Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YDL109C64763632320.0
YGL144C (ROG1)68566714260.0
Scas_669.1469066313890.0
Kwal_23.346466859713571e-180
CAGL0E04950g67365713421e-178
ADL285C64458413321e-177
Scas_613.1462864513191e-175
KLLA0E14872g67758912771e-168
CAGL0H10340g5926408281e-102
AER322C6366366997e-83
YDR444W6876536913e-81
Kwal_47.184826236306611e-77
KLLA0B01375g6406576491e-75
CAGL0M10043g6586486291e-72
Scas_717.506584014826e-52
AFR386C5042001782e-13
KLLA0F16709g5312041684e-12
Kwal_27.101022581981553e-11
Kwal_55.217034412011513e-10
Sklu_2393.45462061506e-10
CAGL0L10318g4572081443e-09
KLLA0F16423g4592071391e-08
YOR059C4502081353e-08
ADR202C4432151344e-08
Scas_698.394712261283e-07
Sklu_2232.44452141221e-06
YNL004W (HRB1)42961760.39
KLLA0E09350g62945760.49
Kwal_47.1825936645692.6
KLLA0F09713g28851682.8
CAGL0M04147g97437675.9
YNL321W90837666.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YDL109C
         (636 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YDL109C (YDL109C) [760] chr4 complement(265258..267201) Protein ...  1249   0.0  
YGL144C (ROG1) [1843] chr7 complement(232453..234510) Protein of...   553   0.0  
Scas_669.14                                                           539   0.0  
Kwal_23.3464                                                          527   e-180
CAGL0E04950g 478626..480647 similar to sp|P53118 Saccharomyces c...   521   e-178
ADL285C [1456] [Homologous to ScYGL144C - SH; ScYDL109C - SH] (2...   517   e-177
Scas_613.14                                                           512   e-175
KLLA0E14872g 1326334..1328367 similar to sp|P53118 Saccharomyces...   496   e-168
CAGL0H10340g 1007564..1009342 similar to sp|P53118 Saccharomyces...   323   e-102
AER322C [2823] [Homologous to ScYDR444W - SH] (1229579..1231489)...   273   7e-83
YDR444W (YDR444W) [1264] chr4 (1350278..1352341) Protein of unkn...   270   3e-81
Kwal_47.18482                                                         259   1e-77
KLLA0B01375g 110709..112631 similar to sgd|S0002852 Saccharomyce...   254   1e-75
CAGL0M10043g complement(999113..1001089) similar to tr|Q04093 Sa...   246   1e-72
Scas_717.50                                                           190   6e-52
AFR386C [3578] [Homologous to NOHBY] (1131324..1132838) [1515 bp...    73   2e-13
KLLA0F16709g 1539612..1541207 weakly similar to ca|CA1159|IPF134...    69   4e-12
Kwal_27.10102                                                          64   3e-11
Kwal_55.21703                                                          63   3e-10
Sklu_2393.4 , Contig c2393 3530-5170 reverse complement                62   6e-10
CAGL0L10318g complement(1103690..1105063) similar to tr|Q08448 S...    60   3e-09
KLLA0F16423g complement(1516717..1518096) similar to sgd|S000558...    58   1e-08
YOR059C (YOR059C) [4867] chr15 complement(438907..440259) Protei...    57   3e-08
ADR202C [1943] [Homologous to ScYOR059C - SH] (1060157..1061488)...    56   4e-08
Scas_698.39                                                            54   3e-07
Sklu_2232.4 YOR059C, Contig c2232 3289-4626                            52   1e-06
YNL004W (HRB1) [4581] chr14 (623331..624620) Protein with simila...    34   0.39 
KLLA0E09350g complement(832187..834076) similar to sgd|S0005548 ...    34   0.49 
Kwal_47.18259                                                          31   2.6  
KLLA0F09713g 894192..895058 similar to sp|P38324 Saccharomyces c...    31   2.8  
CAGL0M04147g complement(455977..458901) similar to sp|P42839 Sac...    30   5.9  
YNL321W (YNL321W) [4293] chr14 (34695..37421) Member of the calc...    30   6.4  

>YDL109C (YDL109C) [760] chr4 complement(265258..267201) Protein of
           unknown function, has high similarity to uncharacterized
           S. cerevisiae Rog1p [1944 bp, 647 aa]
          Length = 647

 Score = 1249 bits (3232), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 604/636 (94%), Positives = 604/636 (94%)

Query: 1   MEAGRSADEVLYHNQSSVKLGELERYVITYELYQGDSIPADITLDSLWVKIKNTTKLSYK 60
           MEAGRSADEVLYHNQSSVKLGELERYVITYELYQGDSIPADITLDSLWVKIKNTTKLSYK
Sbjct: 1   MEAGRSADEVLYHNQSSVKLGELERYVITYELYQGDSIPADITLDSLWVKIKNTTKLSYK 60

Query: 61  PAYLLGPFILYCDVRAKDYESSYKIICSADKPVFQSNLQAQQKFIAELSLHHIKPRYVWI 120
           PAYLLGPFILYCDVRAKDYESSYKIICSADKPVFQSNLQAQQKFIAELSLHHIKPRYVWI
Sbjct: 61  PAYLLGPFILYCDVRAKDYESSYKIICSADKPVFQSNLQAQQKFIAELSLHHIKPRYVWI 120

Query: 121 VDIVSQILFNKETKVTFEIVVGNSKASLKRKIRCNDSLPDKACNILHTGLSVHRLTTADI 180
           VDIVSQILFNKETKVTFEIVVGNSKASLKRKIRCNDSLPDKACNILHTGLSVHRLTTADI
Sbjct: 121 VDIVSQILFNKETKVTFEIVVGNSKASLKRKIRCNDSLPDKACNILHTGLSVHRLTTADI 180

Query: 181 WKVPRPIDMSQKSHLVILTHGFQSNVSADMEYLMEEIYKAQMNNPNERLVIKGYMKNACE 240
           WKVPRPIDMSQKSHLVILTHGFQSNVSADMEYLMEEIYKAQMNNPNERLVIKGYMKNACE
Sbjct: 181 WKVPRPIDMSQKSHLVILTHGFQSNVSADMEYLMEEIYKAQMNNPNERLVIKGYMKNACE 240

Query: 241 TEKGIKFLGVGLANYIIDELYDDSVGKISFIGHSLGGLTQTFAICYIKTKYPYFFKKVEP 300
           TEKGIKFLGVGLANYIIDELYDDSVGKISFIGHSLGGLTQTFAICYIKTKYPYFFKKVEP
Sbjct: 241 TEKGIKFLGVGLANYIIDELYDDSVGKISFIGHSLGGLTQTFAICYIKTKYPYFFKKVEP 300

Query: 301 INFISLASPLLGIATSTPNYVKMSLSMGIIGTTGQELGLKDGNYGDKPXXXXXXXXXXXX 360
           INFISLASPLLGIATSTPNYVKMSLSMGIIGTTGQELGLKDGNYGDKP            
Sbjct: 301 INFISLASPLLGIATSTPNYVKMSLSMGIIGTTGQELGLKDGNYGDKPLLYLLSEESLIS 360

Query: 361 XXARFKRRTLYANAVNDGIVPXXXXXXXXXXXXXXXXXXGGQTTAPCDPLFQPEVSPIGE 420
             ARFKRRTLYANAVNDGIVP                  GGQTTAPCDPLFQPEVSPIGE
Sbjct: 361 VLARFKRRTLYANAVNDGIVPLYSSSLLFLDYSQLLQKLGGQTTAPCDPLFQPEVSPIGE 420

Query: 421 LPNHSDVANDDDGINASSWNTFWKSKENNCDKKSKRLMNASVIKSMKSVLLSPCPDAKFF 480
           LPNHSDVANDDDGINASSWNTFWKSKENNCDKKSKRLMNASVIKSMKSVLLSPCPDAKFF
Sbjct: 421 LPNHSDVANDDDGINASSWNTFWKSKENNCDKKSKRLMNASVIKSMKSVLLSPCPDAKFF 480

Query: 481 SDPDARVATIIHDKIYTEKNLPPPSPTLYEGTAAKEGETRKTRKEMEEIIARRWHKGMHW 540
           SDPDARVATIIHDKIYTEKNLPPPSPTLYEGTAAKEGETRKTRKEMEEIIARRWHKGMHW
Sbjct: 481 SDPDARVATIIHDKIYTEKNLPPPSPTLYEGTAAKEGETRKTRKEMEEIIARRWHKGMHW 540

Query: 541 RKVVVLLKPDAHNNIIVRRRFSNAYGWPVVDHLVTAHFQRDDPIASPMQDKQFAEEDINM 600
           RKVVVLLKPDAHNNIIVRRRFSNAYGWPVVDHLVTAHFQRDDPIASPMQDKQFAEEDINM
Sbjct: 541 RKVVVLLKPDAHNNIIVRRRFSNAYGWPVVDHLVTAHFQRDDPIASPMQDKQFAEEDINM 600

Query: 601 ATGGVEPNKFYSWLTKIEDPSVYHGGIVSTASQLAS 636
           ATGGVEPNKFYSWLTKIEDPSVYHGGIVSTASQLAS
Sbjct: 601 ATGGVEPNKFYSWLTKIEDPSVYHGGIVSTASQLAS 636

>YGL144C (ROG1) [1843] chr7 complement(232453..234510) Protein of
           unknown function, has high similarity to uncharacterized
           S. cerevisiae Ydl109p [2058 bp, 685 aa]
          Length = 685

 Score =  553 bits (1426), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/667 (44%), Positives = 400/667 (59%), Gaps = 62/667 (9%)

Query: 7   ADEVLYHNQSSVKLGELERYVITYELYQGDSIPADITLDSLWVKIKNTTKLSYKPAYLLG 66
            +E+L+H +SSVK+GELERYVITY LY G+ IP D+ L+SLW+K++N   LSY+ AYL+G
Sbjct: 6   TNEILFHYKSSVKVGELERYVITYHLYDGEEIPPDLNLNSLWLKVRNMNPLSYRAAYLMG 65

Query: 67  PFILYCDVRAKDYESSYKIICSADKPVFQSNLQAQQKFIAELSLHHIKPRYVWIVDIVSQ 126
           PF+LYCDV+   Y  S KI+ S D P F+ N+Q QQ F+AELS+H+I+ +YVWI D++SQ
Sbjct: 66  PFMLYCDVKTAQYHHSQKIVASVDYPKFEPNVQTQQDFVAELSVHNIRQKYVWIADVMSQ 125

Query: 127 ILFNKETKVTFEIVVGNSKASLKRKIRCNDSLPDKACNILHTG-----LSVHRLTTADIW 181
           ILF   T VT+E+ +G SK S++        LP       H G     L+V+RLTT D+W
Sbjct: 126 ILFTTNTNVTYEVTIGTSKESVENP----HDLPS------HLGSYSPKLTVNRLTTLDLW 175

Query: 182 KVPRPIDMSQKS-HLVILTHGFQSNVSADMEYLMEEIYKAQMNNPNERLVIKGYMKNACE 240
            +P  I   QK  HLV+LTHG  SNVS D+ Y+ME+IYKAQ N P+E++V+KGY  N C+
Sbjct: 176 NLPVQITTPQKKKHLVVLTHGLHSNVSTDLVYIMEQIYKAQKNYPHEQIVVKGYRGNVCQ 235

Query: 241 TEKGIKFLGVGLANYIIDELYDDSVGKISFIGHSLGGLTQTFAICYIKTKYPYFFKKVEP 300
           TEKG+K+LG  LA YII +LYD+S+ KISF+GHSLGGL Q FAI YI   YP+FFKKV P
Sbjct: 236 TEKGVKYLGTRLAEYIIQDLYDESIRKISFVGHSLGGLIQAFAIAYIYEVYPWFFKKVNP 295

Query: 301 INFISLASPLLGIATSTPNYVKMSLSMGIIGTTGQELGLKDGNYGDKPXXXXXXXXXXXX 360
           INFI+LASPLLGI T  P Y+K+ LS G+IG TGQ+LGL++     KP            
Sbjct: 296 INFITLASPLLGIVTDNPAYIKVLLSFGVIGKTGQDLGLENDVEVGKPLLYLLSGLPLIE 355

Query: 361 XXARFKRRTLYANAVNDGIVPXXXXXXXXXXXXXXXXXXGG-QTTAPCDPLFQPEVSPIG 419
              RFKRRT+YANA+NDGIVP                     +  +   PL     +P+ 
Sbjct: 356 ILRRFKRRTVYANAINDGIVPLYTASLLFLDYNDILEQLQKLKENSKKSPLINDASTPVN 415

Query: 420 E-LPNHSDVANDDDGINASSWNTFWKSKENNCDKKSKRLMNASVIKSMKSVLLSPCPDAK 478
           +   N + ++     ++  +   F    EN  +     +   S  +S  S+LL P P+  
Sbjct: 416 QDFFNKTFISPLTKMLSILAPQKF--PTENGSE-----IPKVSFFESASSILLPPLPERA 468

Query: 479 FFSDPDARVATIIHDKIYTEKNLPPPSPTLYEGTAAKEG----------ETRKTRKEMEE 528
           +  DPD+R   IIHDKIY E ++P     + +G   K+           + R   + +EE
Sbjct: 469 YIMDPDSRDPVIIHDKIYNEDDIPQSEFDIEDGFFGKKNILLQAFFAGKKERAKYRNLEE 528

Query: 529 IIARRWHKGMHWRKVVVLLKPDAHNNIIVRRRFSNAYGWPVVDHLVTAHF---------- 578
            IARRWH+GM WRKVVV LKPDAHNNIIVRR+F+NAYGWPV+DHL+  HF          
Sbjct: 529 TIARRWHEGMAWRKVVVALKPDAHNNIIVRRKFANAYGWPVIDHLIDVHFNGDDDDDNDE 588

Query: 579 -------QRDDPIASPMQDKQFAEEDINMATGGVEPNKFYSWLTKIEDPSVYH---GGIV 628
                  Q  +PI S  + K+   +  N+        + Y WL K+E   V+     G++
Sbjct: 589 NDDINSTQVVEPIQSVTEGKKKYRKAENIP-------QEYGWLNKVETNGVFDEGPTGMI 641

Query: 629 STASQLA 635
           ST  ++ 
Sbjct: 642 STVGEIV 648

>Scas_669.14
          Length = 690

 Score =  539 bits (1389), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/663 (44%), Positives = 399/663 (60%), Gaps = 69/663 (10%)

Query: 8   DEVLYHNQSSVKLGELERYVITYELYQGDSIPADITLDSLWVKIKNTTKLSYKPAYLLGP 67
           +++LY N+S++   + +RY+ITY LY  + IP+DI LD L+++IKN   +SY+ AYL+GP
Sbjct: 2   NDLLYQNKSTLGAAQQDRYIITYNLYDTEEIPSDIKLDPLYLRIKNIEPISYRAAYLMGP 61

Query: 68  FILYCDVRAKDYESSYKIICSADKPVFQSNLQAQQKFIAELSLHHIKPRYVWIVDIVSQI 127
           FILYCDVR + Y  S +I  + D+P F+SNL   Q  I  LSLH I+ RYVWIVD+VSQI
Sbjct: 62  FILYCDVRLETYHHSQRIYSTCDQPQFESNLLPSQDAIWSLSLHQIQKRYVWIVDVVSQI 121

Query: 128 LFNKETKVTFEIVVGNSKASLKRKIRCNDSLPDKACNILHTGLSVHRLTTADIWKVPRPI 187
           LF   T +T+EI +G +K SL   I       D+        L V +L T D+WK+P  +
Sbjct: 122 LFTTNTDITYEISMGYTKESLHHSINNERLGSDR--------LVVTKLNTLDLWKLPVQL 173

Query: 188 DMS----QKSHLVILTHGFQSNVSADMEYLMEEIYKAQMNNPNERLVIKGYMKNACETEK 243
             S    ++ HLVILTHG  SN++ DMEY+ME+IYK+Q N PNE++V+ GY  N C+TE+
Sbjct: 174 APSDRRRRRKHLVILTHGLHSNLTVDMEYIMEQIYKSQDNYPNEQIVVDGYPGNICQTER 233

Query: 244 GIKFLGVGLANYIIDELYDDSVGKISFIGHSLGGLTQTFAICYIKTKYPYFFKKVEPINF 303
           G+K+LG  LA YI++ELYD S+ KISFIGHSLGGL QTFAI YI  KYP+FF+KV+PINF
Sbjct: 234 GVKYLGERLAKYIVNELYDASIVKISFIGHSLGGLVQTFAIAYINVKYPWFFQKVQPINF 293

Query: 304 ISLASPLLGIATSTPNYVKMSLSMGIIGTTGQELGLKDGNYGDKPXXXXXXXXXXXXXXA 363
           I++ASPLLGI T  P YVK+ LS G+IG TGQ+LGL   +  D+P               
Sbjct: 294 IAMASPLLGIVTDNPAYVKLLLSFGVIGKTGQDLGLDRVSETDRPLLYLLPGEPTRSVLL 353

Query: 364 RFKRRTLYANAVNDGIVPXXXXXXXXXXXXXXXXXXGGQTTAPCDPLFQPEVSPIGELPN 423
           +FKRRTLYANA+NDGIVP                      TA    LF      + +L  
Sbjct: 354 KFKRRTLYANAINDGIVPLY--------------------TASL--LFLDYDDILEQLHK 391

Query: 424 HSD--VANDDDGI----NASSWN-----------TFWKSKENNCDKKSKRLMNASVIKSM 466
           + D  +A D+  +    N +S+N           + W  ++      SK L   S+++S 
Sbjct: 392 NEDEELAKDEQNVTIPENTASFNKNFISPLTKMLSIWAPQKFPQGPDSK-LPKVSMLQSA 450

Query: 467 KSVLLSPCPDAKFFSDPDARVATIIHDKIYTEKNLPPPSPTLYEG------------TAA 514
            S+LL P PD ++  +P AR   IIHDK YT+++LP     L +             T  
Sbjct: 451 TSILLPPLPDQEYLLNPKARHPVIIHDKTYTQEDLPKGDTELEDTFFNSENMLLQAFTDI 510

Query: 515 KEGETRKTRKEMEEIIARRWHKGMHWRKVVVLLKPDAHNNIIVRRRFSNAYGWPVVDHLV 574
           K G  RK  +++EE IARRWH+GM WRKVVV LKPDAHNNIIVRRRF+NAYGW V+DHL+
Sbjct: 511 KAG--RKRYQKLEESIARRWHEGMSWRKVVVALKPDAHNNIIVRRRFANAYGWNVIDHLI 568

Query: 575 TAHFQRDDPIASPMQDKQFAEEDINMATGGVEPNKFYSWLTKIEDPSVYH---GGIVSTA 631
             HF  DD +              N  +  +EP   Y+W+TK E  S++     G++ST 
Sbjct: 569 GVHFNGDDRLEEEQTKAGLEAPLPNDQSSVIEPIDEYAWVTKAESESLFDEGPTGMISTM 628

Query: 632 SQL 634
            ++
Sbjct: 629 GEM 631

>Kwal_23.3464
          Length = 668

 Score =  527 bits (1357), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 283/597 (47%), Positives = 364/597 (60%), Gaps = 33/597 (5%)

Query: 6   SADEVLYHNQSSVKLGELERYVITYELYQGDS-IPADITLDSLWVKIKNTTKLSYKPAYL 64
           + D V+YH +SSVK+GE+ERY+I+Y+LY  D  +PAD+ L+SLW+K++N    +++ AYL
Sbjct: 2   TKDGVVYHAKSSVKVGEMERYIISYQLYDDDEGLPADLNLNSLWLKVRNIESFTFRAAYL 61

Query: 65  LGPFILYCDVRAKDYESSYKIICSADKPVFQSNLQAQQKFIAELSLHHIKPRYVWIVDIV 124
           +GP++LYCDVRA DY  S ++  SAD+P F+  LQ QQ FI ELSLH++K  YVW+VD+V
Sbjct: 62  MGPYLLYCDVRASDYHHSQRLFVSADQPTFEPTLQPQQDFITELSLHNLKKTYVWVVDVV 121

Query: 125 SQILFNKETKVTFEIVVGNSKASLKRKIRCNDSLPDKACNILHTGLSVHRLTTADIWKVP 184
           SQI+F   T+V FE+ VG S     RK     S        L + L+V RLT+ D+W +P
Sbjct: 122 SQIIFTTTTQVGFEVSVGTS-----RKCLAKSSEFSPVSGSLESKLNVTRLTSLDLWNLP 176

Query: 185 RPIDMS--QKSHLVILTHGFQSNVSADMEYLMEEIYKAQMNNPNERLVIKGYMKNACETE 242
             +     QK HLVILTHG  SNV ADM YL E+I K Q   P E++V+KG+  N C+TE
Sbjct: 177 VQLSTHTHQKEHLVILTHGLHSNVHADMFYLKEQIEKCQKYYPEEQIVVKGFNGNVCKTE 236

Query: 243 KGIKFLGVGLANYIIDELYDDSVGKISFIGHSLGGLTQTFAICYIKTKYPYFFKKVEPIN 302
           KGI +LG  LA YI+ ELY + V KISFIGHSLGGL QTFAI YI  KYP+FF+ V PIN
Sbjct: 237 KGINYLGTRLAEYIVKELYHERVKKISFIGHSLGGLVQTFAIAYIHVKYPWFFQNVSPIN 296

Query: 303 FISLASPLLGIATSTPNYVKMSLSMGIIGTTGQELGLKDGNYGDKPXXXXXXXXXXXXXX 362
           FI+LA+PLLGI T  P YV + LS GI+G TGQ+LGL + +   KP              
Sbjct: 297 FITLATPLLGIVTDNPAYVNILLSFGIVGKTGQDLGLTELSKDGKPLLYLLPGKPTKTVL 356

Query: 363 ARFKRRTLYANAVNDGIVPXXXXXXXXXXXXXXXXXXGGQTTAPCDPLFQPEVSPIGELP 422
             FKRRT+YANAVNDGIVP                   GQ         +PE+       
Sbjct: 357 RMFKRRTIYANAVNDGIVPLYSASLLFLDYEDVL----GQLKT------KPELRERLSSN 406

Query: 423 NHSDVANDDDGINASSWNTFWKSKENNCDKKSKRLMNASVIKSMKSVLLSPCPDAKFFSD 482
             SD  + +     S   +FW + +   D  S ++   SVI+S  SVL+ P P+  +  +
Sbjct: 407 TSSDFISRNFLSPISKAISFW-APQKFPDDGSLKIPKVSVIESATSVLIPPLPEKTYIMN 465

Query: 483 PDARVATIIHDKIYTEKNLPP-----------PSPTLYEGTAAKEGETRKTRKEMEEIIA 531
           P +R   IIHDKIY ++ +PP            + TL +      G   K  + +EE IA
Sbjct: 466 PSSRENIIIHDKIYCDQEVPPRESQSEKELLESNNTLLKAFTRSSG---KDNRRLEEEIA 522

Query: 532 RRWHKGMHWRKVVVLLKPDAHNNIIVRRRFSNAYGWPVVDHLVTAHFQRDDPIASPM 588
           RRWH+G+ WRKVVV LKPDAHNNIIVRRRFSNAYGWPVVDHL   HF   D  +  M
Sbjct: 523 RRWHEGISWRKVVVGLKPDAHNNIIVRRRFSNAYGWPVVDHLTQNHFNSMDDESEEM 579

>CAGL0E04950g 478626..480647 similar to sp|P53118 Saccharomyces
           cerevisiae YGL144c or tr|Q12103 Saccharomyces cerevisiae
           YDL109c, hypothetical start
          Length = 673

 Score =  521 bits (1342), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 283/657 (43%), Positives = 399/657 (60%), Gaps = 51/657 (7%)

Query: 1   MEAGRSADEVLYHNQSSVKLGELERYVITYELYQGDSIPADITLDSLWVKIKNTTKLSYK 60
           M+   +  ++LYH +SSVK+GE+ERY+I Y LY+ D IP D+ LDSL+V++KN + LS++
Sbjct: 1   MDEIDANKDILYHYRSSVKVGEIERYLIEYILYEDDEIPDDLKLDSLYVRLKNCSPLSFR 60

Query: 61  PAYLLGPFILYCDVRAKDYESSYKIICSADKPVFQSNLQAQQKFIAELSLHHIKPRYVWI 120
             YL GPFILY DVR+ +Y  S  I+ SAD P F++NLQAQQ  + ELSLH+I+ +YVWI
Sbjct: 61  AGYLAGPFILYGDVRSNNYHHSQHIVSSADYPQFEANLQAQQVKVMELSLHNIQSKYVWI 120

Query: 121 VDIVSQILFNKETKVTFEIVVGNSKASLKR--KIRCNDSLPDKACNILHTGLSVHRLTTA 178
           +D+VSQILF   T V FE+ VG  +  L+   +I C   L   + N++     V RLTT 
Sbjct: 121 LDVVSQILFTTNTNVPFEVTVGMDRKMLEENNEIECLPHLGSTSNNLI-----VSRLTTD 175

Query: 179 DIWKVPRPIDMSQK-SHLVILTHGFQSNVSADMEYLMEEIYKAQMNNPNERLVIKGYMKN 237
           D+WK+PR +   +   HLVILTHG  SNVSAD+ YLMEEIYK+Q N PNE L++ GY  N
Sbjct: 176 DLWKLPRELAPKKDIKHLVILTHGLHSNVSADLSYLMEEIYKSQANFPNEILIVDGYFDN 235

Query: 238 ACETEKGIKFLGVGLANYIIDELYDDSVGKISFIGHSLGGLTQTFAICYIKTKYPYFFKK 297
            CETEKG+++LG  LA+YIID LYD  V KISF+GHSLGGL QTFAI  +  +YP+FF K
Sbjct: 236 VCETEKGVRYLGTRLADYIIDNLYDADVKKISFVGHSLGGLVQTFAIGNLAARYPWFFDK 295

Query: 298 VEPINFISLASPLLGIATSTPNYVKMSLSMGIIGTTGQELGLKDGNYGDKPXXXXXXXXX 357
           V+P+NFI++ASP+LGI T  P Y+ + LS G++G TG++L L      +KP         
Sbjct: 296 VKPVNFITIASPMLGIVTDNPAYINLLLSFGVVGRTGKDLNLDVDLPDEKPLLYSLSGEF 355

Query: 358 XXXXXARFKRRTLYANAVNDGIVPXXXXXXXXXXXXXXXXXXGGQTTAPCDPLFQPEVSP 417
                 +F+RRT+YANAVNDGIVP                       A    L + E + 
Sbjct: 356 IRSILRKFERRTIYANAVNDGIVPLYTSGLLYL-----------DYDAILKKLREKEENK 404

Query: 418 IGELPNHSDVANDDDGINA------SSWNTFWKSKENNCDKKSKRLMNASVIKSMKSVLL 471
               PN+  V+++    N       +   + W  ++    +   ++   S  +S  S+LL
Sbjct: 405 SLSGPNNITVSDNTAFFNKNFISPLTKMLSLWAPQK--FPESDPKIPKVSFFQSAASILL 462

Query: 472 SPCPDAKFFSDPDARVATIIHDKIYTEKNL----PPPSPTLYEG-----TAAKEGETRKT 522
            P PD  F  +P  R   IIHDKIYTE+++      P  + +        A     + KT
Sbjct: 463 PPLPDINFIVNPKHRNDIIIHDKIYTEEDIKDVEKDPDSSFFNNKNIFLQALSTVTSEKT 522

Query: 523 R-KEMEEIIARRWHKGMHWRKVVVLLKPDAHNNIIVRRRFSNAYGWPVVDHLVTAHFQRD 581
           + +E+E+ IA RWHKG+ WRKV+V LKPDAHNNIIVRRRFSNAYGWPV+DHL++ HF  +
Sbjct: 523 KYQELEKTIAIRWHKGLSWRKVIVALKPDAHNNIIVRRRFSNAYGWPVIDHLISEHFSGE 582

Query: 582 DPIASPMQDKQFAEEDINMATGGVEPNKFYSWLTKIEDPSVYH---GGIVSTASQLA 635
           +        +  +++D+++ T   + N    W+ + ++  ++     G++ST  ++ 
Sbjct: 583 NF-------EMDSQKDVSITTTREDLN----WIKRPDEDGLFKEGPTGMISTVGEIV 628

>ADL285C [1456] [Homologous to ScYGL144C - SH; ScYDL109C - SH]
           (201714..203648) [1935 bp, 644 aa]
          Length = 644

 Score =  517 bits (1332), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 262/584 (44%), Positives = 368/584 (63%), Gaps = 36/584 (6%)

Query: 7   ADEVLYHNQSSVKLGELERYVITYELYQGDSIPADITLDSLWVKIKNTTKLSYKPAYLLG 66
           A EVLYH +SSV++GE+ERYVITY+LY  + +P  I L SLW+K+KN + L+Y+ AYL+G
Sbjct: 6   AREVLYHYRSSVRIGEVERYVITYDLYDEEELPERIQLSSLWLKVKNVSSLTYRAAYLMG 65

Query: 67  PFILYCDVRAKDYESSYKIICSADKPVFQSNLQAQQKFIAELSLHHIKPRYVWIVDIVSQ 126
           P++LYCD+R +DY  S K+  SAD P F+  +Q Q +F+AELSLH ++ RYVW++D+VSQ
Sbjct: 66  PYMLYCDLRTEDYHHSQKLFSSADMPQFEPAMQPQHEFLAELSLHRLQKRYVWLLDVVSQ 125

Query: 127 ILFNKETKVTFEIVVGNSKASLKRKIRCNDSLPDKACNILHTGLSVHRLTTADIWKVPRP 186
           I+F   + V FE+ + ++K +L+       +L  +A +  +  L+V+R TT D+W +P+ 
Sbjct: 126 IIFTTNSVVPFEVTIASAKPALED----TATLAPQAGS-FNRRLTVNRQTTLDLWNLPQQ 180

Query: 187 I--DMSQKSHLVILTHGFQSNVSADMEYLMEEIYKAQMNNPNERLVIKGYMKNACETEKG 244
           +  D ++  HLV+LTHG  SNV+ADM+YL E I + Q   PNE +V+KG+  N C+TEKG
Sbjct: 181 VFDDYTKPEHLVVLTHGLHSNVTADMQYLKETIEQCQQYYPNEHIVVKGFGDNVCKTEKG 240

Query: 245 IKFLGVGLANYIIDELYDDSVGKISFIGHSLGGLTQTFAICYIKTKYPYFFKKVEPINFI 304
           IK+LG  L  YI+ +LY++ + +ISFIGHSLGGLTQTFAI YI   YP+FF+KV+P+NF+
Sbjct: 241 IKYLGGRLGEYIVKQLYNERIKRISFIGHSLGGLTQTFAIAYIAINYPWFFEKVDPVNFV 300

Query: 305 SLASPLLGIATSTPNYVKMSLSMGIIGTTGQELGLKDGNYGDKPXXXXXXXXXXXXXXAR 364
           +L+SPLLGI T+ P YV + LSMG++G TGQ+LGL+     D+P               +
Sbjct: 301 ALSSPLLGIVTNNPAYVNILLSMGVVGKTGQDLGLQAHQGDDQPLLCSLPGHTTRRILRK 360

Query: 365 FKRRTLYANAVNDGIVPXXXXXXXXXXXXXXXXXXGGQTTAPCDPLFQPEVSPIGELPNH 424
           FK+RTLYANAVNDGIVP                            L+    S + +L   
Sbjct: 361 FKKRTLYANAVNDGIVPLYTSAL----------------------LYLDYDSILKQLDTQ 398

Query: 425 SDVANDDDGINASSWNTFWKSKENNC--DKKSKRLMNASVIKSMKSVLLSPCPDAKFFSD 482
               +  D    +  N   K+        + S  +   S+  S  SVLL P P+  +  +
Sbjct: 399 EYQVDKQDFFTKTLINPLVKAINVLMPQTQSSSSIPKVSMFDSAMSVLLPPLPEKSYLMN 458

Query: 483 PDARVATIIHDKIYTEKNLP----PPSPTLYEGTAAKEGETRKTRKEMEEIIARRWHKGM 538
           P    + I+HDK+Y+E ++P    PP   ++       G   +  K++EE IA++WHKGM
Sbjct: 459 PSGDPSVILHDKMYSEADIPEVGQPPEKNIWSSLLLNIGNNEE-YKQLEEEIAKKWHKGM 517

Query: 539 HWRKVVVLLKPDAHNNIIVRRRFSNAYGWPVVDHLVTAHFQRDD 582
            WRKV+V LKPDAHNNIIVRRRF+NAYGWPV+DHLV  HF   D
Sbjct: 518 TWRKVIVHLKPDAHNNIIVRRRFANAYGWPVIDHLVQNHFNGSD 561

>Scas_613.14
          Length = 628

 Score =  512 bits (1319), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 281/645 (43%), Positives = 375/645 (58%), Gaps = 48/645 (7%)

Query: 1   MEAGRSADEVLYHNQSSVKLGELERYVITYELYQGDSIPADITLDSLWVKIKNTTKLSYK 60
           M    S D+VLY + S VK+G + RY+I Y LY GD IP  I+LD L + IKN  + S+K
Sbjct: 1   MAKSISDDQVLYQDTSEVKIGGIRRYIIKYNLYTGDEIPTTISLDPLKLTIKNKVRKSFK 60

Query: 61  PAYLLGPFILYCDVRAKDYESSYKIICSADKPVFQSNLQAQQKFIAELSLHHIKPRYVWI 120
            AYL+GPF LYCDVRA+ Y    +I+ S D P F SNLQ   KFIAELSLH IK +YVWI
Sbjct: 61  AAYLMGPFTLYCDVRAQSYHHKQRIVSSKDVPQFISNLQPHSKFIAELSLHEIKKKYVWI 120

Query: 121 VDIVSQILFNKETKVTFEIVVGNSKASLKRKIRCNDSLPDKACNILHTGLSVHRLTTADI 180
           +D++SQ +F+  +  +FE+ +G +  +                    + L V  L+T  I
Sbjct: 121 IDVISQSIFSLNSVTSFELTLGTTTNNYNSG----------------SSLEVETLSTDVI 164

Query: 181 WKVPRPIDMSQKS----HLVILTHGFQSNVSADMEYLMEEIYKAQMNNPNERLVIKGYMK 236
           W     I + ++S    HLVILTHG  SNV+ADM YLME+IY  Q    NE++V+KGY+ 
Sbjct: 165 WNEKATIPLLRESRKMIHLVILTHGMHSNVTADMSYLMEQIYNTQSLYSNEKIVVKGYVG 224

Query: 237 NACETEKGIKFLGVGLANYIIDELYDDSVGKISFIGHSLGGLTQTFAICYIKTKYPYFFK 296
           N C+TE GIKFLG GLA YIID LY   V KISFIGHSLGGL Q+FAI  I   +P+FF+
Sbjct: 225 NVCKTEMGIKFLGEGLAKYIIDTLYSVEVAKISFIGHSLGGLIQSFAISSIAVLHPWFFE 284

Query: 297 KVEPINFISLASPLLGIATSTPNYVKMSLSMGIIGTTGQELGLKDGNYGDKPXXXXXXXX 356
           KV+P+NFI+LA+P LGI T  P+YVKM LS GIIG TG +LGLK+ +Y +          
Sbjct: 285 KVKPVNFITLATPFLGIVTDNPSYVKMLLSAGIIGKTGVDLGLKE-HYDN--ILYLLSGE 341

Query: 357 XXXXXXARFKRRTLYANAVNDGIVPXXXXXXXXXXXXXXXXXXGGQTTAPCDPLFQPEVS 416
                  +F+RRTLYANA+NDGIVP                       +    +  PE  
Sbjct: 342 PIKSIMKKFERRTLYANAMNDGIVPLYTSCLLFLDYADVLSELDNLKRSIKITIDTPESG 401

Query: 417 PIGELPNHSDVANDDDGINASSWNTFWKSKENNCDKKSKRLMNASVIKSMKSVLLSPCPD 476
              E      + N      +SSW+  +K ++   DK S +L   S+I+SM S+L  P P 
Sbjct: 402 RESE-----KIIN-----TSSSWSKVFKHRKE--DKHSVKLPKTSIIESMASILQPPSPT 449

Query: 477 AKFFSDPDARVATIIHDKIYTEKNLPPPSPTLYE-------GTAAKEGETRKTRKEMEEI 529
            ++ ++P +R   IIHDK+YTE ++       Y+           +   T K  + +E  
Sbjct: 450 DEYITNPSSRAKVIIHDKVYTEDDIERIESNFYKLKNDRLLSRFYRRHSTGKQNERLEVE 509

Query: 530 IARRWHKGMHWRKVVVLLKPDAHNNIIVRRRFSNAYGWPVVDHLVTAHFQRDDPIASPMQ 589
           IA+RWH G  WRKV+V L  +AHNNIIVRRRFSN YGW V+DHL+  HF   D +     
Sbjct: 510 IAKRWHSGTPWRKVIVALGSEAHNNIIVRRRFSNGYGWEVIDHLIENHFNGSDSLLVHNN 569

Query: 590 DKQFAEEDINMATGGVEPNKFYSWLTKIEDPSVYHGGIVSTASQL 634
           ++Q       +    +EPNK +SW+TK+EDP  Y GG++S  ++L
Sbjct: 570 EEQ------AVMKATMEPNKEFSWITKVEDPCSYSGGLLSRTTKL 608

>KLLA0E14872g 1326334..1328367 similar to sp|P53118 Saccharomyces
           cerevisiae YGL144c, start by similarity
          Length = 677

 Score =  496 bits (1277), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 262/589 (44%), Positives = 348/589 (59%), Gaps = 37/589 (6%)

Query: 6   SADEVLYHNQSSVKLGELERYVITYELYQGDSIPADITLDSLWVKIKNTTKLSYKPAYLL 65
           S  +++YH QSS+++GELERY+ TY+LY GD IP+D+TLDSLW+KIKN   ++ + AYL+
Sbjct: 30  SDHDIMYHFQSSLRIGELERYIFTYDLYMGDEIPSDLTLDSLWLKIKNIENVTLRAAYLM 89

Query: 66  GPFILYCDVRAKDYESSYKIICSADKPVFQSNLQAQQKFIAELSLHHIKPRYVWIVDIVS 125
           GP++LY DVR KDY    ++  SAD+P F+SN+Q QQ FIAELSLH++K RYVWIVDI S
Sbjct: 90  GPYVLYADVRTKDYHHKQRLFISADQPQFESNIQPQQDFIAELSLHNLKKRYVWIVDIAS 149

Query: 126 QILFNKETKVTFEIVVGNSKASLKRKIRCNDSLPDKACNILHTGLSVHRLTTADIWK--- 182
           QILF K+  + F I VG SK S+       DS  +    +  + + V RLTTAD+W    
Sbjct: 150 QILFTKQASINFSITVGGSKESISV-----DSARNIQLGVQSSRMKVDRLTTADLWNASL 204

Query: 183 VPRPIDMSQKSHLVILTHGFQSNVSADMEYLMEEIYKAQMNNPNERLVIKGYMKNACETE 242
           + + +   +K HLVILTHG  SNV++D+ Y+ E+I K Q N   E LV+KG+  N C+TE
Sbjct: 205 LSKSVFGRRKEHLVILTHGLHSNVTSDLFYIKEQIEKTQ-NQHEEMLVVKGFTDNVCKTE 263

Query: 243 KGIKFLGVGLANYIIDELYDDSVGKISFIGHSLGGLTQTFAICYIKTKYPYFFKKVEPIN 302
           KGIK+LG  LA +I+  LY+D+  KISFIGHSLGGL Q+FAI YI   YP FF++VEP+N
Sbjct: 264 KGIKWLGTRLAEHIVHNLYNDATVKISFIGHSLGGLVQSFAIAYISYNYPKFFEQVEPVN 323

Query: 303 FISLASPLLGIATSTPNYVKMSLSMGIIGTTGQELGLKDGNYGDKPXXXXXXXXXXXXXX 362
           FI++ASP+LGI +    Y++  L+MGI G TGQ+L L+  N   +P              
Sbjct: 324 FITMASPMLGIVSDNAVYIQRLLAMGIAGKTGQDLSLQTYNGLKQPLLQTLSSSSALRRI 383

Query: 363 AR-FKRRTLYANAVNDGIVPXXXXXXXXXXXXXXXXXXGGQTTAPCDPLFQPEVSPIGEL 421
            + FK  T+YANA NDGIVP                     T       FQ     I  L
Sbjct: 384 LKCFKSCTVYANACNDGIVPLYTSALLFLDYDDILDKLNMNTEDLQTDFFQRNF--ISPL 441

Query: 422 PNHSDVANDDDGINASSWNTFWKSKENNCDKKSKRLMNASVIKSMKSVLLSPCPDAKFFS 481
               D+                        +   ++  AS++ S  SVL+ P PD  + +
Sbjct: 442 TKAMDIL-----------------MPQRVSQNGTKIPVASMLDSAYSVLIPPLPDKSYIT 484

Query: 482 DPDARVATIIHDKIYTEKNLPPPSPTLYEGTAAKEGETRKT--------RKEMEEIIARR 533
           DP  R   ++HDK+Y+ +++P                  KT         K++EE IAR 
Sbjct: 485 DPKTRKDVVVHDKVYSGQDIPDHQSNSQLEVMNSSNVLLKTFNIAFGGQYKKLEEQIARN 544

Query: 534 WHKGMHWRKVVVLLKPDAHNNIIVRRRFSNAYGWPVVDHLVTAHFQRDD 582
           WHK + WRKV++ LKPDAHNNII RRRFSNAYGWPVVDHL   HF  DD
Sbjct: 545 WHKDVKWRKVIINLKPDAHNNIITRRRFSNAYGWPVVDHLTETHFLNDD 593

>CAGL0H10340g 1007564..1009342 similar to sp|P53118 Saccharomyces
           cerevisiae YGL144c or tr|Q12103 Saccharomyces cerevisiae
           YDL109c, hypothetical start
          Length = 592

 Score =  323 bits (828), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 216/640 (33%), Positives = 326/640 (50%), Gaps = 76/640 (11%)

Query: 11  LYHNQSSVKLGELERYVITYELYQGDSIPADITLDSLWVKIKNTTKLSYKPAYLLGPFIL 70
           + H + ++ +GE  R++I         + ++I    ++V+++N TK + +  YLLGPF+L
Sbjct: 1   MIHVRGALAIGETSRFLI--------EVNSNID-GPVFVRLRNRTKATRRATYLLGPFVL 51

Query: 71  YCDVRAKDYESSYKIICSADKPVFQSNLQAQQKFIAEL---SLHHIKPRYVWIVDIVSQI 127
           YCD R     +  + +     P F++N++ Q KF  +L       +  +  WI+D+VS++
Sbjct: 52  YCDSRPVIPANQNEYV-----PQFKANIEPQGKFTFQLKPEDARDVGGKRCWIIDVVSEV 106

Query: 128 LFNKETKVTFEIVVGNSKASLKRKIRCNDSLPDKACNILHTGLSVHRLTTADIWKVPRPI 187
           LFN+ TKV +E+++     + K+     D       +++    S H +   +  +V   I
Sbjct: 107 LFNQITKVDYELLISLDINNFKKSKYQQDIYESIEGDVVAKQYSNHDIQ--EFIEVGAKI 164

Query: 188 DMSQ----KSHLVILTHGFQSNVSADMEYLMEEIYKAQMNNPNERLVIKGYMKNACETEK 243
             SQ      HLVI+THG  SNVS DM Y+ME++     ++ +E L++ GY  N C TE 
Sbjct: 165 KKSQTKERNQHLVIVTHGMISNVSNDMMYIMEQLRAIDRDDLDEELILDGYTGNVCRTEL 224

Query: 244 GIKFLGVGLANYIIDELYDDSVGKISFIGHSLGGLTQTFAICYIKTKYPYFFKKVEPINF 303
           GIK LG+ LANYI+ E Y+ ++ KISFIGHSLGGL QTFAI YI   + +FF  V+P+NF
Sbjct: 225 GIKNLGIRLANYIVKERYNTNIKKISFIGHSLGGLVQTFAIAYIYILHGWFFDAVKPVNF 284

Query: 304 ISLASPLLGIATSTPNYVKMSLSMGIIGTTGQELGLKDGN-YGDKPXXXXXXXXXXXXXX 362
           ISLA+P LG+ +   NY K  LS G +G TG++L     N   +                
Sbjct: 285 ISLATPFLGLYSHIGNYTKRLLSSGALGQTGEDLRYHSHNKLKNFSILYLLSGDPAHSIL 344

Query: 363 ARFKRRTLYANAVNDGIVPXXXXXXXXXXXXXXXXXXGGQTTAPCDPLFQPEVSPIGELP 422
            +F+RRTLYANA+NDGIVP                            L   + S I +  
Sbjct: 345 QKFERRTLYANAINDGIVPL-----------------------ASSALLYLDYSKILKDS 381

Query: 423 NHSDVANDDDGINASSWNTFWKSKE----NNCDKKSKRLMNASVIKSMKSVLLSPCPDAK 478
                  DD      +W  F  S++       + KSK     S+  ++ +++L P P   
Sbjct: 382 KLLKKETDDIRSIVMTWKEFQDSEDFKVYKKVNPKSKIFRRVSLTNTVGNLVL-PEPPKN 440

Query: 479 FFSDPDARVATIIHDKIYTEKNLPP----PSPTLYEGTAAKEGETRKTRKEMEEIIARRW 534
             SD    +  +IHD++Y   ++P     P   + E  A         R +++E +ARRW
Sbjct: 441 ITSD----MKVLIHDQVYQYNDIPDSEYFPPDGIDEIMAMD-------RHQLQECMARRW 489

Query: 535 HKGMHWRKVVVLLKPDAHNNIIVRRRFSNAYGWPVVDHLVTAHFQRDDPIASPMQD--KQ 592
           H G  WRKV+V L+ DAHN+I VRRR+SN+ GW V+ H++  HF +      P  D   Q
Sbjct: 490 HAGKSWRKVIVCLEGDAHNSINVRRRYSNSCGWAVISHMILNHFIKPQKCDVPEADIVSQ 549

Query: 593 FAEEDINMATGGVEPNKFYSWLTKIEDPSVYHGGIVSTAS 632
            A  D       +EPNK Y+WL K ED     GG++  A+
Sbjct: 550 PASRD----EADMEPNKTYAWLLK-EDKE--KGGLIRRAT 582

>AER322C [2823] [Homologous to ScYDR444W - SH] (1229579..1231489)
           [1911 bp, 636 aa]
          Length = 636

 Score =  273 bits (699), Expect = 7e-83,   Method: Compositional matrix adjust.
 Identities = 198/636 (31%), Positives = 311/636 (48%), Gaps = 78/636 (12%)

Query: 1   MEAGRSADEVLYHNQSSVKLGELERYVITYELYQGDSIPADITLDSLWVKIKNTTKLSYK 60
           +E+G     +LY++Q  +  GE+ RY+I  +  Q D   A   ++ L ++IKN      +
Sbjct: 17  LESGNHV--LLYNDQRGISQGEVFRYIIKVDKAQLD---AKTKIEELVLRIKNVESPLLR 71

Query: 61  PAYLLGPFILYCDVRAKDYESSYKIICSADKPVFQSNLQAQQKFIAELSLHH-----IKP 115
           P YL GP+ +Y +VR  +Y+ +       D   F S+L+  + F A L L+         
Sbjct: 72  PIYLTGPYSVYAEVRPYNYDENTAF--QGDDLQFISDLKPDEAFSATLKLNGDSQVLEST 129

Query: 116 RYVWIVDIVSQILFNKETKVTFEIVVGNSKASLKRKIRCNDSLPDKACNILHTGLSVHRL 175
            Y W  D++SQ+ +  +  +   + +GN+++  K  ++     P +A   + +G +V   
Sbjct: 130 VYSWTADVLSQMTWMVDHPILVRLSIGNTRSIGKAAMKT----PARAVEPV-SGFTVEIQ 184

Query: 176 TTADIWKVPRPIDMSQKSHLVILTHGFQSNVSADMEYLMEEIYK---AQMNNPNERLVIK 232
            T  +W  P P+   +  HLVI+THG  SN+  DM YL + + K   A   N N+ +V++
Sbjct: 185 DTMTVWNEP-PLFPERPVHLVIVTHGIFSNIGCDMLYLRDRLKKCAHAVEENCNQNVVVR 243

Query: 233 GYMKNACETEKGIKFLGVGLANYII-------DELYDDSVGKISFIGHSLGGLTQTFAIC 285
           GY  N  ++ KGI++L + +A+Y++       +E + D   +ISFIGHSLGGL QTFAI 
Sbjct: 244 GYHGNIGKSHKGIEYLAMRVADYVLKTIAQMPNEYFLD---RISFIGHSLGGLVQTFAIQ 300

Query: 286 YIKTKYPYFFKK----VEPINFISLASPLLGIATSTPNYVKMSLSMGIIGTTGQELGLKD 341
           Y+  + P  F      + P+NFI+LASP LG+    P Y  ++L+ G +G TG++L LK+
Sbjct: 301 YMLERDPGIFSPQAGGLRPMNFIALASPFLGVIGDFPLYATVALNFGALGRTGKDLNLKN 360

Query: 342 G------------NYGDKPXXXXXXXXXXXXXXARFKRRTLYANAVNDGIVPXXXXXXXX 389
                         Y  +P                F  RTLYANA++DGIVP        
Sbjct: 361 DFAISELVRNPKQAYNRRPVLESIVSGSMKSVLQAFSNRTLYANALHDGIVPLRTSALLY 420

Query: 390 X--XXXXXXXXXGGQTTAPCDPLFQPEVS----PIGELPNHSDVANDDDGI--------- 434
                       G Q  A    L + + +       E+P   D++   D I         
Sbjct: 421 LDWYSLQEVNLIGAQEGAETFDLGEEDHALKRYDTVEIP--PDLSEKKDTIRWLLPRALI 478

Query: 435 -NASSW----NTFWKSKENNCDKKSKR--LMNASVIKSMKSVLLSPCPDAKFFSDPDARV 487
                W     T     E   D+ S    L  AS + S  ++L++P P   ++ DP +R 
Sbjct: 479 KRRHKWYKRSQTVKPGIEQLWDEDSDYHPLTKASALSSAANILVAPPPTQDYYKDPQSRT 538

Query: 488 ATIIHDKIYTEKNLPPP---SPTLYEGTAAKEGETRKTRKEMEEIIARRWHKGMHWRKVV 544
             I HDK Y+ + LPP    +  L +       +  +T    +E IAR + + M WRKV+
Sbjct: 539 DYIFHDKRYSPEELPPAYYRNRELLKKILYPNDKVHRT----QEKIARGYQESMSWRKVL 594

Query: 545 VLLKPDAHNNIIVRRRFSNAYGWPVVDHLVTAHFQR 580
           V ++P++HNNIIVRRRF N++GW V++HLV  HF R
Sbjct: 595 VNIQPESHNNIIVRRRFVNSFGWIVIEHLVNEHFGR 630

>YDR444W (YDR444W) [1264] chr4 (1350278..1352341) Protein of unknown
           function, has low similarity to C. albicans Orf6.7404p
           [2064 bp, 687 aa]
          Length = 687

 Score =  270 bits (691), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 199/653 (30%), Positives = 301/653 (46%), Gaps = 96/653 (14%)

Query: 1   MEAGRSADEVLYHNQSSVKLGELERYVITYELYQGDSIPAD-ITLDSLWVKIKNTTKLSY 59
           +E   +   +L   +  +++GEL RY  +      D I    + +  L+++IKN      
Sbjct: 12  LEINETGGTLLVDERKRLRIGELYRYKFSV---NKDVIKEQGLDVSHLFLRIKNEESALL 68

Query: 60  KPAYLLGPFILYCDVRAKDYESSYKIICSADKPVFQSNLQAQQKFIAELSLHHIK----- 114
           +P YL GP+  Y DVR  +Y  + K       P F  NL+  ++F  ++ L+        
Sbjct: 69  RPLYLTGPYSFYIDVRPHNYNENRKFPGKEIIP-FVENLKPDERFKVKILLNENSRVGDT 127

Query: 115 PRYVWIVDIVSQILFNKETKVTFEIVVGNSKASLKRKIRCNDSLPDKACNILHTGLSVHR 174
             Y W +DI+SQ+      K+ F   +G ++  +K+      S+          G+S+  
Sbjct: 128 SLYSWTIDIISQLAVTTIPKLEFSFRIGTTRKVVKKSNGLFKSI---------EGVSLEM 178

Query: 175 LTTADIWKVPRPIDMSQKSHLVILTHGFQSNVSADMEYLMEEIYKAQMNNP-----NERL 229
             T  +W +P P    +  HLVI+THG  SN+  DM Y+ ++I   +M  P     N  +
Sbjct: 179 WDTETLWDLP-PKFPEKPVHLVIMTHGIFSNIGCDMLYMKDKI--EEMTFPMDESINPNI 235

Query: 230 VIKGYMKNACETEKGIKFLGVGLANYI---IDELYDD-SVGKISFIGHSLGGLTQTFAIC 285
           +++G+M N  ++  GI  LGV +  Y+   +D+L     V +ISFIGHSLGG TQ+ A+ 
Sbjct: 236 IVRGFMGNVGKSGHGIHCLGVRVGKYVLETVDKLNKKYKVDRISFIGHSLGGPTQSMAVR 295

Query: 286 YIKTKYPYFF---KKVEPINFISLASPLLGIATSTPNYVKMSLSMGIIGTTGQELGL--- 339
           YI  K P FF   K V+P+NFI+LASP +G+    P Y+ + L MG +G TG++L L   
Sbjct: 296 YISIKRPDFFDAVKGVKPVNFITLASPFIGVIGDFPFYLSVPLDMGALGLTGRDLNLKYT 355

Query: 340 ----KDGNYGDK---PXXXXXXXXXXXXXXAR-----FKRRTLYANAVNDGIVPXXXXXX 387
               KDG Y D    P              A+     FKRRT+YAN ++DGIVP      
Sbjct: 356 PLTSKDGLYADDEVYPEHSKYILEILPQAPAKKVFESFKRRTIYANVMDDGIVPLRTAAL 415

Query: 388 XX---XXXXXXXXXXGGQTTAPCDPLFQPEVSP---------------IGELPNHSDVAN 429
                               +P    F    SP               +GE+P  S    
Sbjct: 416 LYLDWRSIHKVQKIRKKNKNSPTSSEFVSSDSPESSGASSPSNENGNNVGEIPAESPNKK 475

Query: 430 -------DDDGINASSWNTFWKSKENNCDKKSKRLM-------------NASVIKSMKSV 469
                      I+ S  N + + + N  +  S                  A+ + S  SV
Sbjct: 476 ATLQWTLPQAVIHGSKINKYKRGQTNEANSDSDNEQGVFLDGQKFEPPKEANTVLSALSV 535

Query: 470 LLSPCPDAKFFSDPDARVATIIHDKIYTEKNLPPP----SPTLYEGTAAKEGETRKTRKE 525
           L +  PD ++  +P  R   +IHDK+Y  + LPPP     P + +     E   R     
Sbjct: 536 LTAAIPDQEYIKNPAVRKDEVIHDKLYHPEELPPPHYENRPIVKKLIYPNESVNR----- 590

Query: 526 MEEIIARRWHKGMHWRKVVVLLKPDAHNNIIVRRRFSNAYGWPVVDHLVTAHF 578
           ++E IAR W + M WRKV+V ++PD+HNNI+VRRRF N YG+  V+H+V  HF
Sbjct: 591 IQERIAREWQETMTWRKVLVQIQPDSHNNIVVRRRFVNLYGYVAVEHMVEHHF 643

>Kwal_47.18482
          Length = 623

 Score =  259 bits (661), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 193/630 (30%), Positives = 298/630 (47%), Gaps = 75/630 (11%)

Query: 8   DEVLYHNQSSVKLGELERYVITYELYQGDSIPADITLDSLWVKIKNTTKLSYKPAYLLGP 67
           D +L  ++  + LGEL RY +T +    D   + IT    ++  KNT     +P YL GP
Sbjct: 8   DLLLVDDRLKLGLGELVRYNVTVDRSLLDDHLSHIT--EFYLTFKNTESAFLRPIYLTGP 65

Query: 68  FILYCDVRAKDYESSYKIICSADKPVFQSNLQAQQKFIAELSLH-----HIKPRYVWIVD 122
           +  Y DV+  +Y+     I   +K  F  +++  +++ A L L+         R+VW ++
Sbjct: 66  YSFYVDVQPCNYDER---IPFNEKLQFCEDVKPNEEYRAVLQLNDNSRVEESERFVWQIN 122

Query: 123 IVSQILFNKETKVTFEIVVGNSKASLKRKIRCNDSLPDKACNILHTGLSVHRLTTADIWK 182
           ++SQ+   K   + F + +   K+S          +P      +  G    +  T  +W 
Sbjct: 123 VMSQLSVTKIPVLGFRLCISCGKSS---------EIPSSPVTSIK-GFVCEKWDTHGLWN 172

Query: 183 VPRPIDMSQKSHLVILTHGFQSNVSADMEYLMEEIYKAQ----MNNPNERLVIKGYMKNA 238
           +P P    +  HLV+LTHG  SNV  D+ YL + I  A      ++    LV++GYM N 
Sbjct: 173 LP-PRFPDRPLHLVVLTHGIFSNVGCDLVYLKDRIEAAASVAGKDSKTSNLVVRGYMGNQ 231

Query: 239 CETEKGIKFLGVGLANYIID------ELYDDSVGKISFIGHSLGGLTQTFAICYIKTKYP 292
             + KGIK  GV LA +II+      E YD  +  ISF+ HSLGG +Q  AI YI  + P
Sbjct: 232 GRSSKGIKANGVRLAKFIIETVDDLKEEYD--LQYISFVAHSLGGPSQAMAIRYICLERP 289

Query: 293 YFF---KKVEPINFISLASPLLGIATSTPNYVKMSLSMGIIGTTGQELGL---------- 339
             F   K ++P+NFI+LASP LGIA   P +V ++L +G++G TG +L L          
Sbjct: 290 DIFDPAKGLKPLNFITLASPYLGIAGEVPPFVTLALDVGVLGQTGADLNLNRTFFLSKDG 349

Query: 340 ------KDGNYGDKPXXXXXXXXXXXXXXARFKRRTLYANAVNDGIVPXXXXXXXXXXXX 393
                 K G+Y  KP               RF+ RT+YAN ++DGIVP            
Sbjct: 350 IVRKDEKLGSYRRKPLLEIIPSRPLTELIQRFENRTIYANILHDGIVPLRTAALLYLDWK 409

Query: 394 XXXXXXGGQTTAPCD----PLFQPEVSPIGELPN--------------HSDVANDDDGIN 435
                 G +     D    P    E   IG++P                + +        
Sbjct: 410 ALGDVRGIRRENGKDDEGTPYSSNEKDAIGKIPEEKMDKQSALKYLMPQAALRRKYKKYT 469

Query: 436 ASSWNTFWKSKENNCDKKSKRLM----NASVIKSMKSVLLSPCPDAKFFSDPDARVATII 491
            +   +     EN+  ++S   +    +A+ + S  +++++P P  K+  +P  R   I+
Sbjct: 470 RTQILSQESGNENSYSEESTEPISPPPSANPLVSAANIIVAPLPTQKYLQNPKEREDKIV 529

Query: 492 HDKIYTEKNLPPPSPTLYEGTAAKEGETRKTRKEMEEIIARRWHKGMHWRKVVVLLKPDA 551
           HDKIY    L PP+         K          ++E IAR+W + M+WRKV+V ++PD+
Sbjct: 530 HDKIYYPDEL-PPAHYRKRDVLKKIIYPNDRIYRVQERIARQWQETMNWRKVLVSIEPDS 588

Query: 552 HNNIIVRRRFSNAYGWPVVDHLVTAHFQRD 581
           HNNI+VRR+F NA+GW VVDHLV  HF ++
Sbjct: 589 HNNIVVRRKFVNAFGWVVVDHLVKEHFGKE 618

>KLLA0B01375g 110709..112631 similar to sgd|S0002852 Saccharomyces
           cerevisiae YDR444w, start by similarity
          Length = 640

 Score =  254 bits (649), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 194/657 (29%), Positives = 301/657 (45%), Gaps = 130/657 (19%)

Query: 10  VLYHNQSSVKLGELERYVITYELYQGDSIPADITLDSLWVKIKNTTKLSYKPAYLLGPFI 69
           +L     S+ +G++ RY I  +  +  S   + T D+L+++ KN      +P ++ GP+ 
Sbjct: 19  LLLRETGSLGIGDVNRYKIIVDKNKLLSDGIECTDDTLYLEFKNQESALLRPLWITGPYS 78

Query: 70  LYCDVRAKDYESSYKIICSADKPVFQSNLQAQQKFIAELSLHHIKPR------YVWIVDI 123
           +Y ++   +Y+   + I   D   F S+L+  + F A+L L+    R      Y W +D+
Sbjct: 79  IYVEITPNNYDERKQFI--GDGIEFMSDLKPDENFKAKLYLNS-NARVDGTSCYAWKIDL 135

Query: 124 VSQILFNKETKVTFEIVVGNSKASLKRKIRCNDSLPDKACNILHT-GLSVHRLTTADIWK 182
           ++Q       ++ F   +  +  + K       S  DK   +  T GL + +L T  +W 
Sbjct: 136 IAQFTVVTIVRLPFVFTLATTYKTAKH------SQKDKNIEVQQTDGLKISKLDTEQLWN 189

Query: 183 VPRPIDMSQKSHLVILTHGFQSNVSADMEYLMEEIYKAQMNNP---NERLVIKGYMKNAC 239
           +P P    +  HLVI+THG  S++  DM  L + I +A    P   N  LVI+GY  N  
Sbjct: 190 LPPPFP-DKPVHLVIITHGIFSSIGGDMLCLKDTIERASNFLPDDNNGNLVIRGYPGNVG 248

Query: 240 ETEKGIKFLGVGLANYIIDEL----YDDSVGKISFIGHSLGGLTQTFAICYIKTKYPYFF 295
           ++ KGI+ LG  LA YIID +       ++ +ISF+GHSLGG  Q  AI YI  + P  F
Sbjct: 249 KSHKGIRHLGFKLAEYIIDTIDKLQQQFTLTRISFVGHSLGGPVQAMAIHYISVERPDIF 308

Query: 296 KK---VEPINFISLASPLLGIATSTPNYVKMSLSMGIIGTTGQELGLK------------ 340
            K   + P+NF++ ASP LG+    P Y+ + L +G +G TG++L LK            
Sbjct: 309 DKTTGLTPVNFVAAASPFLGVIGDLPKYISIVLDIGALGQTGRDLTLKRSYFLPSKGIVN 368

Query: 341 -DGNYG---DKPXXXXXXXXXXXXXXARFKRRTLYANAVNDGIVPXXXXXXXXXXXXXXX 396
            DG++     KP               RFK RT+YAN   DGIVP               
Sbjct: 369 NDGSHDRIKSKPILELLPKHPALEVFQRFKCRTVYANVAFDGIVPLR------------- 415

Query: 397 XXXGGQTTAPCDPLFQPEVSPIGELPNHSDVANDDDGINASSWNTFWKSKENNCDKKS-- 454
                  TA    L    +S + ++ + ++ A  ++G+     ++  +  E++ D KS  
Sbjct: 416 -------TAALLYLDWRGLSDVQQVRSENN-AQSEEGVEEQKGSSLGEIPESSSDNKSIL 467

Query: 455 KRLMNASVIKSMK-------------------------------------------SVLL 471
           + L+  S+IK  K                                           S + 
Sbjct: 468 QWLLPQSLIKKEKYKPYVRTQTTSSVESASSDSNNNSDSPTTFKPPKKANTLQAAASTIS 527

Query: 472 SPCPDAKFFSDPDARVATIIHDKIYTEKNLPPPSPTLYEGTAAKEGETRKTRKEM----- 526
           +P P   +  DP +R   IIHDK+YT + LP            K  + +K  K++     
Sbjct: 528 APLPGMSYLVDPSSRTDRIIHDKVYTPEELP-----------DKHYKHKKLVKKIIYPNY 576

Query: 527 -----EEIIARRWHKGMHWRKVVVLLKPDAHNNIIVRRRFSNAYGWPVVDHLVTAHF 578
                EE IAR W + M WRKV+V L+PD+HNNIIVRRRF N++GW VV+H+   HF
Sbjct: 577 SIHMKEERIARYWQETMDWRKVIVELQPDSHNNIIVRRRFVNSFGWIVVNHIADEHF 633

>CAGL0M10043g complement(999113..1001089) similar to tr|Q04093
           Saccharomyces cerevisiae YDR444w, hypothetical start
          Length = 658

 Score =  246 bits (629), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 202/648 (31%), Positives = 298/648 (45%), Gaps = 96/648 (14%)

Query: 10  VLYHNQSSVKLGELERYVITYELYQGDSIPAD-ITLDSLWVKIKNTTKLSYKPAYLLGPF 68
           +L H ++S+ +G + RY++  +      +  D I    L+++ KN      +P YL GP+
Sbjct: 8   LLVHEKNSLGIGGMCRYILQVD---HKKLKEDGIDTQELYLRFKNLESPLLRPVYLTGPY 64

Query: 69  ILYCDVRAKDYESSYKIICSADKPVFQSNLQAQQKFIAEL------SLHHIKPR---YVW 119
             Y DVR  +Y+     I S D   F S+L+  +KF A+L       L     R   Y W
Sbjct: 65  AFYIDVRPCNYDEDKTYIGSEDV-AFCSDLKPDEKFKAKLYFNANSRLQTKNARDEIYSW 123

Query: 120 IVDIVSQILFNKETKVTFEIVVGNSKASLKRKIRCNDSLPDKACNILHTGLSVHRLTTAD 179
            +DI+SQ+       VTF I+  + K    +KI                GLS+       
Sbjct: 124 TIDIISQLAV-----VTFPILKYSFKVGTSKKIVKKSKGKKVTS---VRGLSLKMWDEKS 175

Query: 180 IWKVPRPIDMSQKSHLVILTHGFQSNVSADMEYLMEEIYKAQMN-----NPNERLVIKGY 234
           +W +P P    +  HLVILTHG  SNV  DM Y+ ++I +  MN     NPN  +V++G 
Sbjct: 176 LWNLP-PKYPDKPIHLVILTHGIFSNVGCDMLYMKDKIEQTAMNIEERYNPN--VVVRGC 232

Query: 235 MKNACETEKGIKFLGVGLANYII---DELYDD-SVGKISFIGHSLGGLTQTFAICYIKTK 290
           M N  ++  GI +LG  LA +++   +EL  +  V KISFIGHSLGG TQ+ AI YI   
Sbjct: 233 MDNMGKSAHGIYYLGKRLAKFVVRTVEELRKEYHVDKISFIGHSLGGPTQSMAIHYISVM 292

Query: 291 YPYFFKKV---EPINFISLASPLLGIATSTPNYVKMSLSMGIIGTTGQELGLK------- 340
           YP FF  V   +P++FI+LASP +G+    P Y+ + L MG +G TG++L LK       
Sbjct: 293 YPDFFNTVSGIKPMHFIALASPFIGVIGDFPLYLSVPLDMGALGLTGRDLNLKYTPLTSN 352

Query: 341 ----------DGNYGDKPXXXXXXXXXXXXXXARFKRRTLYANAVNDGIVPXXXXXXXXX 390
                     + ++  K                 F  RTLYAN V+DGIVP         
Sbjct: 353 EGLSALTLAQENSHLPKNILEIIPQPPAQQVFQLFMNRTLYANIVHDGIVPLRTAALLYL 412

Query: 391 XXXXXXXXXGGQTTA---------PCDPLFQPEVSP------IGELPNHSDVAND----- 430
                      + +A            P     VS       +GE+P+ S  + +     
Sbjct: 413 DWRSLTQVKDIKKSAGEKSNNKITEDSPTDNESVSTTNKDNKMGEIPSESPNSKNFLQWA 472

Query: 431 --------------------DDGINASSWNTFWKSKENNCDKKSKRLMNASVIKSMKSVL 470
                               D   N SS +T  +S ++  ++K K    AS   S  S L
Sbjct: 473 LPQVIIKGPKMNKFKRGQIMDTKSNESS-DTDTESSDSKQEQKFKGPSEASTFMSALSTL 531

Query: 471 LSPCPDAKFFSDPDARVATIIHDKIYTEKNLPPPSPTLYEGTAAKEGETRKTRKEMEEII 530
            +P P  ++  +P  R   ++HD++Y  ++LP     L   T  +     ++   ++E I
Sbjct: 532 TAPVPTQEYIKNPKVRKDRVVHDRVYEPQDLPEQH-YLKRSTMKRVVYPNESVNRIQERI 590

Query: 531 ARRWHKGMHWRKVVVLLKPDAHNNIIVRRRFSNAYGWPVVDHLVTAHF 578
           AR W   M WRKV+V ++PD+HNNI+VRRRF N YG   V H+V  HF
Sbjct: 591 ARAWQMNMSWRKVLVEIQPDSHNNIVVRRRFVNLYGNVAVSHMVREHF 638

>Scas_717.50
          Length = 658

 Score =  190 bits (482), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 136/401 (33%), Positives = 202/401 (50%), Gaps = 41/401 (10%)

Query: 10  VLYHNQSSVKLGELERYVITYELYQGDSIPADITLDSLWVKIKNTTKLSYKPAYLLGPFI 69
           +L +    + +G+L RY+I+ +  + +   + I ++ L+++IKN      +P YL GP+ 
Sbjct: 18  LLLNETKKLGIGDLSRYIISVDKKKLED--SGICIEELFLRIKNEESPLLRPVYLTGPYT 75

Query: 70  LYCDVRAKDYESSYKIICSADKPV-FQSNLQAQQKFIAELSLH-HIK----PRYVWIVDI 123
            Y DVR  +Y      I   D+ + F  +L+   +F  ++ L+ H +      Y W VDI
Sbjct: 76  FYVDVRPHNYHEDE--IFEGDEVIPFCEHLKPDARFKTKIFLNKHSRVANTNTYSWTVDI 133

Query: 124 VSQILFNKETKVTFEIVVGNSKASLKRKIRCNDSLPDKACNILHTGLSVHRLTTADIWKV 183
           +SQ+       + +   +  +K   K     N S   K   +   G  V  L T+ +W  
Sbjct: 134 LSQLCVIPTPTLKYSFRIATTKKETK-----NGSKGKKPVKM--DGFEVKLLDTSSLWSF 186

Query: 184 PRPIDMSQKSHLVILTHGFQSNVSADMEYLMEEIYKAQMNNP---NERLVIKGYMKNACE 240
           P P   ++  HLVI+THG  SN+  DM Y+ ++I +   + P   N  +V++G MKN  +
Sbjct: 187 P-PKYPNKPVHLVIMTHGIFSNIGCDMLYMKDKIEETANSVPEDINPNVVVRGCMKNMGK 245

Query: 241 TEKGIKFLGVGLANYII---DELYDD-SVGKISFIGHSLGGLTQTFAICYIKTKYPYFF- 295
           +  G+ +LG  +A YII   DEL     V KISFIGHSLGG TQ  A+ YI  K P  F 
Sbjct: 246 SAHGVHYLGKRVAEYIIETVDELNKKYKVDKISFIGHSLGGPTQGMAVHYISVKRPDIFH 305

Query: 296 --KKVEPINFISLASPLLGIATSTPNYVKMSLSMGIIGTTGQELGLK------------D 341
             K ++P+NFI+LASP +G+    P YV + L  G +G TG++L LK            D
Sbjct: 306 PTKGIKPVNFITLASPFIGVIGDFPLYVSLPLDAGSLGLTGRDLNLKYTPLTSKDGLTTD 365

Query: 342 GNYGD-KPXXXXXXXXXXXXXXARFKRRTLYANAVNDGIVP 381
           GN    K                RF  RTLYAN V+DGIVP
Sbjct: 366 GNAAKTKLILEIIPQPPALAIFERFVHRTLYANVVHDGIVP 406

 Score = 94.7 bits (234), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 52/124 (41%), Positives = 71/124 (57%), Gaps = 10/124 (8%)

Query: 460 ASVIKSMKSVLLSPCPDAKFFSDPDARVA-TIIHDKIYTEKNLPPP----SPTLYEGTAA 514
           AS + +  SVL +P P  ++  +P+ R    I+HDKIYT K +P       P + +    
Sbjct: 528 ASTMLAALSVLTAPLPSQEYIKNPEVRHHDAIVHDKIYTPKEIPRAHYANRPAIKKVIYP 587

Query: 515 KEGETRKTRKEMEEIIARRWHKGMHWRKVVVLLKPDAHNNIIVRRRFSNAYGWPVVDHLV 574
            E   R      +E IAR+W   M+WRKV+V +KPD+HNNI+VRRRF N YG   V H+V
Sbjct: 588 NESVNR-----TQERIARQWQMTMNWRKVLVKIKPDSHNNIVVRRRFVNLYGDVAVSHMV 642

Query: 575 TAHF 578
             HF
Sbjct: 643 EEHF 646

>AFR386C [3578] [Homologous to NOHBY] (1131324..1132838) [1515 bp,
           504 aa]
          Length = 504

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 58/200 (29%), Positives = 88/200 (44%), Gaps = 19/200 (9%)

Query: 194 HLVILTHGFQSNVSADMEYLMEEIYKAQMNNPNERLVIKGYMKNACETEKGIKFLGVGLA 253
           HLV L HG   NV+  MEYL   + + Q  +P   +V    M     T  GI   G  +A
Sbjct: 5   HLVFLVHGLWGNVT-HMEYLGRAVSQLQERSPETLVVYAAKMNQGYRTYDGIDICGYRVA 63

Query: 254 NYIIDELYD-------DSVGKISFIGHSLGGLTQTFAICYIKTKYPYFFKK--VEPINFI 304
             I +++           V K S +G+S+GGL   +A+  + +    FFKK  ++ INF 
Sbjct: 64  KEIQEQVATLNCPETGTVVTKFSIVGYSMGGLISRYAVGLLYSN--QFFKKQDIKLINFT 121

Query: 305 SLASPLLGIATSTPNYVKMSLSMG---IIGTTGQELGLKD----GNYGDKPXXXXXXXXX 357
           +  SP +G+     N      +     I+G +G+++ LKD     N              
Sbjct: 122 TFCSPHVGVLAPGKNLAVRVFNFVCSLILGNSGRQMFLKDRIKAANGMPLIVLMSVGDSI 181

Query: 358 XXXXXARFKRRTLYANAVND 377
                 +F+ R+LYAN VND
Sbjct: 182 FYKALEQFQHRSLYANIVND 201

>KLLA0F16709g 1539612..1541207 weakly similar to ca|CA1159|IPF13423
           Candida albicans unknown function, start by similarity
          Length = 531

 Score = 69.3 bits (168), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 59/204 (28%), Positives = 94/204 (46%), Gaps = 24/204 (11%)

Query: 192 KSHLVILTHGFQSNVSADMEYLMEEI--YKAQMNNP-------NERLVI-KGYMKNACET 241
           K HLV+L HG   N S      M EI  Y   +N+        NE +V+ + ++    +T
Sbjct: 14  KIHLVVLVHGLWGNRSH-----MNEICNYLLSLNDSSAGHKSLNEMIVVHQTHLNEGYKT 68

Query: 242 EKGIKFLGVGLANYIIDELY---DDSVGKISFIGHSLGGLTQTFAICYIKTKYPYFFKKV 298
             GI   G+ ++  I D++     D V K S IG+SLGGL   +A+  +     +    +
Sbjct: 69  YDGIDVCGIRVSKEIKDQINHYGSDHVVKFSLIGYSLGGLICRYALGVLYQAQTFKKNDI 128

Query: 299 EPINFISLASPLLGIATSTPNYVKMSLSM---GIIGTTGQELGLKDGNYGDKPXXXXXXX 355
           E +NFI+  +P +G+     N      ++    ++G +G+++ LKD  Y   P       
Sbjct: 129 ELVNFITFCTPHVGVLAPGNNVAVNLFNIIVPLVLGNSGKQMFLKD-KYNGYPLLYVMSS 187

Query: 356 XXXXXXXA--RFKRRTLYANAVND 377
                  A  +FK R LYAN +ND
Sbjct: 188 PSSVFYKALKQFKYRALYANIIND 211

>Kwal_27.10102
          Length = 258

 Score = 64.3 bits (155), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 53/198 (26%), Positives = 100/198 (50%), Gaps = 16/198 (8%)

Query: 194 HLVILTHGFQSNVSADMEYL---MEEIYKAQMN--NPNERLVIKGYMKNACETEKGIKFL 248
           HLV+L HG   N S  ++Y+   ++E ++++ +  +  E +V   ++    +T  GI   
Sbjct: 15  HLVVLVHGLWGNRS-HLDYMSNALKESFESREDTCSKEELVVYTPHLNEGYKTYDGIDVC 73

Query: 249 GVGLANYIIDELYD-DSVGKISFIGHSLGGLTQTFAICYIKTKYPYFFKKVEPINFISLA 307
           GV +A+ I +++    SV K S  G+SLGGL   +A+  +  +  +  + ++ +NF +  
Sbjct: 74  GVRVASEIEEQIVSLGSVTKFSICGYSLGGLISRYALGVLHKRQLFKKRDIQLVNFTTFC 133

Query: 308 SPLLGIATSTPNYVKMSLSMGII----GTTGQELGLKD--GNYGDKPXXXXXXXXXXXXX 361
           +P +G+     N V + L   I+    G++G+++ LKD     G+ P             
Sbjct: 134 TPHVGVYAPGKN-VAVRLYNAIVPLVLGSSGKQMFLKDKPKFSGELPLILSMSLENSIFY 192

Query: 362 XA--RFKRRTLYANAVND 377
            A   F+ ++LYAN +ND
Sbjct: 193 KALQEFQTKSLYANVIND 210

>Kwal_55.21703
          Length = 441

 Score = 62.8 bits (151), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 52/201 (25%), Positives = 91/201 (45%), Gaps = 18/201 (8%)

Query: 194 HLVILTHGFQSNVSADMEYLMEEIYKAQMNNPNERLVIKGYMKNACETEKGIKFLG---- 249
           HL +L HG   N        + +++    ++    L          +T  GI+ +G    
Sbjct: 5   HLFVLVHGLWGNYKHMNA--IRDVFAETFHDHENTLFFSPRQNGYFKTFDGIEIMGYRTL 62

Query: 250 VGLANYIIDELYDDSVGKISFIGHSLGGLTQTFAICYIKTKYPYFFKKVEPINFISLASP 309
           + L  +I ++     + KISF+G+S+GGL   F I  + T+    F+ +EP  FI+ A+P
Sbjct: 63  LELCRFI-EQFPKGEITKISFVGYSMGGLIARFMIGKMFTECHELFQCIEPQLFITFATP 121

Query: 310 LLGI--------ATSTPNYVKMSLSMG--IIGTTGQELGLKDGNYGDKPXXXXXXXXXXX 359
            LG+        A+     +++  ++G  I+G TG++L ++D +  ++            
Sbjct: 122 HLGVHFFLKEDRASHRRALLRILSALGTTILGRTGRQLFIQD-SLPEQSILVQLSSGEYL 180

Query: 360 XXXARFKRRTLYANAVNDGIV 380
              ARFK R   AN  ND  V
Sbjct: 181 HGLARFKHRLCVANVKNDRTV 201

>Sklu_2393.4 , Contig c2393 3530-5170 reverse complement
          Length = 546

 Score = 62.4 bits (150), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 56/206 (27%), Positives = 93/206 (45%), Gaps = 19/206 (9%)

Query: 190 SQKSHLVILTHGFQSNVS--------ADMEYLMEEIYKAQMNNPNERLVI-KGYMKNACE 240
           S+  HLV+L HG   N S         D      ++++       E +V+    +    +
Sbjct: 6   SKDYHLVVLVHGLWGNGSHFDYISNSIDTSLKTHDVFQPGGKLAGEEIVVYTTCLNEGYK 65

Query: 241 TEKGIKFLGVGLANYIIDELYD-DSVGKISFIGHSLGGLTQTFAICYIKTKYPYFFKKVE 299
           T  GI   G+ +A  I D++    SV K S +G+SLGGL   +A+  +  K  +    +E
Sbjct: 66  TYDGIDVCGLRVAKEIEDQIETLGSVIKFSLVGYSLGGLIARYALGILYKKQLFKKHDIE 125

Query: 300 PINFISLASPLLGIATSTPNYVKMSLSMGII----GTTGQELGLKDG--NYGDKPXXXXX 353
            INF +  +P +G+     N + ++L   I+    G +G+++ LKD   + G+ P     
Sbjct: 126 LINFTTFCTPHVGVYAPGKN-IAVNLFNTIVPFVLGNSGKQMFLKDQVRSAGNLPLVYLM 184

Query: 354 XXXXXXXXXA--RFKRRTLYANAVND 377
                    A   FK + LYAN +ND
Sbjct: 185 SMENSVFYKALQEFKYKALYANVIND 210

>CAGL0L10318g complement(1103690..1105063) similar to tr|Q08448
           Saccharomyces cerevisiae YOR059c, start by similarity
          Length = 457

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 55/208 (26%), Positives = 93/208 (44%), Gaps = 20/208 (9%)

Query: 189 MSQKSHLVILTHGFQSNVS--ADMEYLMEEIYKAQMNNPNERLVIKGYMKNAC-ETEKGI 245
           M Q  HL +L HG   N      +E +++     + +  ++  V     +NA  +T  GI
Sbjct: 1   MGQDKHLFVLIHGLWGNYKHMKSLEKVLDATLNGKKSGKDKDYVFFLPKQNATFKTFDGI 60

Query: 246 KFLG----VGLANYIIDELYDDSVGKISFIGHSLGGLTQTFAICYIKTKYPYFFKKVEPI 301
           + +G    + L  ++  E  D ++ KISF+G+SLGGL   F +  + ++    F  +E  
Sbjct: 61  EIIGYRTLLELCEFM-KEFKDGNITKISFVGYSLGGLVARFVVGKMYSECNDIFGNIERC 119

Query: 302 NFISLASPLLGIATSTP-NYVKMSL------SMG--IIGTTGQELGLKDGNYGDKPXXXX 352
            F+++A+P LGI    P  Y+   L       +G  I+G +G+EL + + +         
Sbjct: 120 IFMTMATPHLGIQFYNPLGYLHRKLLFSTFTGLGSTILGKSGRELFIANSS---NDILVR 176

Query: 353 XXXXXXXXXXARFKRRTLYANAVNDGIV 380
                       F  R L+AN  ND  V
Sbjct: 177 LSEGKYIEALEEFNHRILFANVKNDRTV 204

>KLLA0F16423g complement(1516717..1518096) similar to sgd|S0005585
           Saccharomyces cerevisiae YOR059c, start by similarity
          Length = 459

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 50/207 (24%), Positives = 92/207 (44%), Gaps = 21/207 (10%)

Query: 190 SQKSHLVILTHGFQSNVSADMEYLMEEIYKAQMNNPNERLVIKGYMKNACETEKGIKFLG 249
           ++K HL IL HG   N    M  + +E+ +  +++ ++ ++ K       +T  GI+ + 
Sbjct: 4   TKKKHLFILVHGLWGN-HKHMNSI-KEMLEKTLDDIDDIVIFKPENSGYLKTLHGIRVVS 61

Query: 250 VGLANYIIDELYD---DSVGKISFIGHSLGGLTQTFAICYIKTKYPYFFKKVEPINFISL 306
             + + I   + +   +   ++S IG+S+GGL   F I  + T+    F+ +EP+ F++ 
Sbjct: 62  YNVLDEICKFVLNYGPEKFDRVSMIGYSMGGLVSRFIIGKMVTECRDIFQHMEPMIFMTF 121

Query: 307 ASPLLGI-----ATSTPNYVKM--------SLSMGIIGTTGQELGLKDGNYGDKPXXXXX 353
           A+P LG+     +  T  YV           L   I+G +G E+ + +    D       
Sbjct: 122 ATPHLGVNFYLPSDKTRRYVSRKILTSVLSGLGRTILGRSGAEIFISN---KDDRILVDL 178

Query: 354 XXXXXXXXXARFKRRTLYANAVNDGIV 380
                    +RF  R  +AN  ND  V
Sbjct: 179 SQGEYLYGLSRFHHRVCFANVKNDRTV 205

>YOR059C (YOR059C) [4867] chr15 complement(438907..440259) Protein
           of unknown function, has low similarity to
           uncharacterized C. albicans Orf6.7873p [1353 bp, 450 aa]
          Length = 450

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 52/208 (25%), Positives = 93/208 (44%), Gaps = 22/208 (10%)

Query: 189 MSQKSHLVILTHGFQSNVS--ADMEYLMEEIYKAQMNNPNERLVIKGYMKNAC-ETEKGI 245
           M+   HL +L HG   N +    M  ++    K +  + N+ ++     +NA  +T  GI
Sbjct: 1   MTSDKHLFVLIHGLWGNYTHMESMRTILSTTLKKE--DVNDDMIYFLPKQNAMFKTFDGI 58

Query: 246 KFLG----VGLANYIIDELYDDSVGKISFIGHSLGGLTQTFAICYIKTKYPYFFKKVEPI 301
           + +G    + +  +I D   D  + K+S +G+S GGL   F I  + T++   F+ +EP 
Sbjct: 59  EIIGYRTLIEVCEFIRD-YKDGKITKLSVMGYSQGGLVARFMIGKMLTEFKELFEDIEPQ 117

Query: 302 NFISLASPLLGIATSTPNYVKM---------SLSMGIIGTTGQELGLKDGNYGDKPXXXX 352
            FI++A+P LG+    P  +           +L   I+G +G+E+ + + +         
Sbjct: 118 LFITMATPHLGVEFYNPTGIAYKSALYSALRTLGSTILGKSGREMFIANSS---NNILVK 174

Query: 353 XXXXXXXXXXARFKRRTLYANAVNDGIV 380
                     + FK R  +AN  ND  V
Sbjct: 175 LSQGEYLEALSLFKWRIAFANVKNDRTV 202

>ADR202C [1943] [Homologous to ScYOR059C - SH] (1060157..1061488)
           [1332 bp, 443 aa]
          Length = 443

 Score = 56.2 bits (134), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 61/215 (28%), Positives = 85/215 (39%), Gaps = 37/215 (17%)

Query: 189 MSQKSHLVILTHGFQSNVSADMEYLMEEIYKAQMNNPNERLVI-----KGYMKNACETEK 243
           M  K HL +L HG     S      M  I  A      +  V       GY+K    T  
Sbjct: 1   MPNKKHLFVLVHGLWGTHSH-----MNSIKTAFSEALGDDAVFYVPRSNGYVK----TLH 51

Query: 244 GIKFLG----VGLANYIIDELYD-DSVGKISFIGHSLGGLTQTFAICYIKTKYPYFFKKV 298
           GI+ +G    V L  ++  +  D     +ISFIG+S+GGL   F I  I T+    F  +
Sbjct: 52  GIELVGYQTVVELTEFV--QARDPQKFDRISFIGYSMGGLVSRFVIGTIFTECRVIFGHM 109

Query: 299 EPINFISLASPLLGIATSTP-NYVKMSLSMG------------IIGTTGQELGLKDGNYG 345
            P+ F++ A+P LG+    P N    S  MG             +G +G++L L    Y 
Sbjct: 110 RPVLFMTFATPHLGVQFYQPRNPQAKSTVMGAVLPVARFVGSHFLGRSGRQLFLA---YE 166

Query: 346 DKPXXXXXXXXXXXXXXARFKRRTLYANAVNDGIV 380
           +                ARF+ R   AN  ND  V
Sbjct: 167 NDDTLVRMTEGVYLEQLARFRHRVCLANVKNDRTV 201

>Scas_698.39
          Length = 471

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 68/226 (30%), Positives = 101/226 (44%), Gaps = 46/226 (20%)

Query: 185 RPIDMSQK-SHLVILTHGFQSNVSADMEYLMEEIYKAQMNNPNERL--VIKGYMKNAC-E 240
           RP+  +QK +HL IL HG   N    ME L E + K  + +  +RL  V     +NA  +
Sbjct: 7   RPLVSNQKDAHLFILLHGLWGNYK-HMESLKETL-KNSIQDDTDRLPLVFFSPRQNAMFK 64

Query: 241 TEKGIKFLGVGLANYIID--ELYDD-SVGKISFIGHSLGGLTQTFAICYIKTKYP----- 292
           T  G++ +G      II   +L+ +    K+S +G+S+GGL   F I  +  K       
Sbjct: 65  TFDGVEVVGYRALIEIIQFIQLHPEFKFTKLSILGYSMGGLIARFLIGVMFDKNNDEDEM 124

Query: 293 YFFKKVEPINFISLASPLLGIATSTP--NYVKMSLS-------MGIIGTTGQEL------ 337
             FK +EP  FI+ A+P LGI    P  N ++  L+         IIG +G+E+      
Sbjct: 125 KVFKGMEPQLFITFATPHLGIHFYNPLNNMLRTFLNPMLTLIGSNIIGVSGREMFIMRNT 184

Query: 338 ---GLKDGNYGDKPXXXXXXXXXXXXXXARFKRRTLYANAVNDGIV 380
               L  G Y D                ++FK R ++AN  ND  V
Sbjct: 185 ELVELSSGKYLD--------------ALSKFKWRIVFANVKNDRTV 216

>Sklu_2232.4 YOR059C, Contig c2232 3289-4626
          Length = 445

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 59/214 (27%), Positives = 86/214 (40%), Gaps = 33/214 (15%)

Query: 189 MSQKSHLVILTHGFQSNVSADMEYLMEEIYKAQMNNPNERLVI------KGYMKNACETE 242
           MS K HL +L HG   N        M+ I         +  VI       GY K    T 
Sbjct: 1   MSGK-HLFVLVHGLWGNYKH-----MDSIKGVFSKTFGDENVIFFAPKQNGYFK----TF 50

Query: 243 KGIKFLGVGLANYIIDELYDDSVGKI---SFIGHSLGGLTQTFAICYIKTKYPYFFKKVE 299
            GI+ +G      + + +    VGKI   SFIG+S+GGL   F I  ++T+    F+ + 
Sbjct: 51  DGIEIVGYRTLLELCEFIRKYGVGKITKISFIGYSMGGLISRFIIGKMETECQELFEGIN 110

Query: 300 PINFISLASPLLGIATSTP-------------NYVKMSLSMGIIGTTGQELGLKDGNYGD 346
              FI+ A+P LG+    P             + V   L   ++G +G++L ++D +  D
Sbjct: 111 RQLFITFATPHLGVEFYLPKEKPLQTRSRRFLHSVLSFLGSTVLGRSGRQLFIRDKHSWD 170

Query: 347 KPXXXXXXXXXXXXXXARFKRRTLYANAVNDGIV 380
                           A FK R   AN  ND  V
Sbjct: 171 STLVKLSSDEYLLGLSA-FKYRICIANVKNDRTV 203

>YNL004W (HRB1) [4581] chr14 (623331..624620) Protein with
           similarity to Rlf6p, contains three RNA recognition
           motif (RRM) domains [1290 bp, 429 aa]
          Length = 429

 Score = 33.9 bits (76), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 30/61 (49%), Gaps = 1/61 (1%)

Query: 488 ATIIHDKIYTEKNLPPPSPTLYEGTAAKEGETRKTRKEMEEIIARRWHKGMHWRKVVVLL 547
           A  +  KI+  ++ PPPS  + E  A   GE R  RK   E+I +     ++W+ +  + 
Sbjct: 198 AFFMDRKIFVRQDNPPPSNNIKERKALDRGELRHNRK-THEVIVKNLPASVNWQALKDIF 256

Query: 548 K 548
           K
Sbjct: 257 K 257

>KLLA0E09350g complement(832187..834076) similar to sgd|S0005548
           Saccharomyces cerevisiae YOR022c, hypothetical start
          Length = 629

 Score = 33.9 bits (76), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 27/45 (60%), Gaps = 4/45 (8%)

Query: 266 GKISFIGHSLGGLTQTFAICYIKTKYPYFFKKVEPINFISLASPL 310
           GK+S +GHSLG +   F I   ++K+P  F   E  NF ++ SP+
Sbjct: 423 GKVSLLGHSLGSVI-LFDILSQQSKFPLNF---EVDNFFAIGSPI 463

>Kwal_47.18259
          Length = 366

 Score = 31.2 bits (69), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 26/45 (57%), Gaps = 4/45 (8%)

Query: 266 GKISFIGHSLGGLTQTFAICYIKTKYPYFFKKVEPINFISLASPL 310
           GK+  +GHSLG L   F I   + +YP  F  VE  NF S+ SP+
Sbjct: 158 GKVHIMGHSLGSLL-IFDILANQDRYPLDF-DVE--NFFSIGSPV 198

>KLLA0F09713g 894192..895058 similar to sp|P38324 Saccharomyces
           cerevisiae YBR228w singleton, start by similarity
          Length = 288

 Score = 30.8 bits (68), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 26/51 (50%), Gaps = 1/51 (1%)

Query: 195 LVILTHGFQSNVSA-DMEYLMEEIYKAQMNNPNERLVIKGYMKNACETEKG 244
           +V   +GF S ++A   E+  +  YK +    NERLV K   +N   T+ G
Sbjct: 63  MVCFIYGFTSKIAALQFEHAWQHSYKTRFIENNERLVTKKNTRNGIATKLG 113

>CAGL0M04147g complement(455977..458901) similar to sp|P42839
           Saccharomyces cerevisiae YNL321w, hypothetical start
          Length = 974

 Score = 30.4 bits (67), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 22/37 (59%), Gaps = 3/37 (8%)

Query: 588 MQDKQFAEEDINMATGGVEPNKFYSWLTKIEDPSVYH 624
           +QDKQ+ EED +    G+   +FY+W+T  +    +H
Sbjct: 320 IQDKQYLEEDRD---EGISVQQFYNWVTSYKSRLFFH 353

>YNL321W (YNL321W) [4293] chr14 (34695..37421) Member of the calcium
           permease family of membrane transporters [2727 bp, 908
           aa]
          Length = 908

 Score = 30.0 bits (66), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 12/37 (32%), Positives = 23/37 (62%), Gaps = 3/37 (8%)

Query: 588 MQDKQFAEEDINMATGGVEPNKFYSWLTKIEDPSVYH 624
           +QD+Q+ +ED +    G+   +FY+W+T   +  V+H
Sbjct: 301 LQDEQYLQEDKD---EGISMQQFYNWVTSYSNRLVFH 334

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.134    0.403 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 20,623,971
Number of extensions: 895261
Number of successful extensions: 2483
Number of sequences better than 10.0: 39
Number of HSP's gapped: 2472
Number of HSP's successfully gapped: 54
Length of query: 636
Length of database: 16,596,109
Length adjustment: 108
Effective length of query: 528
Effective length of database: 12,857,365
Effective search space: 6788688720
Effective search space used: 6788688720
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)