Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YDR035W (ARO3)37036419450.0
Scas_661.2437236617260.0
CAGL0H10142g37236617120.0
Sklu_2360.537236616990.0
Kwal_56.2307937236616500.0
KLLA0F18744g37236616150.0
ABL102C37336615410.0
AFL047W36435811501e-158
YBR249C (ARO4)37035111491e-157
Sklu_1187.136835111371e-156
Scas_597.1337235111301e-154
CAGL0C01573g35635111271e-154
KLLA0F06556g36435111151e-152
Kwal_14.155436435411081e-151
Scas_26.11831678011e-107
AFR270W381107967e-04
Scas_689.5129473691.7
Scas_660.3148046681.8
Scas_706.2446039654.1
Kwal_33.13646125353638.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YDR035W
         (364 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YDR035W (ARO3) [888] chr4 (521811..522923) 2-Dehydro-3-deoxyphos...   753   0.0  
Scas_661.24                                                           669   0.0  
CAGL0H10142g 989652..990770 highly similar to sp|P14843 Saccharo...   664   0.0  
Sklu_2360.5 YDR035W, Contig c2360 14257-15375                         659   0.0  
Kwal_56.23079                                                         640   0.0  
KLLA0F18744g complement(1723008..1724126) highly similar to sp|P...   626   0.0  
ABL102C [490] [Homologous to ScYDR035W (ARO3) - SH] (206411..207...   598   0.0  
AFL047W [3146] [Homologous to ScYBR249C (ARO4) - SH] complement(...   447   e-158
YBR249C (ARO4) [428] chr2 complement(716839..717951) 2-Dehydro-3...   447   e-157
Sklu_1187.1 YBR249C, Contig c1187 489-1595                            442   e-156
Scas_597.13                                                           439   e-154
CAGL0C01573g 170694..171764 highly similar to sp|P32449 Saccharo...   438   e-154
KLLA0F06556g 633167..634261 highly similar to sp|P32449 Saccharo...   434   e-152
Kwal_14.1554                                                          431   e-151
Scas_26.1                                                             313   e-107
AFR270W [3462] [Homologous to NOHBY] complement(919886..921031) ...    42   7e-04
Scas_689.5                                                             31   1.7  
Scas_660.31                                                            31   1.8  
Scas_706.24                                                            30   4.1  
Kwal_33.13646                                                          29   8.4  

>YDR035W (ARO3) [888] chr4 (521811..522923)
           2-Dehydro-3-deoxyphosphoheptonate aldolase (DAHPS),
           inhibited by phenylalanine [1113 bp, 370 aa]
          Length = 370

 Score =  753 bits (1945), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/364 (100%), Positives = 364/364 (100%)

Query: 1   MFIKNDHAGDRKRLEDWRIKGYDPLTPPDLLQHEFPISAKGEENIIKARDSVCDILNGKD 60
           MFIKNDHAGDRKRLEDWRIKGYDPLTPPDLLQHEFPISAKGEENIIKARDSVCDILNGKD
Sbjct: 1   MFIKNDHAGDRKRLEDWRIKGYDPLTPPDLLQHEFPISAKGEENIIKARDSVCDILNGKD 60

Query: 61  DRLVIVIGPCSLHDPKAAYDYADRLAKISEKLSKDLLIIMRAYLEKPRTTVGWKGLINDP 120
           DRLVIVIGPCSLHDPKAAYDYADRLAKISEKLSKDLLIIMRAYLEKPRTTVGWKGLINDP
Sbjct: 61  DRLVIVIGPCSLHDPKAAYDYADRLAKISEKLSKDLLIIMRAYLEKPRTTVGWKGLINDP 120

Query: 121 DMNNSFQINKGLRISREMFIKLVEKLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH 180
           DMNNSFQINKGLRISREMFIKLVEKLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH
Sbjct: 121 DMNNSFQINKGLRISREMFIKLVEKLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH 180

Query: 181 RELASGLSFPIGFKNGTDGGLQVAIDAMRAAAHEHYFLSVTKPGVTAIVGTEGNKDTFLI 240
           RELASGLSFPIGFKNGTDGGLQVAIDAMRAAAHEHYFLSVTKPGVTAIVGTEGNKDTFLI
Sbjct: 181 RELASGLSFPIGFKNGTDGGLQVAIDAMRAAAHEHYFLSVTKPGVTAIVGTEGNKDTFLI 240

Query: 241 LRGGKNGTNFDKESVQNTKKQLEKAGLTDDSQKRIMIDCSHGNSNKDFKNQPKVAKCIYD 300
           LRGGKNGTNFDKESVQNTKKQLEKAGLTDDSQKRIMIDCSHGNSNKDFKNQPKVAKCIYD
Sbjct: 241 LRGGKNGTNFDKESVQNTKKQLEKAGLTDDSQKRIMIDCSHGNSNKDFKNQPKVAKCIYD 300

Query: 301 QLTEGENSLCGVMIESNINEGRQDIPKEGGREGLKYGCSVTDACIGWESTEQVLELLAEG 360
           QLTEGENSLCGVMIESNINEGRQDIPKEGGREGLKYGCSVTDACIGWESTEQVLELLAEG
Sbjct: 301 QLTEGENSLCGVMIESNINEGRQDIPKEGGREGLKYGCSVTDACIGWESTEQVLELLAEG 360

Query: 361 VRNR 364
           VRNR
Sbjct: 361 VRNR 364

>Scas_661.24
          Length = 372

 Score =  669 bits (1726), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/366 (86%), Positives = 344/366 (93%), Gaps = 2/366 (0%)

Query: 1   MFIKNDHAGDRKRLEDWRIKGYDPLTPPDLLQHEFPISAKGEENIIKARDSVCDILNGKD 60
           MFIKNDHAGDR RLEDWRIKGYDPLTPPDLLQHE+PIS +G + I+ AR++VCDILNGKD
Sbjct: 1   MFIKNDHAGDRTRLEDWRIKGYDPLTPPDLLQHEYPISERGHKIIVDAREAVCDILNGKD 60

Query: 61  DRLVIVIGPCSLHDPKAAYDYADRLAKISEKLSKDLLIIMRAYLEKPRTTVGWKGLINDP 120
           DRLVIVIGPCS+HDPKAAY+YADRLAKI+  LSKDLLIIMRAYLEKPRTTVGWKGLINDP
Sbjct: 61  DRLVIVIGPCSIHDPKAAYEYADRLAKIAATLSKDLLIIMRAYLEKPRTTVGWKGLINDP 120

Query: 121 DMNNSFQINKGLRISREMFIKLVEKLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH 180
           D++NSFQINKGLRISREMF KLVEKLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH
Sbjct: 121 DIDNSFQINKGLRISREMFTKLVEKLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH 180

Query: 181 RELASGLSFPIGFKNGTDGGLQVAIDAMRAAAHEHYFLSVTKPGVTAIVGTEGNKDTFLI 240
           RELASGLSFPIGFKNGTDGGLQV+IDAMRAAAHEHYFLSVTKPGVTAIVGTEGNKDTF+I
Sbjct: 181 RELASGLSFPIGFKNGTDGGLQVSIDAMRAAAHEHYFLSVTKPGVTAIVGTEGNKDTFVI 240

Query: 241 LRGGKNGTNFDKESVQNTKKQLEKAGLTD--DSQKRIMIDCSHGNSNKDFKNQPKVAKCI 298
           LRGGK+GTNFD ESVQ TKK+L+K  L D  D+Q+RIMIDCSHGNSNKD++NQPKVA+ I
Sbjct: 241 LRGGKHGTNFDAESVQITKKELKKTNLIDANDTQRRIMIDCSHGNSNKDYRNQPKVAQSI 300

Query: 299 YDQLTEGENSLCGVMIESNINEGRQDIPKEGGREGLKYGCSVTDACIGWESTEQVLELLA 358
           YDQLT GEN++CGVMIESN+ EGRQD+P EGGR GLKYGCS+TDACIGWESTE VL+ LA
Sbjct: 301 YDQLTAGENAICGVMIESNLVEGRQDVPPEGGRAGLKYGCSITDACIGWESTEDVLKQLA 360

Query: 359 EGVRNR 364
           EGVRNR
Sbjct: 361 EGVRNR 366

>CAGL0H10142g 989652..990770 highly similar to sp|P14843
           Saccharomyces cerevisiae YDR035w ARO3
           2-dehydro-3-deoxyphosphoheptonate aldolase, start by
           similarity
          Length = 372

 Score =  664 bits (1712), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/366 (85%), Positives = 344/366 (93%), Gaps = 2/366 (0%)

Query: 1   MFIKNDHAGDRKRLEDWRIKGYDPLTPPDLLQHEFPISAKGEENIIKARDSVCDILNGKD 60
           MFIKND+ GDR RLEDWRIKGYDPLTPPDLLQHE+PIS KG  NI+KARDSVCDILNGKD
Sbjct: 1   MFIKNDYRGDRTRLEDWRIKGYDPLTPPDLLQHEYPISEKGAANILKARDSVCDILNGKD 60

Query: 61  DRLVIVIGPCSLHDPKAAYDYADRLAKISEKLSKDLLIIMRAYLEKPRTTVGWKGLINDP 120
           DR+VIVIGPCS+HDPKAAY+YAD+LA I+EKLS DLLIIMRAYLEKPRTTVGWKGLINDP
Sbjct: 61  DRMVIVIGPCSIHDPKAAYEYADKLAVIAEKLSDDLLIIMRAYLEKPRTTVGWKGLINDP 120

Query: 121 DMNNSFQINKGLRISREMFIKLVEKLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH 180
           D++NSFQINKGLRISREMF KL+EKLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH
Sbjct: 121 DIDNSFQINKGLRISREMFTKLIEKLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH 180

Query: 181 RELASGLSFPIGFKNGTDGGLQVAIDAMRAAAHEHYFLSVTKPGVTAIVGTEGNKDTFLI 240
           RELASGLSFPIGFKNGTDGGLQVAIDAMRAA+HEHYFLSVTKPGVTAIVGTEGN DTF+I
Sbjct: 181 RELASGLSFPIGFKNGTDGGLQVAIDAMRAASHEHYFLSVTKPGVTAIVGTEGNSDTFII 240

Query: 241 LRGGKNGTNFDKESVQNTKKQLEKAGLTD--DSQKRIMIDCSHGNSNKDFKNQPKVAKCI 298
           LRGGK+GTN+D E+V++TK+QL KA L D  DS +RIMIDCSHGNSNKD++NQPKVA+ I
Sbjct: 241 LRGGKHGTNYDAENVKSTKEQLRKAKLIDEADSTRRIMIDCSHGNSNKDYRNQPKVAQEI 300

Query: 299 YDQLTEGENSLCGVMIESNINEGRQDIPKEGGREGLKYGCSVTDACIGWESTEQVLELLA 358
           Y+QL+ GEN LCGVMIESN+ EGRQD+P EGGREGLKYGCS+TDACIGW++TE VLELLA
Sbjct: 301 YNQLSAGENGLCGVMIESNLVEGRQDVPPEGGREGLKYGCSITDACIGWDTTESVLELLA 360

Query: 359 EGVRNR 364
           EGVRNR
Sbjct: 361 EGVRNR 366

>Sklu_2360.5 YDR035W, Contig c2360 14257-15375
          Length = 372

 Score =  659 bits (1699), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/366 (84%), Positives = 341/366 (93%), Gaps = 2/366 (0%)

Query: 1   MFIKNDHAGDRKRLEDWRIKGYDPLTPPDLLQHEFPISAKGEENIIKARDSVCDILNGKD 60
           MFIKNDH GDR RLEDWRIKGYDPLTPPDLLQHE+PIS KG + I+ AR+ VC+ILNGKD
Sbjct: 1   MFIKNDHVGDRTRLEDWRIKGYDPLTPPDLLQHEYPISEKGHKTIVDAREQVCEILNGKD 60

Query: 61  DRLVIVIGPCSLHDPKAAYDYADRLAKISEKLSKDLLIIMRAYLEKPRTTVGWKGLINDP 120
           DRLVIVIGPCS+HDPKAAY+YAD+LA +SEKLSKDLLIIMRAYLEKPRTTVGWKGLINDP
Sbjct: 61  DRLVIVIGPCSIHDPKAAYEYADKLAALSEKLSKDLLIIMRAYLEKPRTTVGWKGLINDP 120

Query: 121 DMNNSFQINKGLRISREMFIKLVEKLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH 180
           D++NSFQINKGLRISREMF  LVEKLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH
Sbjct: 121 DIDNSFQINKGLRISREMFTNLVEKLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH 180

Query: 181 RELASGLSFPIGFKNGTDGGLQVAIDAMRAAAHEHYFLSVTKPGVTAIVGTEGNKDTFLI 240
           RELASGLSFPIGFKNGTDGGLQV+IDAMRAAAH HYFLSVTKPG+TAIVGTEGN DTF+I
Sbjct: 181 RELASGLSFPIGFKNGTDGGLQVSIDAMRAAAHSHYFLSVTKPGITAIVGTEGNSDTFVI 240

Query: 241 LRGGKNGTNFDKESVQNTKKQLEKAGLTDD--SQKRIMIDCSHGNSNKDFKNQPKVAKCI 298
           LRGGK GTN+D  +V+ T+K+L KA L D+  +Q+RIMIDCSHGNS+KDF+NQPKVA+ I
Sbjct: 241 LRGGKKGTNYDSANVKETQKELIKAKLADENGTQRRIMIDCSHGNSSKDFRNQPKVAQSI 300

Query: 299 YDQLTEGENSLCGVMIESNINEGRQDIPKEGGREGLKYGCSVTDACIGWESTEQVLELLA 358
           YDQLT GEN++CGVMIESN+ EGRQD+P EGGREGLKYGCS+TDACIGWESTEQVLELLA
Sbjct: 301 YDQLTAGENAICGVMIESNLVEGRQDVPPEGGREGLKYGCSITDACIGWESTEQVLELLA 360

Query: 359 EGVRNR 364
           +GV+NR
Sbjct: 361 KGVQNR 366

>Kwal_56.23079
          Length = 372

 Score =  640 bits (1650), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/366 (81%), Positives = 338/366 (92%), Gaps = 2/366 (0%)

Query: 1   MFIKNDHAGDRKRLEDWRIKGYDPLTPPDLLQHEFPISAKGEENIIKARDSVCDILNGKD 60
           MFIKNDH GDR RLEDWRIKGYDPLTPPDLLQHE PISAKG + I+ AR+ VCDILNGKD
Sbjct: 1   MFIKNDHVGDRTRLEDWRIKGYDPLTPPDLLQHELPISAKGHKTIVDAREQVCDILNGKD 60

Query: 61  DRLVIVIGPCSLHDPKAAYDYADRLAKISEKLSKDLLIIMRAYLEKPRTTVGWKGLINDP 120
           DRLVIVIGPCS+HDPKAAY+Y DRLA  S+K +KDLLIIMRAYLEKPRTTVGWKGLINDP
Sbjct: 61  DRLVIVIGPCSIHDPKAAYEYCDRLAAESKKHAKDLLIIMRAYLEKPRTTVGWKGLINDP 120

Query: 121 DMNNSFQINKGLRISREMFIKLVEKLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH 180
           D++NSFQINKGLRISRE+F  LVEK+PIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH
Sbjct: 121 DIDNSFQINKGLRISRELFTNLVEKMPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH 180

Query: 181 RELASGLSFPIGFKNGTDGGLQVAIDAMRAAAHEHYFLSVTKPGVTAIVGTEGNKDTFLI 240
           RELASGLSFPIGFKNGTDGGLQV++DAMRAAAH HYFLSVTKPGVTAIVGTEGN DTF+I
Sbjct: 181 RELASGLSFPIGFKNGTDGGLQVSVDAMRAAAHSHYFLSVTKPGVTAIVGTEGNSDTFVI 240

Query: 241 LRGGKNGTNFDKESVQNTKKQLEKAGLTDDSQK--RIMIDCSHGNSNKDFKNQPKVAKCI 298
           LRGGK GTN+D E+V+ T+++L KA + +++ K  RIMIDCSHGNS+KD++NQPKVA+ I
Sbjct: 241 LRGGKTGTNYDAENVKKTQEELVKAKIAEENGKTRRIMIDCSHGNSSKDYRNQPKVAQSI 300

Query: 299 YDQLTEGENSLCGVMIESNINEGRQDIPKEGGREGLKYGCSVTDACIGWESTEQVLELLA 358
           Y+QLT+G+N++CGVMIESN+ EGRQD+P EGGREGLKYGCS+TDACIGWE+TE+VL LLA
Sbjct: 301 YEQLTDGQNAICGVMIESNLVEGRQDVPAEGGREGLKYGCSITDACIGWETTEEVLALLA 360

Query: 359 EGVRNR 364
           +GV+NR
Sbjct: 361 KGVQNR 366

>KLLA0F18744g complement(1723008..1724126) highly similar to
           sp|P14843 Saccharomyces cerevisiae YDR035w ARO3
           2-dehydro-3-deoxyphosphoheptonate aldolase,
           phenylalanine-inhibited, start by similarity
          Length = 372

 Score =  626 bits (1615), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/366 (79%), Positives = 331/366 (90%), Gaps = 2/366 (0%)

Query: 1   MFIKNDHAGDRKRLEDWRIKGYDPLTPPDLLQHEFPISAKGEENIIKARDSVCDILNGKD 60
           MFI NDH GDR  LEDWRIKGYDPLTPPDLLQHE+PI  K ++ I++AR+ VCDILNGKD
Sbjct: 1   MFITNDHIGDRSSLEDWRIKGYDPLTPPDLLQHEYPIGEKAKKIIVEAREKVCDILNGKD 60

Query: 61  DRLVIVIGPCSLHDPKAAYDYADRLAKISEKLSKDLLIIMRAYLEKPRTTVGWKGLINDP 120
           DRLV+VIGPCS+HDPKAAY+YAD L KIS++LS DLLIIMRAYLEKPRTTVGWKGLINDP
Sbjct: 61  DRLVVVIGPCSIHDPKAAYEYADLLKKISDELSDDLLIIMRAYLEKPRTTVGWKGLINDP 120

Query: 121 DMNNSFQINKGLRISREMFIKLVEKLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH 180
           D++NSFQINKGLRISREMF +L EKLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH
Sbjct: 121 DIDNSFQINKGLRISREMFTRLTEKLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH 180

Query: 181 RELASGLSFPIGFKNGTDGGLQVAIDAMRAAAHEHYFLSVTKPGVTAIVGTEGNKDTFLI 240
           RELASGLSFPIGFKNGTDGGLQVA+DAMR+AAH HYFLSVTKPGVTAIVGTEGN+DTF+I
Sbjct: 181 RELASGLSFPIGFKNGTDGGLQVAVDAMRSAAHSHYFLSVTKPGVTAIVGTEGNEDTFVI 240

Query: 241 LRGGKNGTNFDKESVQNTKKQLEKAGLTDDS--QKRIMIDCSHGNSNKDFKNQPKVAKCI 298
           LRGGK GTNFD E+V+ T+ +L KA + D    Q+RIM+DCSHGNS KDF+NQPKVA+ +
Sbjct: 241 LRGGKTGTNFDAENVKKTQAELVKAKVADAEGVQRRIMVDCSHGNSKKDFRNQPKVAQSL 300

Query: 299 YDQLTEGENSLCGVMIESNINEGRQDIPKEGGREGLKYGCSVTDACIGWESTEQVLELLA 358
           Y+QL+ G+N++CGVMIESN+ EGRQD+P EGGRE L YGCS+TDACIGWE+TE VL LLA
Sbjct: 301 YEQLSAGQNAICGVMIESNLVEGRQDVPPEGGREKLIYGCSITDACIGWETTEDVLRLLA 360

Query: 359 EGVRNR 364
           +GV+NR
Sbjct: 361 KGVKNR 366

>ABL102C [490] [Homologous to ScYDR035W (ARO3) - SH]
           (206411..207532) [1122 bp, 373 aa]
          Length = 373

 Score =  598 bits (1541), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/366 (75%), Positives = 327/366 (89%), Gaps = 2/366 (0%)

Query: 1   MFIKNDHAGDRKRLEDWRIKGYDPLTPPDLLQHEFPISAKGEENIIKARDSVCDILNGKD 60
           MFIKN++ GD+ RLEDWRIKGYDPLTPP++LQHE P+SA G   I++AR+ V  +L+G+D
Sbjct: 1   MFIKNEYIGDKSRLEDWRIKGYDPLTPPNVLQHELPVSANGRAIIVRAREGVVQVLSGRD 60

Query: 61  DRLVIVIGPCSLHDPKAAYDYADRLAKISEKLSKDLLIIMRAYLEKPRTTVGWKGLINDP 120
           DRL++V+GPCS+HDP+AA +YA RL++++ +L  +LL+IMRAYLEKPRTTVGWKGLINDP
Sbjct: 61  DRLLVVVGPCSIHDPEAALEYAQRLSEVASRLRGELLVIMRAYLEKPRTTVGWKGLINDP 120

Query: 121 DMNNSFQINKGLRISREMFIKLVEKLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH 180
           D++NSFQINKGLRISREM+ +LVE +PIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH
Sbjct: 121 DIDNSFQINKGLRISREMYTQLVEHIPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH 180

Query: 181 RELASGLSFPIGFKNGTDGGLQVAIDAMRAAAHEHYFLSVTKPGVTAIVGTEGNKDTFLI 240
           RELASGLSFPIGFKNGTDG LQVAIDAMRAAAH HYFLSVTKPGVTAIVGTEGN+DTF+I
Sbjct: 181 RELASGLSFPIGFKNGTDGCLQVAIDAMRAAAHSHYFLSVTKPGVTAIVGTEGNEDTFII 240

Query: 241 LRGGKNGTNFDKESVQNTKKQLEKAGLTDDS--QKRIMIDCSHGNSNKDFKNQPKVAKCI 298
           LRGGK+GTN+D  SVQ  K+ L  A L D +  Q+RIMIDCSHGNSNKD++NQPKVA+ I
Sbjct: 241 LRGGKDGTNYDAASVQQAKQDLVNAKLVDSAGVQRRIMIDCSHGNSNKDYRNQPKVAQDI 300

Query: 299 YDQLTEGENSLCGVMIESNINEGRQDIPKEGGREGLKYGCSVTDACIGWESTEQVLELLA 358
           Y+QL++GEN++CGVMIESN+ EGRQDIP+  GR GLKYGCS+TDACIGW+ T +VLELLA
Sbjct: 301 YEQLSKGENAICGVMIESNLVEGRQDIPEGNGRVGLKYGCSITDACIGWDQTVEVLELLA 360

Query: 359 EGVRNR 364
           +GV N+
Sbjct: 361 KGVINK 366

>AFL047W [3146] [Homologous to ScYBR249C (ARO4) - SH]
           complement(351599..352693) [1095 bp, 364 aa]
          Length = 364

 Score =  447 bits (1150), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 215/358 (60%), Positives = 266/358 (74%), Gaps = 9/358 (2%)

Query: 8   AGDRKRLEDWRIKGYDPLTPPDLLQHEFPISAKGEENIIKARDSVCDILNGKDDRLVIVI 67
           A D  + ED RI GYDPL  P LLQ + P +    E   K R    DI+ GKDDR+++V+
Sbjct: 8   AADADQAEDVRILGYDPLVSPALLQSQIPATQACLETAQKGRREAIDIITGKDDRVLVVV 67

Query: 68  GPCSLHDPKAAYDYADRLAKISEKLSKDLLIIMRAYLEKPRTTVGWKGLINDPDMNNSFQ 127
           GPCS+HD  AA +YA RL K++E+L  DL+++MRAYLEKPRTTVGWKGLINDPD+NN+F 
Sbjct: 68  GPCSIHDLDAAQEYAQRLKKLAEELEGDLVVVMRAYLEKPRTTVGWKGLINDPDVNNTFN 127

Query: 128 INKGLRISREMFIKLVE-KLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLHRELASG 186
           INKGL+ +R++F+ L    +PI  EMLDTISPQ+L+D  S GAIGARTTESQLHRELASG
Sbjct: 128 INKGLQAARQLFVNLTSIGVPIGSEMLDTISPQYLTDLLSFGAIGARTTESQLHRELASG 187

Query: 187 LSFPIGFKNGTDGGLQVAIDAMRAAAHEHYFLSVTKPGVTAIVGTEGNKDTFLILRGGKN 246
           LSFPIGFKNGTDG L VA+DA++A++H H+F+ VTK GV AI  T+GN+  F+ILRGGK 
Sbjct: 188 LSFPIGFKNGTDGSLDVALDAVKASSHSHHFMGVTKHGVAAITTTKGNEHCFVILRGGKR 247

Query: 247 GTNFDKESVQNTKKQLEKAGLTDDSQKRIMIDCSHGNSNKDFKNQPKVAKCIYDQLTEGE 306
           GTN+D  SV   K +L   G+       +MID SHGNSNKDF+NQPKV + + +Q+  GE
Sbjct: 248 GTNYDATSVAEAKAKLPPTGV-------LMIDYSHGNSNKDFRNQPKVNEVVSEQIANGE 300

Query: 307 NSLCGVMIESNINEGRQDIPKEGGREGLKYGCSVTDACIGWESTEQVLELLAEGVRNR 364
           + + GVMIESNINEG Q IP E G+ GLKYG S+TD CI WE+TE+VL  LA  VR R
Sbjct: 301 DKIVGVMIESNINEGSQKIPPE-GKAGLKYGVSITDGCISWETTEEVLRKLAGAVRKR 357

>YBR249C (ARO4) [428] chr2 complement(716839..717951)
           2-Dehydro-3-deoxyphosphoheptonate aldolase
           (3-deoxy-D-arabino-heptulosonate-7-phosphate synthase or
           DAHP synthase), inhibited by tyrosine [1113 bp, 370 aa]
          Length = 370

 Score =  447 bits (1149), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 218/351 (62%), Positives = 262/351 (74%), Gaps = 8/351 (2%)

Query: 15  EDWRIKGYDPLTPPDLLQHEFPISAKGEENIIKARDSVCDILNGKDDRLVIVIGPCSLHD 74
           ED RI GYDPL  P LLQ + P +    E   + R    DI+ GKDDR+++++GPCS+HD
Sbjct: 21  EDVRILGYDPLASPALLQVQIPATPTSLETAKRGRREAIDIITGKDDRVLVIVGPCSIHD 80

Query: 75  PKAAYDYADRLAKISEKLSKDLLIIMRAYLEKPRTTVGWKGLINDPDMNNSFQINKGLRI 134
            +AA +YA RL K+S++L  DL IIMRAYLEKPRTTVGWKGLINDPD+NN+F INKGL+ 
Sbjct: 81  LEAAQEYALRLKKLSDELKGDLSIIMRAYLEKPRTTVGWKGLINDPDVNNTFNINKGLQS 140

Query: 135 SREMFIKLVE-KLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLHRELASGLSFPIGF 193
           +R++F+ L    LPI  EMLDTISPQ+L+D  S GAIGARTTESQLHRELASGLSFP+GF
Sbjct: 141 ARQLFVNLTNIGLPIGSEMLDTISPQYLADLVSFGAIGARTTESQLHRELASGLSFPVGF 200

Query: 194 KNGTDGGLQVAIDAMRAAAHEHYFLSVTKPGVTAIVGTEGNKDTFLILRGGKNGTNFDKE 253
           KNGTDG L VA+DA +AAAH H+F+ VTK GV AI  T+GN+  F+ILRGGK GTN+D +
Sbjct: 201 KNGTDGTLNVAVDACQAAAHSHHFMGVTKHGVAAITTTKGNEHCFVILRGGKKGTNYDAK 260

Query: 254 SVQNTKKQLEKAGLTDDSQKRIMIDCSHGNSNKDFKNQPKVAKCIYDQLTEGENSLCGVM 313
           SV   K QL            +MID SHGNSNKDF+NQPKV   + +Q+  GEN++ GVM
Sbjct: 261 SVAEAKAQLPAG------SNGLMIDYSHGNSNKDFRNQPKVNDVVCEQIANGENAITGVM 314

Query: 314 IESNINEGRQDIPKEGGREGLKYGCSVTDACIGWESTEQVLELLAEGVRNR 364
           IESNINEG Q IP E G+ GLKYG S+TDACIGWE+TE VL  LA  VR R
Sbjct: 315 IESNINEGNQGIPAE-GKAGLKYGVSITDACIGWETTEDVLRKLAAAVRQR 364

>Sklu_1187.1 YBR249C, Contig c1187 489-1595
          Length = 368

 Score =  442 bits (1137), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 213/351 (60%), Positives = 262/351 (74%), Gaps = 9/351 (2%)

Query: 15  EDWRIKGYDPLTPPDLLQHEFPISAKGEENIIKARDSVCDILNGKDDRLVIVIGPCSLHD 74
           ED RI GYDPL  P LLQ + P +    +   + R    DI+ GKDDR+++++GPCS+HD
Sbjct: 19  EDVRILGYDPLVSPALLQSQVPATQVSLQTAQRGRKESIDIITGKDDRVLVIVGPCSIHD 78

Query: 75  PKAAYDYADRLAKISEKLSKDLLIIMRAYLEKPRTTVGWKGLINDPDMNNSFQINKGLRI 134
            + A +Y  RL K+S++L  DL IIMRAYLEKPRTTVGWKGLINDPD+NN+F INKGL+ 
Sbjct: 79  LELAQEYGTRLKKLSDELQGDLCIIMRAYLEKPRTTVGWKGLINDPDVNNTFNINKGLQY 138

Query: 135 SREMFIKLVE-KLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLHRELASGLSFPIGF 193
           +R++F+ L    +PI  EMLDTISPQ+L+D  S GAIGARTTESQLHRELASGLSFPIGF
Sbjct: 139 ARQLFVNLTSLGVPIGSEMLDTISPQYLTDLLSFGAIGARTTESQLHRELASGLSFPIGF 198

Query: 194 KNGTDGGLQVAIDAMRAAAHEHYFLSVTKPGVTAIVGTEGNKDTFLILRGGKNGTNFDKE 253
           KNGTDG L VA+DA++AA+H H+F+ VTK GV AI  T+GN+  F+ILRGGK GTN+D +
Sbjct: 199 KNGTDGTLGVALDAVKAASHSHHFMGVTKHGVAAITTTKGNEHCFIILRGGKKGTNYDAQ 258

Query: 254 SVQNTKKQLEKAGLTDDSQKRIMIDCSHGNSNKDFKNQPKVAKCIYDQLTEGENSLCGVM 313
           SV   K QL   G        +M+D SHGNSNKDF+NQPKV   + +Q+  GE+ + GVM
Sbjct: 259 SVAEAKAQLPPTG-------ALMVDYSHGNSNKDFRNQPKVNDAVCEQIANGEDKIIGVM 311

Query: 314 IESNINEGRQDIPKEGGREGLKYGCSVTDACIGWESTEQVLELLAEGVRNR 364
           IES+INEG+Q IP E G+ GLKYG S+TD CIGWESTEQVL  LA  VR R
Sbjct: 312 IESHINEGQQSIPPE-GKAGLKYGVSITDGCIGWESTEQVLRKLAAAVRQR 361

>Scas_597.13
          Length = 372

 Score =  439 bits (1130), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 214/351 (60%), Positives = 266/351 (75%), Gaps = 8/351 (2%)

Query: 15  EDWRIKGYDPLTPPDLLQHEFPISAKGEENIIKARDSVCDILNGKDDRLVIVIGPCSLHD 74
           ED RI GYDPL  P LLQ + P + K  E   K R    +I++G+DDR+++++GPCS+HD
Sbjct: 21  EDVRILGYDPLVSPALLQVQIPATEKCIETAKKGRRESIEIISGRDDRVLVIVGPCSIHD 80

Query: 75  PKAAYDYADRLAKISEKLSKDLLIIMRAYLEKPRTTVGWKGLINDPDMNNSFQINKGLRI 134
             AA +YA +L K++++LS+DL++IMRAYLEKPRTTVGWKGLINDPD+NN+F INKGL+ 
Sbjct: 81  LDAAQEYALKLKKLADELSQDLVVIMRAYLEKPRTTVGWKGLINDPDVNNTFNINKGLQS 140

Query: 135 SREMFIKLVE-KLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLHRELASGLSFPIGF 193
           +R++F+ L    LPI  EMLDTISPQ+L+D  S GAIGARTTESQLHRELASGLSFPIGF
Sbjct: 141 ARQLFVNLTNIGLPIGSEMLDTISPQYLADLLSFGAIGARTTESQLHRELASGLSFPIGF 200

Query: 194 KNGTDGGLQVAIDAMRAAAHEHYFLSVTKPGVTAIVGTEGNKDTFLILRGGKNGTNFDKE 253
           KNGTDG L VA+DA +AA+H H+F+ VTK GV AI  T+GN+  F+ILRGGK GTN+D +
Sbjct: 201 KNGTDGTLGVAVDACQAASHSHHFMGVTKHGVAAITTTKGNEHCFVILRGGKKGTNYDAK 260

Query: 254 SVQNTKKQLEKAGLTDDSQKRIMIDCSHGNSNKDFKNQPKVAKCIYDQLTEGENSLCGVM 313
           SV   K QL            +MID SHGNSNKDF+NQPKV   + +Q+  GEN++ GVM
Sbjct: 261 SVAEAKAQLPAG------SNGLMIDYSHGNSNKDFRNQPKVNDAVCEQIANGENAIIGVM 314

Query: 314 IESNINEGRQDIPKEGGREGLKYGCSVTDACIGWESTEQVLELLAEGVRNR 364
           IESNINEG Q IP E G+ GLKYG S+TDACI +E+TE VL+ LA  VR R
Sbjct: 315 IESNINEGSQKIPPE-GKAGLKYGVSITDACISFETTEDVLKKLAAAVRQR 364

>CAGL0C01573g 170694..171764 highly similar to sp|P32449
           Saccharomyces cerevisiae YBR249c ARO4, start by
           similarity
          Length = 356

 Score =  438 bits (1127), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 213/351 (60%), Positives = 262/351 (74%), Gaps = 8/351 (2%)

Query: 15  EDWRIKGYDPLTPPDLLQHEFPISAKGEENIIKARDSVCDILNGKDDRLVIVIGPCSLHD 74
           ED RI GYDPL  P LLQ + P +    +   + R    +I+ G+DDR+++++GPCS+HD
Sbjct: 8   EDVRILGYDPLVSPALLQVQVPATEVSIQTARRGRKESIEIITGRDDRVLVIVGPCSVHD 67

Query: 75  PKAAYDYADRLAKISEKLSKDLLIIMRAYLEKPRTTVGWKGLINDPDMNNSFQINKGLRI 134
             AA +YA RL K+S++L KDL I+MRAYLEKPRTTVGWKGLINDPD+NN+F INKGL+ 
Sbjct: 68  LDAAQEYAQRLKKLSDELQKDLCIVMRAYLEKPRTTVGWKGLINDPDVNNTFNINKGLQS 127

Query: 135 SREMFIKLVEK-LPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLHRELASGLSFPIGF 193
           +R++F+ L    +PI  EMLDTISPQ+L+D  S GAIGARTTESQLHRELASGLSFPIGF
Sbjct: 128 ARQLFVNLTNTGVPIGSEMLDTISPQYLADLLSFGAIGARTTESQLHRELASGLSFPIGF 187

Query: 194 KNGTDGGLQVAIDAMRAAAHEHYFLSVTKPGVTAIVGTEGNKDTFLILRGGKNGTNFDKE 253
           KNGTDG L VA+DA +AA+H H+F+ VTK GV AI  T+GN+  F+ILRGGK GTN+D +
Sbjct: 188 KNGTDGTLGVAVDACQAASHSHHFMGVTKHGVAAITTTKGNEHCFVILRGGKKGTNYDAK 247

Query: 254 SVQNTKKQLEKAGLTDDSQKRIMIDCSHGNSNKDFKNQPKVAKCIYDQLTEGENSLCGVM 313
           SV   KKQL +          +MID SHGNSNKDF+NQPKV   + +Q+  GE ++ GVM
Sbjct: 248 SVAEAKKQLPEGA------NGLMIDYSHGNSNKDFRNQPKVNDAVCEQIANGEKAIVGVM 301

Query: 314 IESNINEGRQDIPKEGGREGLKYGCSVTDACIGWESTEQVLELLAEGVRNR 364
           IESNINEG Q IP E G+ GLKYG S+TDACI WE+TE VL  LA  VR R
Sbjct: 302 IESNINEGNQCIPPE-GKAGLKYGVSITDACISWETTEDVLRKLAAAVRQR 351

>KLLA0F06556g 633167..634261 highly similar to sp|P32449
           Saccharomyces cerevisiae YBR249c ARO4
           2-dehydro-3-deoxyphosphoheptonate aldolase,
           tyrosine-inhibited, start by similarity
          Length = 364

 Score =  434 bits (1115), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 213/351 (60%), Positives = 260/351 (74%), Gaps = 9/351 (2%)

Query: 15  EDWRIKGYDPLTPPDLLQHEFPISAKGEENIIKARDSVCDILNGKDDRLVIVIGPCSLHD 74
           ED RI GYDPL  P LLQ + P S +  E   K R    DI+ GKDDR+++V+GPCS+HD
Sbjct: 13  EDVRILGYDPLVSPALLQAQVPASQECLETAQKGRKESIDIITGKDDRVLVVVGPCSIHD 72

Query: 75  PKAAYDYADRLAKISEKLSKDLLIIMRAYLEKPRTTVGWKGLINDPDMNNSFQINKGLRI 134
            K A DYA  L  +S++L  DL IIMRAYLEKPRTTVGWKGLINDPD++N++ INKGL++
Sbjct: 73  LKEAQDYAKGLKALSDELKGDLCIIMRAYLEKPRTTVGWKGLINDPDVDNTYNINKGLQV 132

Query: 135 SREMFIKLVE-KLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLHRELASGLSFPIGF 193
           SR++F+ L    LPI  EMLDTISPQ+L+D  S GAIGARTTESQLHRELASGLSFP+GF
Sbjct: 133 SRQLFVNLTSLGLPIGSEMLDTISPQYLADLLSFGAIGARTTESQLHRELASGLSFPVGF 192

Query: 194 KNGTDGGLQVAIDAMRAAAHEHYFLSVTKPGVTAIVGTEGNKDTFLILRGGKNGTNFDKE 253
           KNGTDG L VA+DA++AA+H H+F+ VTK GV AI  T+GN+  F+ILRGGK GTN+D  
Sbjct: 193 KNGTDGTLGVALDAVQAASHSHHFMGVTKHGVAAITTTKGNEHCFVILRGGKQGTNYDSV 252

Query: 254 SVQNTKKQLEKAGLTDDSQKRIMIDCSHGNSNKDFKNQPKVAKCIYDQLTEGENSLCGVM 313
           SV   KK L   G+       +MID SHGNSNKDF+NQPKV   + +Q+  GE+ + GVM
Sbjct: 253 SVAEAKKALPPTGV-------LMIDYSHGNSNKDFRNQPKVNDAVCEQIANGEDKIIGVM 305

Query: 314 IESNINEGRQDIPKEGGREGLKYGCSVTDACIGWESTEQVLELLAEGVRNR 364
           IES+INEG+Q IP E G+ GLKYG S+TD CI  E+T +VL  LA  VR R
Sbjct: 306 IESHINEGKQSIPAE-GKAGLKYGVSITDGCISLETTAEVLRKLAAAVRAR 355

>Kwal_14.1554
          Length = 364

 Score =  431 bits (1108), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 207/354 (58%), Positives = 261/354 (73%), Gaps = 9/354 (2%)

Query: 12  KRLEDWRIKGYDPLTPPDLLQHEFPISAKGEENIIKARDSVCDILNGKDDRLVIVIGPCS 71
           ++ ED RI G DPL  P LLQ + P + +    + K R     I+ G+DDRL++++GPCS
Sbjct: 11  EQAEDVRILGLDPLVSPALLQSQIPATPECLRTVQKGRVGASKIIMGEDDRLLVIVGPCS 70

Query: 72  LHDPKAAYDYADRLAKISEKLSKDLLIIMRAYLEKPRTTVGWKGLINDPDMNNSFQINKG 131
           +HD   A +YA RL K++++L  +L IIMRAYLEKPRTTVGWKGLINDPD+NNSF INKG
Sbjct: 71  IHDLDLAQEYARRLKKVADELEGELCIIMRAYLEKPRTTVGWKGLINDPDVNNSFNINKG 130

Query: 132 LRISREMFIKLVEK-LPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLHRELASGLSFP 190
           L+ +R++F+ L    LPI  EMLDTISPQ+L+D  S GAIGARTTESQLHRELASGLSFP
Sbjct: 131 LQCARQLFVNLTSAGLPIGSEMLDTISPQYLADLLSFGAIGARTTESQLHRELASGLSFP 190

Query: 191 IGFKNGTDGGLQVAIDAMRAAAHEHYFLSVTKPGVTAIVGTEGNKDTFLILRGGKNGTNF 250
           +GFKNGTDG + VAIDAM AA+H H+F+ VTK G  AI  T+GN+  F+ILRGG  GTN+
Sbjct: 191 VGFKNGTDGTMGVAIDAMLAASHSHHFMGVTKHGFAAITTTKGNEHCFVILRGGTKGTNY 250

Query: 251 DKESVQNTKKQLEKAGLTDDSQKRIMIDCSHGNSNKDFKNQPKVAKCIYDQLTEGENSLC 310
           D +SV   K QL   G        +M+DCSHGNSNKD++NQPKV   + +Q+  GE+ + 
Sbjct: 251 DAKSVAEAKAQLPPGG-------TLMVDCSHGNSNKDYRNQPKVNDAVCEQVANGEDKII 303

Query: 311 GVMIESNINEGRQDIPKEGGREGLKYGCSVTDACIGWESTEQVLELLAEGVRNR 364
           GVMIES+INEG+Q IP E G+ GLKYG S+TD CIGWE+TE+VL  L+  V+ R
Sbjct: 304 GVMIESHINEGKQSIPPE-GKAGLKYGVSITDGCIGWETTEEVLRKLSNAVKQR 356

>Scas_26.1
          Length = 183

 Score =  313 bits (801), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 145/167 (86%), Positives = 157/167 (94%)

Query: 1   MFIKNDHAGDRKRLEDWRIKGYDPLTPPDLLQHEFPISAKGEENIIKARDSVCDILNGKD 60
           MFIKNDH GDR RLEDWRIKGYDPLTPPDLLQHE+PIS KG + I+ AR+ VC+ILNGKD
Sbjct: 3   MFIKNDHVGDRTRLEDWRIKGYDPLTPPDLLQHEYPISEKGHKTIVDAREQVCEILNGKD 62

Query: 61  DRLVIVIGPCSLHDPKAAYDYADRLAKISEKLSKDLLIIMRAYLEKPRTTVGWKGLINDP 120
           DRLVIVIGPCS+HDPKAAY+YAD+LA +SEKLSKDLLIIMRAYLEKPRTTVGWKGLINDP
Sbjct: 63  DRLVIVIGPCSIHDPKAAYEYADKLAALSEKLSKDLLIIMRAYLEKPRTTVGWKGLINDP 122

Query: 121 DMNNSFQINKGLRISREMFIKLVEKLPIAGEMLDTISPQFLSDCFSL 167
           D++NSFQINKGLRISREMF  LVEKLPIAGEMLDTISPQFLSDCFS+
Sbjct: 123 DIDNSFQINKGLRISREMFTNLVEKLPIAGEMLDTISPQFLSDCFSV 169

>AFR270W [3462] [Homologous to NOHBY] complement(919886..921031)
           [1146 bp, 381 aa]
          Length = 381

 Score = 41.6 bits (96), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 51/107 (47%), Gaps = 2/107 (1%)

Query: 135 SREMFIKLVEKLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLHRELASGLSFPIGFK 194
           +R++   + E   +  ++LD     F+SD  SL  + AR+ +  L  ++ASGL   +  +
Sbjct: 126 TRDVLRAICEHTGVCLDILDNTLMNFVSDIPSLVVLDARSPDISL--KVASGLPSNVAVR 183

Query: 195 NGTDGGLQVAIDAMRAAAHEHYFLSVTKPGVTAIVGTEGNKDTFLIL 241
                 +  AI  +   A    + +V+  G+   + T GN DTFL L
Sbjct: 184 CRNANEIFSAIKILEHIAQPTLYPTVSHDGLPICIHTTGNPDTFLAL 230

>Scas_689.5
          Length = 1294

 Score = 31.2 bits (69), Expect = 1.7,   Method: Composition-based stats.
 Identities = 18/73 (24%), Positives = 34/73 (46%), Gaps = 1/73 (1%)

Query: 75   PKAAYDYADRLAKISEKLSKDLLIIMRAYLEKPRTTVGWKGLINDPDMNNSFQINKGLRI 134
            P+   ++  + + IS+K+      ++R Y ++     GWK L+ D D N    I  G   
Sbjct: 959  PELLKEFGSQWSLISQKIGSKSTTMVRNYYQRNSAHFGWKLLVEDAD-NRRNAIRSGSVH 1017

Query: 135  SREMFIKLVEKLP 147
              +M ++  + LP
Sbjct: 1018 QSQMLLQPEQMLP 1030

>Scas_660.31
          Length = 480

 Score = 30.8 bits (68), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 30/46 (65%), Gaps = 2/46 (4%)

Query: 223 PGVTAIVGTEGNKDTF--LILRGGKNGTNFDKESVQNTKKQLEKAG 266
           PG+  ++GTE +   F  L+LR  K   NF  ++++N+++ ++++G
Sbjct: 383 PGIIIVIGTEKSCKFFENLVLRRIKWSENFKDQNIENSERVVDQSG 428

>Scas_706.24
          Length = 460

 Score = 29.6 bits (65), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 25/39 (64%), Gaps = 2/39 (5%)

Query: 55  ILNGKDDRLVIVIGPCSLHDPKAAY--DYADRLAKISEK 91
           IL+G++D L    GP S+ DP   +  DYA++L+ ++ +
Sbjct: 350 ILSGENDTLESYCGPVSITDPLLLWKSDYANKLSSLNTR 388

>Kwal_33.13646
          Length = 1253

 Score = 28.9 bits (63), Expect = 8.4,   Method: Composition-based stats.
 Identities = 13/53 (24%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 75  PKAAYDYADRLAKISEKLSKDLLIIMRAYLEKPRTTVGWKGLIND--PDMNNS 125
           P+   ++  + A ISE+L      ++R Y ++    +GW+ L+++  P + N+
Sbjct: 902 PELLKEFGTQWALISERLGTKSTTMVRNYFQRNAEQMGWQSLVDNSSPSVENN 954

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.137    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 12,662,852
Number of extensions: 567861
Number of successful extensions: 1487
Number of sequences better than 10.0: 28
Number of HSP's gapped: 1487
Number of HSP's successfully gapped: 28
Length of query: 364
Length of database: 16,596,109
Length adjustment: 103
Effective length of query: 261
Effective length of database: 13,030,455
Effective search space: 3400948755
Effective search space used: 3400948755
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 62 (28.5 bits)