Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YDR036C (EHD3)50049226010.0
Scas_661.2652346315440.0
CAGL0K11968g49545214650.0
Kwal_56.2308747645812071e-163
KLLA0F18678g50446211151e-148
AGR024C4774569981e-131
Scas_526.2304168760.28
YOR180C (DCI1)271177720.75
Sklu_2044.3284169691.8
YNL167C (SKO1)64753665.8
KLLA0C04686g277184646.4
CAGL0H05071g1110115657.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YDR036C
         (492 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YDR036C (EHD3) [889] chr4 complement(523206..524708) Member of t...  1006   0.0  
Scas_661.26                                                           599   0.0  
CAGL0K11968g complement(1153196..1154683) similar to sp|P28817 S...   568   0.0  
Kwal_56.23087                                                         469   e-163
KLLA0F18678g 1716890..1718404 similar to sp|P28817 Saccharomyces...   434   e-148
AGR024C [4334] [Homologous to ScYDR036C - SH] (759545..760978) [...   389   e-131
Scas_526.2                                                             34   0.28 
YOR180C (DCI1) [4977] chr15 complement(674352..675167) Peroxisom...    32   0.75 
Sklu_2044.3 YLR284C, Contig c2044 3827-4681                            31   1.8  
YNL167C (SKO1) [4429] chr14 complement(319416..321359) Transcrip...    30   5.8  
KLLA0C04686g complement(428962..429795) similar to sgd|S0004274 ...    29   6.4  
CAGL0H05071g 486899..490231 similar to sp|Q12749 Saccharomyces c...    30   7.3  

>YDR036C (EHD3) [889] chr4 complement(523206..524708) Member of the
           enoyl-coA hydratase/isomerase protein family [1503 bp,
           500 aa]
          Length = 500

 Score = 1006 bits (2601), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 483/492 (98%), Positives = 483/492 (98%)

Query: 1   MLRNTLKCAQLSSKYGFKXXXXXXXXXQPQLNVTDAPPVLFTVQDTARVITLNRPKKLNA 60
           MLRNTLKCAQLSSKYGFK         QPQLNVTDAPPVLFTVQDTARVITLNRPKKLNA
Sbjct: 1   MLRNTLKCAQLSSKYGFKTTTRTFMTTQPQLNVTDAPPVLFTVQDTARVITLNRPKKLNA 60

Query: 61  LNAEMSESMFKTLNEYAKSDTTNLVILKSSNRPRSFCAGGDVATVAIFNFNKEFAKSIKF 120
           LNAEMSESMFKTLNEYAKSDTTNLVILKSSNRPRSFCAGGDVATVAIFNFNKEFAKSIKF
Sbjct: 61  LNAEMSESMFKTLNEYAKSDTTNLVILKSSNRPRSFCAGGDVATVAIFNFNKEFAKSIKF 120

Query: 121 FTDEYSLNFQIATYLKPIVTFMDGITMGGGVGLSIHTPFRIATENTKWAMPEMDIGFFPD 180
           FTDEYSLNFQIATYLKPIVTFMDGITMGGGVGLSIHTPFRIATENTKWAMPEMDIGFFPD
Sbjct: 121 FTDEYSLNFQIATYLKPIVTFMDGITMGGGVGLSIHTPFRIATENTKWAMPEMDIGFFPD 180

Query: 181 VGSTFALPRIVTLANSNSQMALYLCLTGEVVTGADAYMLGLASHYVSSENLDALQKRLGE 240
           VGSTFALPRIVTLANSNSQMALYLCLTGEVVTGADAYMLGLASHYVSSENLDALQKRLGE
Sbjct: 181 VGSTFALPRIVTLANSNSQMALYLCLTGEVVTGADAYMLGLASHYVSSENLDALQKRLGE 240

Query: 241 ISPPFNNDPQSAYFFGMVNESIDEFVSPLPKDYVFKYSNEKLNVIEACFNLSKNGTIEDI 300
           ISPPFNNDPQSAYFFGMVNESIDEFVSPLPKDYVFKYSNEKLNVIEACFNLSKNGTIEDI
Sbjct: 241 ISPPFNNDPQSAYFFGMVNESIDEFVSPLPKDYVFKYSNEKLNVIEACFNLSKNGTIEDI 300

Query: 301 MNNLRQYEGSAEGKAFAQEIKTKLLTKSPSSLQIALRLVQENSRDHIESAIKRDLYTAAN 360
           MNNLRQYEGSAEGKAFAQEIKTKLLTKSPSSLQIALRLVQENSRDHIESAIKRDLYTAAN
Sbjct: 301 MNNLRQYEGSAEGKAFAQEIKTKLLTKSPSSLQIALRLVQENSRDHIESAIKRDLYTAAN 360

Query: 361 MCMNQDSLVEFSEATKHKLIDKQRVPYPWTKKEQLFVSQLTSITSPKPSLPMSLLRNTSN 420
           MCMNQDSLVEFSEATKHKLIDKQRVPYPWTKKEQLFVSQLTSITSPKPSLPMSLLRNTSN
Sbjct: 361 MCMNQDSLVEFSEATKHKLIDKQRVPYPWTKKEQLFVSQLTSITSPKPSLPMSLLRNTSN 420

Query: 421 VTWTQYPYHSKYQLPTEQEIAAYIEKRTNDDTGAKVTEREVLNHFANVIPSRRGKLGIQS 480
           VTWTQYPYHSKYQLPTEQEIAAYIEKRTNDDTGAKVTEREVLNHFANVIPSRRGKLGIQS
Sbjct: 421 VTWTQYPYHSKYQLPTEQEIAAYIEKRTNDDTGAKVTEREVLNHFANVIPSRRGKLGIQS 480

Query: 481 LCKIVCERKCEE 492
           LCKIVCERKCEE
Sbjct: 481 LCKIVCERKCEE 492

>Scas_661.26
          Length = 523

 Score =  599 bits (1544), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/463 (60%), Positives = 362/463 (78%), Gaps = 7/463 (1%)

Query: 35  DAPPVLFTVQDTARVITLNRPKKLNALNAEMSESMFKTLNEYAKSDTTNLVILKSSNRPR 94
           +A PVLF++QDTARV+TLNRP KLNALN EM +SMF+ LNEY+KSD TNL+I+KSS++ R
Sbjct: 48  EAAPVLFSMQDTARVVTLNRPAKLNALNFEMCQSMFQILNEYSKSDATNLIIVKSSDKGR 107

Query: 95  SFCAGGDVATVAIFNFNKEFAKSIKFFTDEYSLNFQIATYLKPIVTFMDGITMGGGVGLS 154
           S CAGGDVATVA+ N N    K+I+FF  EYSLN Q+ATY KPIVT+M+GITMGGGVGLS
Sbjct: 108 SLCAGGDVATVAVQNLNGNHKKAIEFFEAEYSLNLQMATYPKPIVTYMNGITMGGGVGLS 167

Query: 155 IHTPFRIATENTKWAMPEMDIGFFPDVGSTFALPRIVTLANSNSQMALYLCLTGEVVTGA 214
           +HTPFRIATENTKWAMPEMDIGFFPDVG+TFALPR+VT+AN++SQMALYLCLTGEV+ G 
Sbjct: 168 VHTPFRIATENTKWAMPEMDIGFFPDVGTTFALPRLVTMANNHSQMALYLCLTGEVLNGE 227

Query: 215 DAYMLGLASHYVSSENLDALQKRLGEISPP--FNNDP--QSAYFFGMVNESIDEFVSPLP 270
           DAYMLGLASHYV+SENL +L+ RLGE++P      DP   SA FF MVN +I+EF + LP
Sbjct: 228 DAYMLGLASHYVNSENLQSLEVRLGELTPTKHITADPAKSSAIFFDMVNGTINEFSTNLP 287

Query: 271 KDYVFKYSNEKLNVIEACFNLSKNGTIEDIMNNLRQYEGSAEGKAFAQEIKTKLLTKSPS 330
            DY FK++ ++L+VIE+CF+++++ +IE+I+ +L QY  S  G +F  EIK KL TKS +
Sbjct: 288 MDYKFKFTTDQLDVIESCFDITRHTSIEEILRSLDQYAKSEAGISFCTEIKNKLATKSMT 347

Query: 331 SLQIALRLVQENSRDHIESAIKRDLYTAANMCMNQDSLVEFSEATKHKLIDKQRVPYPWT 390
           S+QIAL++++ENSRD I SA++RDL+TA+NMC+N++ + EFSEATKHKL+DKQ+ PYPW 
Sbjct: 348 SMQIALKVLKENSRDDINSALRRDLFTASNMCVNEEGVSEFSEATKHKLVDKQKTPYPWK 407

Query: 391 KKEQLFVSQLTSITSPKPSLPMSLLRNTSNVTWTQYPYHSKYQLPTEQEIAAYIEKRTND 450
               +  + L ++ SPK S P+SL  N SN+TW QYPYHSKYQLP+EQ I  Y+ + +  
Sbjct: 408 HNSVISPNLLRAMVSPKLSTPVSLWENFSNITWDQYPYHSKYQLPSEQSIKQYLRRVSGH 467

Query: 451 DTGAK---VTEREVLNHFANVIPSRRGKLGIQSLCKIVCERKC 490
             GA    +T+ EVL HF       + K  +  +C I+CERKC
Sbjct: 468 QDGATSAFITKNEVLKHFTRTNKLTKDKSDVALICNIICERKC 510

>CAGL0K11968g complement(1153196..1154683) similar to sp|P28817
           Saccharomyces cerevisiae YDR036c, hypothetical start
          Length = 495

 Score =  568 bits (1465), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/452 (58%), Positives = 342/452 (75%), Gaps = 3/452 (0%)

Query: 38  PVLFTVQDTARVITLNRPKKLNALNAEMSESMFKTLNEYAKSDTTNLVILKSSNRPRSFC 97
           PVLF+VQ+TAR++TLNRPKKLNALN EM  S+F TL EY+KSD  NL+++KS+N PRS C
Sbjct: 34  PVLFSVQETARIVTLNRPKKLNALNEEMCSSIFNTLTEYSKSDAANLILIKSNNSPRSLC 93

Query: 98  AGGDVATVAIFNFNKEFAKSIKFFTDEYSLNFQIATYLKPIVTFMDGITMGGGVGLSIHT 157
           AGGDVA+VA  N +K F  SI  F  EYSLNFQ+ATY KP+V FMDGITMGGGVGLSIHT
Sbjct: 94  AGGDVASVAQSNLDKNFESSINCFKSEYSLNFQLATYQKPVVVFMDGITMGGGVGLSIHT 153

Query: 158 PFRIATENTKWAMPEMDIGFFPDVGSTFALPRIVTLANSNSQMALYLCLTGEVVTGADAY 217
           PFRIATENTKWAMPE DIGFFPDVG+TFALPR++TLAN N+QMALYLCLTG+V++G DAY
Sbjct: 154 PFRIATENTKWAMPETDIGFFPDVGTTFALPRLITLANKNAQMALYLCLTGDVISGEDAY 213

Query: 218 MLGLASHYVSSENLDALQKRLGEISPPFNNDPQSAYFFGMVNESIDEFVSPLPKDYVFKY 277
           +LGLASHY+   NL+ LQ RLGE+ P  +    S  FF  VN +I+EF +PLP ++ FK+
Sbjct: 214 LLGLASHYIPHSNLEKLQTRLGELRPALDIKFFSDEFFDSVNLAIEEFTTPLPTNHKFKF 273

Query: 278 SNEKLNVIEACFNLSKNGTIEDIMNNLRQYEGSAEGKAFAQEIKTKLLTKSPSSLQIALR 337
           S ++L VIE CF++S   +I  I + L  +EG+ E   FA++ K KL +KS +S+Q+ +R
Sbjct: 274 SKDQLEVIEKCFDISSGESINAIFSKLEAFEGTPEMMQFARDTKKKLESKSMTSMQVGIR 333

Query: 338 LVQENSRDHIESAIKRDLYTAANMCMNQDSLVEFSEATKHKLIDKQRVPYPWTKKEQLFV 397
           L+QENSRD IESA+KRDL TA NMC+N   + EFS ATKHKL+DKQ+VPYPW ++ +L  
Sbjct: 334 LMQENSRDDIESALKRDLTTAVNMCVNDSGIAEFSAATKHKLLDKQKVPYPWKQRTELTP 393

Query: 398 SQLTSITSPKPSLPMSLLRNTSNVTWTQYPYHSKYQLPTEQEIAAYIEKRTNDDTGAKVT 457
            Q+TS+ +PKPSLP+SL+RN SNVTW+QYP+  KYQLP + EI   +EK         + 
Sbjct: 394 QQVTSLIAPKPSLPVSLIRNNSNVTWSQYPHSLKYQLPRDYEIEQQVEKLIKR---GPIK 450

Query: 458 EREVLNHFANVIPSRRGKLGIQSLCKIVCERK 489
           + +V+ +F +  P  + KLG++  C ++ + K
Sbjct: 451 KNDVVKYFTDFNPQTKAKLGVEQYCDLLFDWK 482

>Kwal_56.23087
          Length = 476

 Score =  469 bits (1207), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 233/458 (50%), Positives = 309/458 (67%), Gaps = 18/458 (3%)

Query: 39  VLFTVQDTARVITLNRPKKLNALNAEMSESMFKTLNEYAKSDTTNLVILKSSNRPRSFCA 98
           V F  +  +RV+TL RP+KLNAL+ +M + +  TL EYAKSD  N+VI+KSSN PRS CA
Sbjct: 19  VKFGSKGVSRVVTLARPEKLNALSTQMCQRIIPTLQEYAKSDVNNIVIIKSSNAPRSLCA 78

Query: 99  GGDVATVAIFNFNKEFAKSIKFFTDEYSLNFQIATYLKPIVTFMDGITMGGGVGLSIHTP 158
           GGDVA VA+ N   +   S++FF  EYSLN  +ATY KP+V  MDGITMGGGVGL+ H P
Sbjct: 79  GGDVANVALQNLAGKLDSSLEFFQSEYSLNLLLATYNKPVVVLMDGITMGGGVGLATHVP 138

Query: 159 FRIATENTKWAMPEMDIGFFPDVGSTFALPRIVTLANSNSQMALYLCLTGEVVTGADAYM 218
           FRIATENT+W MPEMDIGFFPDVG+TF+LP+I T+     Q+ALYLCLTG++++G D YM
Sbjct: 139 FRIATENTRWCMPEMDIGFFPDVGTTFSLPKITTVGGVKGQLALYLCLTGDLLSGVDVYM 198

Query: 219 LGLASHYVSSENLDALQKRLGEISPPFNNDPQSAYFFGMVNESIDEFVSPLPKDYVFKYS 278
            GLASHYV S NL+ LQ RLGE+  P  N   S   + +  ++++EF   +P+DY FKYS
Sbjct: 199 AGLASHYVPSHNLEDLQARLGEL--PVTN---SEEMWKITGDALEEFSVAIPEDYNFKYS 253

Query: 279 NEKLNVIEACFNLSKNG------TIEDIMNNLRQYEGSAEGKAFAQEIKTKLLTKSPSSL 332
           N +LNVIE CF   +NG       +E I+N+      S E K F++    KL +KSP SL
Sbjct: 254 NAQLNVIETCFG-PENGLKGIRAALEKIVNS---SSASPEEKEFSRVTLQKLASKSPVSL 309

Query: 333 QIALRLVQENSRDHIESAIKRDLYTAANMCMNQDSLVEFSEATKHKLIDKQRVPYPWTKK 392
           Q+A+     NS+  IESA+K+DL TA+NMC  +D++ EFS+ATKHKL+DK + P+ WTK 
Sbjct: 310 QVAIEQFHRNSQSDIESALKQDLVTASNMC--EDTVSEFSQATKHKLVDKSKAPFQWTKT 367

Query: 393 EQLFVSQLTSITSPKPSLPMSLLRNTSNVTWTQYPYHSKYQLPTEQEIAAYIEKRTNDDT 452
             L V +L+ + SP+ +  +SL +   ++TW +YPYHS++ LPTEQ +  YI    N   
Sbjct: 368 -ALTVEELSRLVSPRAATSVSLQKFPDSLTWKKYPYHSQFMLPTEQNLKDYITGNDNSGR 426

Query: 453 GAKVTEREVLNHFANVIPSRRGKLGIQSLCKIVCERKC 490
                  EVL +F+   PS +GK GI+ LC  +C RKC
Sbjct: 427 SLAANHAEVLKYFSQYNPSSKGKTGIRYLCDQICSRKC 464

>KLLA0F18678g 1716890..1718404 similar to sp|P28817 Saccharomyces
           cerevisiae YDR036c singleton, start by similarity
          Length = 504

 Score =  434 bits (1115), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 221/462 (47%), Positives = 305/462 (66%), Gaps = 17/462 (3%)

Query: 39  VLFTVQDTARVITLNRPKKLNALNAEMSESMFKTLNEYAKSDTTNLVILKSSNRPRSFCA 98
           V F V  TARV+TL+RPKKLNAL+ EM  ++  TL EYAKS   N+VIL SS  PR+FC+
Sbjct: 33  VKFRVDSTARVVTLDRPKKLNALDVEMCSAILPTLQEYAKSTVNNVVILNSSASPRAFCS 92

Query: 99  GGDVATVAIFNFNKEFAKSIKFFTDEYSLNFQIATYLKPIVTFMDGITMGGGVGLSIHTP 158
           GGDVA VA       F  + +FFT EYSLN  +AT  KP+++ MDGITMGGGVGLS H P
Sbjct: 93  GGDVAQVAKLVKEGNFDYAREFFTKEYSLNLALATLNKPVISIMDGITMGGGVGLSTHIP 152

Query: 159 FRIATENTKWAMPEMDIGFFPDVGSTFALPRIVTLANSNSQMALYLCLTGEVVTGADAYM 218
           FRIATENT+WAMPEMDIGFFPDVG+TF++P++ T+  SN Q+A YLC+TG+++ GADAY+
Sbjct: 153 FRIATENTRWAMPEMDIGFFPDVGATFSIPKLTTVGGSNGQLAQYLCMTGDILNGADAYV 212

Query: 219 LGLASHYVSSENLDALQKRLGEI------SPPFNNDPQSAYFFGMVNESIDEFVSPLPKD 272
            G+ASHYV  + +  LQ RL E+      S   N D +    F +VN +I+EF +PLP+D
Sbjct: 213 AGVASHYVPHDQISNLQARLAELHLTEATSQSTNRDDE---IFDVVNHAIEEFNAPLPRD 269

Query: 273 YVFKYSNEKLNVIEACFNLSKNGTIEDIMNNLRQYEG----SAEGKAFAQEIKTKLLTKS 328
           Y FKY+ ++LNVIE CF++    +++ I + L +       S   + FA + K  L +KS
Sbjct: 270 YKFKYTADELNVIEQCFDI--GNSLKQIYSKLDEVIAGKTVSQTAQEFAAKTKQMLASKS 327

Query: 329 PSSLQIALRLVQENSRDHIESAIKRDLYTAANMCMNQDSLVEFSEATKHKLIDKQRVPYP 388
           P SL+IA  L Q NS   I++A+ +DL TA  M  + D L EF+EAT HKL++K + PY 
Sbjct: 328 PVSLEIAKELFQRNSFTDIQTALTQDLITATKMSESPD-LCEFAEATSHKLLEKNKTPYQ 386

Query: 389 WTKKEQLFVSQLTSITSPKPSLPMSLLRNTSNVTWTQYPYHSKYQLPTEQEIAAYIEKRT 448
           W  K+ L ++Q++ + S   S P+SL+R ++ VT+++YP+HSKYQLP E  +  YI    
Sbjct: 387 WKIKD-LKLAQISVLISQNSSNPVSLIRPSNLVTFSEYPHHSKYQLPNETLVEKYITGAD 445

Query: 449 NDDTGAKVTEREVLNHFANVIPSRRGKLGIQSLCKIVCERKC 490
           N      VT++E +  F  + P+ + K G+  L   + +RKC
Sbjct: 446 NHGRQTAVTKKEAVKFFQQLNPATKSKTGVDYLVGFIIDRKC 487

>AGR024C [4334] [Homologous to ScYDR036C - SH] (759545..760978)
           [1434 bp, 477 aa]
          Length = 477

 Score =  389 bits (998), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 203/456 (44%), Positives = 276/456 (60%), Gaps = 13/456 (2%)

Query: 39  VLFTVQDTARVITLNRPKKLNALNAEMSESMFKTLNEYAKSDTTNLVILKSSNRPRSFCA 98
           V F   +TARV+TLNRP+KLNA+N E+  S+   + EYAKSD  N+++  S+  PR+FCA
Sbjct: 19  VKFKTNNTARVVTLNRPEKLNAINHEICHSILPVMQEYAKSDVANVIVFDSACAPRAFCA 78

Query: 99  GGDVATVAIFNFNKEFAKSIKFFTDEYSLNFQIATYLKPIVTFMDGITMGGGVGLSIHTP 158
           GGD+  +A         K   FF  EY++N+ +ATY KP+V  MDGITMGGGVGL+IH P
Sbjct: 79  GGDIVLMAKAMRRDMLEKVDDFFQGEYTMNWMLATYPKPVVALMDGITMGGGVGLTIHVP 138

Query: 159 FRIATENTKWAMPEMDIGFFPDVGSTFALPRIVTLANSNSQMALYLCLTGEVVTGADAYM 218
           FR+ATENTKWAMPE+DIG  PDVG +FALPRI+TL     Q+  YLCLTGEV+ GAD YM
Sbjct: 139 FRVATENTKWAMPELDIGLHPDVGVSFALPRIMTLGGQEGQLGYYLCLTGEVLQGADVYM 198

Query: 219 LGLASHYVSSENLDALQKRLGEISPPFNNDPQSAYFFGMVNESIDEFVSPLPKDYVFKYS 278
            GLASHYV S    AL++RLG +      D      F   N  I+EF SPLP  Y FKY+
Sbjct: 199 AGLASHYVESTQHGALKERLGTVPITRKADET----FANTNAVIEEFSSPLPDGYQFKYN 254

Query: 279 NEKLNVIEACFNLSKNGTIEDIMNNLRQYEGSAE----GKAFAQEIKTKLLTKSPSSLQI 334
            E+L+VIE  F+   + + +++  NL  +  S       + FA+    KL TKS  S +I
Sbjct: 255 KEELDVIERFFHY--DVSYKELRKNLEAFASSNANSEVARNFAKATLEKLSTKSTVSAEI 312

Query: 335 ALRLVQENSRDHIESAIKRDLYTAANMCMNQDSLVEFSEATKHKLIDKQRVPYPWTKKEQ 394
                + NS+  I+SA+K+DL T+ N+  N + L EF  A  HKL++K + PY W K   
Sbjct: 313 TREQFRRNSQRDIQSAMKQDLITSTNLLRNNE-LAEFENAVIHKLVEKAKTPYEW-KNTS 370

Query: 395 LFVSQLTSITSPKPSLPMSLLRNTSNVTWTQYPYHSKYQLPTEQEIAAYIEKRTNDDTGA 454
             V+ ++ + +  P+ P+ LL  T  VT+  Y YH+K+ LPTE  + AYI          
Sbjct: 371 PSVADISKLLAADPANPIDLLE-TFGVTFKNYRYHNKFTLPTEAAVQAYITGTDQSGRSM 429

Query: 455 KVTEREVLNHFANVIPSRRGKLGIQSLCKIVCERKC 490
            VT  E + +F    P  RGK+G + +  ++ +RKC
Sbjct: 430 AVTRAETVKYFTEFNPVSRGKVGTEYVVNLIIDRKC 465

>Scas_526.2
          Length = 304

 Score = 33.9 bits (76), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 37/168 (22%), Positives = 76/168 (45%), Gaps = 8/168 (4%)

Query: 39  VLFTVQDTARVITLNRPKKLNALNAEMSESMFKTLNEYAKSDTTNLVILKSSNRPRSFCA 98
           V +T++    +I LN P+ LN+L  +    +   L +    D+  + +L+SS   + F +
Sbjct: 36  VSYTIEGPIFIIKLNDPRHLNSLTFDDFVYIAMLLEKANSDDSIFITVLQSS--AKFFSS 93

Query: 99  GGDVATVAIFNFNKEFAKSIKFFTDEYSL-NFQIA----TYLKPIVTFMDGITMGGGVGL 153
           GG    V      ++   S+       S  N  +A    T+ K +V  ++G  +G    +
Sbjct: 94  GGKFEAVLESKGKEDDIGSLNNLIGMISSPNVFVANAFRTHEKLLVCCLNGPAVGLSACI 153

Query: 154 SIHTPFRIATENTKWAM-PEMDIGFFPDVGSTFALPRIVTLANSNSQM 200
            +      A +++ + + P  ++GF  +VGS+  LP  + +  +N  +
Sbjct: 154 VMLCDLVYARDDSVYLLFPFSNLGFVAEVGSSVTLPMKLGINKANEHL 201

>YOR180C (DCI1) [4977] chr15 complement(674352..675167) Peroxisomal
           dienoyl-CoA isomerase [816 bp, 271 aa]
          Length = 271

 Score = 32.3 bits (72), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 41/177 (23%), Positives = 77/177 (43%), Gaps = 15/177 (8%)

Query: 49  VITLNRPKKLNALNAEMSESMFKTLNEYAKSDTTNLVILKSSNRPRSFCAGGDVATVAIF 108
           +I L  PK LN+L  E    +   L++    D+    +L+SS   + F +GG  + V   
Sbjct: 15  IIKLIDPKHLNSLTFEDFVYIALLLHKANDIDSVLFTVLQSSG--KYFSSGGKFSAVNKL 72

Query: 109 N---FNKEFAKSIKFFTDEYSLNFQI----ATYLKPIVTFMDGITMGGGVGLSIHTPFRI 161
           N      E  K  K  +   S N  +    A + K +V  ++G  +G    L        
Sbjct: 73  NDGDVTSEVEKVSKLVSAISSPNIFVANAFAIHKKVLVCCLNGPAIGLSASLVALCDIVY 132

Query: 162 ATENTKWAM-PEMDIGFFPDVGSTFALPRIVTLANSNSQM-----ALYLCLTGEVVT 212
           +  ++ + + P  ++GF  +VG++  L + + + ++N  M      L+  L G ++T
Sbjct: 133 SQNDSVFLLFPFSNLGFVAEVGTSVTLTQKLGINSANEHMIFSTPVLFKELIGTIIT 189

>Sklu_2044.3 YLR284C, Contig c2044 3827-4681
          Length = 284

 Score = 31.2 bits (69), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 32/169 (18%), Positives = 68/169 (40%), Gaps = 18/169 (10%)

Query: 36  APPVLFTVQDTARVITLNRPKKLNALNAEMSESMFKTLNEYAKSDTTNLVILKSSNRPRS 95
           +P + +T++    +I    P+ LN+++ +    +   L     +  T   +L+SS   R 
Sbjct: 7   SPKITYTIKGVLFIIQFKAPQTLNSMSGDDYLYLSHLLQISDSNPNTKFTVLQSSG--RF 64

Query: 96  FCAGGDVATVA--------------IFNFNKEFAKSIKFFTDE-YSLNFQIATYLKPIVT 140
           F +G DV+ +A              +   N E  K +  F      +    AT+ K +V 
Sbjct: 65  FSSGADVSGIAELHKSSKKGSKTEQVAESNGELPKWLSLFVSRNLFVTHVFATHKKILVC 124

Query: 141 FMDGITMGGGVGLSIHTPFRIATENTKWAM-PEMDIGFFPDVGSTFALP 188
            ++G  +G    + +      +  +  + + P  ++G   + G +  LP
Sbjct: 125 CLNGPAVGLSAAIVMLCDLVYSMHDKVYLLFPFANLGLVTEGGLSVTLP 173

>YNL167C (SKO1) [4429] chr14 complement(319416..321359)
           Transcriptional repressor that is converted to a
           transcriptional activator by Hog1p-dependent
           phosphorylation in response to osmotic stress, member of
           the ATF/CREB subfamily of bZIP DNA-binding proteins
           [1944 bp, 647 aa]
          Length = 647

 Score = 30.0 bits (66), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 26/53 (49%), Gaps = 7/53 (13%)

Query: 386 PYPWTKKEQLFVSQLTSITSP----KPSLPMSLLRNTSNVTWTQYPYHSKYQL 434
           P P+   EQ F S   +++ P     PSLP  L RN S  T TQ+   S + L
Sbjct: 20  PNPF---EQSFASSKKALSLPGTISHPSLPKELSRNNSTSTITQHSQRSTHSL 69

>KLLA0C04686g complement(428962..429795) similar to sgd|S0004274
           Saccharomyces cerevisiae YLR284c ECI1
           delta3-cis-delta2-trans-enoyl-CoA isomerase, start by
           similarity
          Length = 277

 Score = 29.3 bits (64), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 37/184 (20%), Positives = 73/184 (39%), Gaps = 7/184 (3%)

Query: 33  VTDAPPVLFTVQDTARVITLNRPKKLNALNAEMSESMFKTLNEYAKSDTTNLVILKSSNR 92
           +  +P + +  +    +I     KKLNAL+      +   L E  K   T   +L+SS  
Sbjct: 4   IAKSPRIEYRKEGIFFIIQFTDQKKLNALDGNDYLYLAHLLVENDKDPETAFTVLQSSG- 62

Query: 93  PRSFCAGGDVATVAIFNFNKEFAKSIKFFTDEYSLNFQIA----TYLKPIVTFMDGITMG 148
            R F AG D +++   N +       K+ +   S N  +      + KPI+  ++G  +G
Sbjct: 63  -RFFSAGADFSSIRKENTHNSDGTLPKWASAFLSRNTYVTNAFIVHSKPIICCLNGPAVG 121

Query: 149 GGVGLSIHTPFRIATENTKW-AMPEMDIGFFPDVGSTFALPRIVTLANSNSQMALYLCLT 207
               + +         +  +   P   IG   +  ++  LP  +  A + + +     LT
Sbjct: 122 LSAAIVMICDIVYCMNDKVYLQFPFAKIGLVTEGSTSITLPLKIGYARAQNTLFFNKPLT 181

Query: 208 GEVV 211
            +++
Sbjct: 182 YDIL 185

>CAGL0H05071g 486899..490231 similar to sp|Q12749 Saccharomyces
           cerevisiae YLR383w RHC18, hypothetical start
          Length = 1110

 Score = 29.6 bits (65), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 53/115 (46%), Gaps = 15/115 (13%)

Query: 271 KDYVFKYSNEKLNVIEACFNLSKNGTIEDIMNNLRQYE-GSAEGKAFAQEI--KTKLLTK 327
           KD + KY +    ++E+  N+ KN  I  I +N+R  E G    K  AQEI  + +L   
Sbjct: 836 KDKILKYQDHIKELLESVKNIEKN--IPKIADNIRVLEDGVGLQKQKAQEICPRAELSND 893

Query: 328 SPSSLQIALRLVQENSRDHIESAIKRDLYTAANMC-MNQDSLVEFSEATKHKLID 381
            P S        QE  +  I + I++ L  A  M  M+Q  +V+     K K ID
Sbjct: 894 LPHS--------QEEIKQEI-TNIQQKLQEAEKMMGMSQQQIVDNYNNAKTKFID 939

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.131    0.377 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 15,626,975
Number of extensions: 686602
Number of successful extensions: 2184
Number of sequences better than 10.0: 31
Number of HSP's gapped: 2227
Number of HSP's successfully gapped: 31
Length of query: 492
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 386
Effective length of database: 12,926,601
Effective search space: 4989667986
Effective search space used: 4989667986
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 64 (29.3 bits)