthetase, beta subunit, cytoplasmic
           [1512 bp, 503 aa]
          Length = 503

 Score = 33.1 bits (74), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 2/50 (4%)

Query: 317 RVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVY--DLMDMTELMFSEM 364
           R++ I R FRNE +D TH  EF   E   A  ++   DL+   E  F  M
Sbjct: 351 RLFSIDRVFRNEAVDATHLAEFHQVEGVLADYNITLGDLIKFMEEFFERM 400

>Scas_628.24
          Length = 487

 Score = 31.6 bits (70), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 68/339 (20%), Positives = 133/339 (39%), Gaps = 46/339 (13%)

Query: 256 YIRRFLDQRKFIEVETPMMNVIAGGATAKPFITHHNDLD-----------MDMYMRIAPE 304
           Y ++ L  R F+E +     +I       P I   ND +            D Y+ ++ +
Sbjct: 166 YFKQQLKFRSFMEFQIHYFLMINNFIKVAPPIITGNDCEGANNELFKIKPTDAYLTVSAQ 225

Query: 305 LFLKQLVVGGLDRVYEIGRQFRNEGIDMT-HNPEFTTCEFYQAYAD-VYDLMDMTELMFS 362
           L L+ L+    ++ + +   FR E  +   H  EF   E   AY D +  L+D       
Sbjct: 226 LHLETLL-NSTNKTWSLIPCFRAEKSNTNRHLLEFWMLELELAYIDDLEPLLDFIREFII 284

Query: 363 EMVK---EITGSYIIKYHPDPADPAKELELNFSRPWKRINMIEELEKVFNVKFPSGDQLH 419
            +VK   E     + +Y+P+  D              R  ++   + + +   PS  + +
Sbjct: 285 YLVKQCREHENDLLPRYYPNGVD-------------DRETILTRWDSLID---PS--KWN 326

Query: 420 TAETGEFLKKILVDNKLECPPPLTNARMLDKLVGELEDTCIN--PTFIFGHPQMMSPL-A 476
           T    + +KK+    +     P     +  +    L ++  N  P F+  +P+       
Sbjct: 327 TVTYDDAIKKLQESGQDFVFKPTWGKALQSEHEKWLAESYFNGTPVFVTKYPKDCKAFYM 386

Query: 477 KYSRDQPGLCERFEVFV-ATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLVDET 535
           K + + P   E F++ V    EI       N+     A+ E +  ++   +   +L    
Sbjct: 387 KQTPENPETVECFDLLVPGMGEIIGGSLRENN----SAKLESEMDRRGM-NKRGEL--NW 439

Query: 536 FCNALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFP 574
           + +  + G  P GG+G G++RL  +L  ++ I++ + FP
Sbjct: 440 YIDLRKNGSVPHGGFGLGLERLISYLFGNHNIKDAIPFP 478

>Scas_717.11
          Length = 1280

 Score = 31.6 bits (70), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 38/81 (46%), Gaps = 8/81 (9%)

Query: 380 PADPAKELELNFSRPWKRINMIEELEKVFNVKFPSGDQLHTAETGEFLKKILVDNKLECP 439
           P D AKE+++   R    I  +  +  + N+  PSGD      T   LK+ L+DN  +  
Sbjct: 635 PRDLAKEVKILLLRSSPIIYNVSNISSLLNISHPSGD------TEVELKRKLLDNISKVN 688

Query: 440 PPL--TNARMLDKLVGELEDT 458
           P +     RML   + E E++
Sbjct: 689 PTIFKDQVRMLKDSINEYEES 709

>KLLA0F24200g 2257007..2258965 similar to sp|P53918 Saccharomyces
           cerevisiae YNL125c ESBP6, hypothetical start
          Length = 652

 Score = 31.2 bits (69), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 30/63 (47%), Gaps = 9/63 (14%)

Query: 509 FDQRARFEEQARQKD----QGDDEAQLVDETFCN--ALEYGLPPTGGWG---CGIDRLAM 559
           FDQ +  E + R +      GDDE Q +++ F N       LPP GG+G   C    L M
Sbjct: 148 FDQTSDSEGEYRSEVPVELAGDDEGQTLNKVFTNKETNTLDLPPEGGYGWVCCLCVTLVM 207

Query: 560 FLT 562
           F T
Sbjct: 208 FST 210

>CAGL0L08030g 875106..876509 similar to sp|P25345 Saccharomyces
           cerevisiae YCR024c asn-tRNA synthetase, hypothetical
           start
          Length = 467

 Score = 31.2 bits (69), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 12/39 (30%), Positives = 21/39 (53%)

Query: 536 FCNALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFP 574
           + N  + G+ P GG+G G +R   +L     I++ + FP
Sbjct: 420 YVNLRKQGVAPHGGFGLGFERFISYLLGIQNIKDTIPFP 458

>ADR179C [1920] [Homologous to ScYML015C (TAF40) - SH]
           (1017982..1018980) [999 bp, 332 aa]
          Length = 332

 Score = 30.0 bits (66), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 17/26 (65%)

Query: 144 VLHGDGVEVQLMSQLQDYCDPDSYEK 169
           V  GDG+E ++M Q  D CD DS E+
Sbjct: 221 VEEGDGIEDEIMEQESDICDDDSKEE 246

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.138    0.408 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 19,071,112
Number of extensions: 847144
Number of successful extensions: 2321
Number of sequences better than 10.0: 54
Number of HSP's gapped: 2330
Number of HSP's successfully gapped: 66
Length of query: 581
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 474
Effective length of database: 12,891,983
Effective search space: 6110799942
Effective search space used: 6110799942
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 64 (29.3 bits)