Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YDL108W (KIN28)30630116250.0
Scas_613.13*31229514560.0
CAGL0H10318g30729614220.0
KLLA0E14828g31029413210.0
ADL283W30629612980.0
Kwal_23.347126025211011e-153
KLLA0D11990g3042975723e-72
CAGL0L12474g3022955569e-70
Scas_568.9*3063085516e-69
AGL242C3032975491e-68
KLLA0B09790g2952925281e-65
ADR058C2952925262e-65
Scas_721.462962925091e-62
YBR160W (CDC28)2982955072e-62
CAGL0H07535g2982945062e-62
Scas_610.76683375014e-58
Kwal_27.118032462434675e-57
AFR205C4573004722e-55
CAGL0I08349g6673324743e-54
Scas_721.1105203004656e-54
Kwal_26.75524612944609e-54
AFR019W3593084531e-53
KLLA0E12177g4552964547e-53
Kwal_17.26873623134452e-52
Kwal_55.219006253304523e-51
CAGL0D02002g5532924483e-51
ABR177C7533274553e-51
Kwal_27.119192092044235e-51
KLLA0D10527g6453424481e-50
Kwal_47.178683653084304e-50
Scas_710.283523134284e-50
KLLA0E10527g3713324252e-49
YBL016W (FUS3)3533124208e-49
CAGL0L06820g3663034146e-48
CAGL0L12650g5673104241e-47
CAGL0J04290g3573144121e-47
Scas_623.113782954113e-47
KLLA0A02497g3623044094e-47
Kwal_27.118305752894134e-46
KLLA0F17006g4152934055e-46
ADR253W3803044001e-45
KLLA0D11814g5932894092e-45
CAGL0J00539g4883014024e-45
Kwal_14.14163653033955e-45
ACL191C3652963861e-43
Scas_667.184373173882e-43
YGR040W (KSS1)3683053833e-43
Scas_683.63773043816e-43
Scas_713.384323043812e-42
Scas_688.144793013823e-42
CAGL0D01694g4323113794e-42
Kwal_56.238414323043785e-42
AGL249C5812903845e-42
Kwal_23.55765043143816e-42
ADL315C4342993761e-41
CAGL0K04169g3983343713e-41
KLLA0F20053g4443023733e-41
Kwal_27.125594143133706e-41
YHR030C (SLT2)4843013729e-41
CAGL0M11748g4473023691e-40
KLLA0B11902g4953013702e-40
KLLA0B11946g4393003593e-39
AGR048C4533023603e-39
AER232C5693013627e-39
Scas_680.204822953588e-39
YDL079C (MRK1)5013013404e-36
Scas_22.12482283249e-36
Scas_678.134622952912e-29
AEL230W6082942933e-29
Scas_711.157273022881e-28
YDR477W (SNF1)6332892862e-28
CAGL0G04455g7512202854e-28
Scas_660.286232852844e-28
YJL106W (IME2)6452462844e-28
Kwal_55.220013633072784e-28
Kwal_47.182335982852836e-28
KLLA0A03806g6022892836e-28
CAGL0M08910g6122852811e-27
CAGL0E01683g3753032751e-27
Kwal_26.72766462832774e-27
KLLA0E07414g3653132689e-27
Scas_673.20*7582052661e-25
ADL168C3623022582e-25
Scas_635.13783092574e-25
AFR076W8202772607e-25
KLLA0F02838g7552802582e-24
CAGL0K05709g11033032544e-24
YDR507C (GIN4)11423062511e-23
YCL024W (KCC4)10372032466e-23
Kwal_23.632515423002441e-22
CAGL0G02035g3392992353e-22
CAGL0J11638g7462472403e-22
KLLA0E03487g6472162393e-22
ABR014W9712292395e-22
AFR696C11423032395e-22
ADR204W3393112327e-22
ACR249C6433272377e-22
Scas_493.211173062379e-22
KLLA0F11143g8132912351e-21
Kwal_26.735514462962361e-21
Kwal_26.78619552982351e-21
CAGL0K02673g9152912342e-21
Kwal_47.180983743392292e-21
CAGL0I05896g7782202333e-21
KLLA0C01650g11123032333e-21
CAGL0C05005g10762882323e-21
Scas_668.228932002324e-21
YFR014C (CMK1)4462832294e-21
YHL007C (STE20)9392892314e-21
Scas_648.173403092265e-21
YJL095W (BCK1)14782872316e-21
KLLA0B13607g9892892299e-21
Kwal_0.964272892261e-20
KLLA0F16467g3403022231e-20
AFR092W14232082272e-20
Scas_700.546982902252e-20
Kwal_33.138317002252253e-20
AFR377C7262152253e-20
YAR019C (CDC15)9742842244e-20
Scas_698.373473032204e-20
KLLA0F14190g13381982245e-20
Scas_618.84272932216e-20
Scas_651.37932352226e-20
Scas_613.55172252201e-19
Kwal_55.217093402972171e-19
KLLA0F13552g12672022201e-19
YGL179C (TOS3)5602222192e-19
KLLA0C04191g7972922192e-19
KLLA0F23155g4272052172e-19
CAGL0K08514g14893122192e-19
YDL101C (DUN1)5133222172e-19
CAGL0F04741g4423002163e-19
KLLA0A05819g7042292173e-19
Scas_711.2515152012183e-19
CAGL0L03520g14472912173e-19
KLLA0C08525g15512122174e-19
YJL141C (YAK1)8073332164e-19
KLLA0E04136g3732562134e-19
CAGL0B02739g6763172164e-19
Scas_644.157262262155e-19
AER264C14832952165e-19
ABL034W14252852165e-19
ADL102C3723332125e-19
AEL118C6832302155e-19
KLLA0C06138g7082442155e-19
AER223C9021992156e-19
CAGL0M02233g7673062148e-19
ABL011C7012552139e-19
Kwal_55.203267502612139e-19
Scas_713.79832002131e-18
YCR073C (SSK22)13313062131e-18
CAGL0I05192g3733412091e-18
Kwal_26.87967962952121e-18
Kwal_26.778812671992121e-18
CAGL0L07326g5063012111e-18
AAR009W4531982092e-18
Kwal_33.139846492342102e-18
ACL006W7082022102e-18
Scas_707.315981522103e-18
Scas_616.1014611572094e-18
Kwal_56.224766972042076e-18
KLLA0A06820g7722272067e-18
Scas_653.256662092067e-18
KLLA0F11319g8432812068e-18
CAGL0K10604g4462852049e-18
Scas_201.1*2741922001e-17
AEL284C4792292031e-17
Scas_633.297893102041e-17
Kwal_26.89416612472041e-17
KLLA0E01584g4152252031e-17
Scas_720.9416832302042e-17
Scas_704.503693412012e-17
Kwal_33.131125052912022e-17
Scas_477.57033182032e-17
Kwal_26.87098292092023e-17
CAGL0M10153g8672232023e-17
Scas_651.198012262005e-17
Kwal_27.97734062421985e-17
KLLA0E06413g11612632005e-17
CAGL0M02299g8931952005e-17
KLLA0F08877g3211411965e-17
KLLA0C17160g8312561997e-17
YGL180W (ATG1)8973281988e-17
Scas_640.14*7282111988e-17
Scas_718.906471981988e-17
ACR142W8372871989e-17
Scas_700.348642651981e-16
CAGL0K12496g3602191951e-16
CAGL0K01661g4822011951e-16
CAGL0K12562g16821701972e-16
Scas_692.247181901962e-16
KLLA0D07304g4651951942e-16
CAGL0C02893g6492011942e-16
ADR174C6712081942e-16
YIL035C (CKA1)3722521923e-16
CAGL0J03828g4672161933e-16
YFL033C (RIM15)17701521943e-16
Kwal_55.215458652031943e-16
Scas_700.288961851943e-16
Scas_683.123561981904e-16
Scas_715.3411502621934e-16
KLLA0B13112g7302641926e-16
Kwal_23.35904992251916e-16
Kwal_33.144347592101917e-16
CAGL0G09020g3611931897e-16
Scas_660.209572181917e-16
Kwal_56.240593531931889e-16
Scas_690.133541931889e-16
Kwal_26.87518482251901e-15
ACR119W9312641901e-15
AFR335C10332161901e-15
Kwal_33.141678383091882e-15
CAGL0M09361g11442621882e-15
AFR724C4402911872e-15
AFL090W3461931852e-15
Scas_707.73762211862e-15
Kwal_27.97638682081872e-15
YDL025C6202041863e-15
YBL105C (PKC1)11511951873e-15
KLLA0D07348g9091941863e-15
Scas_685.245152091853e-15
CAGL0L06006g9423231863e-15
CAGL0J03872g6612171853e-15
KLLA0D03190g3721931834e-15
ADR317C8193161854e-15
CAGL0I06248g8132471854e-15
CAGL0E05720g3582231825e-15
ACR191C11492661855e-15
Scas_640.165052021828e-15
KLLA0B03586g7342521829e-15
AEL205W7932221811e-14
ACR133C8512031811e-14
KLLA0D08415g7741981811e-14
Scas_689.246451711811e-14
Scas_580.610152031811e-14
AER222C4232701791e-14
Kwal_47.183076212221802e-14
KLLA0C07535g6242211802e-14
ADL389W7112291802e-14
Kwal_27.1058111542051802e-14
Kwal_14.12493441371772e-14
CAGL0L11550g10722981802e-14
KLLA0F09020g9281511802e-14
Scas_703.57492291792e-14
ACL054W9723271792e-14
CAGL0F09075g7462291792e-14
KLLA0B12716g7161941792e-14
Kwal_33.141925771501783e-14
Kwal_26.76356911941783e-14
KLLA0B07205g4551901783e-14
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YDL108W
         (301 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YDL108W (KIN28) [761] chr4 (267698..267725,267807..268699) Cycli...   630   0.0  
Scas_613.13*                                                          565   0.0  
CAGL0H10318g complement(1006299..1007222) highly similar to sp|P...   552   0.0  
KLLA0E14828g complement(1323743..1324675) gi|27526973|emb|CAD369...   513   0.0  
ADL283W [1458] [Homologous to ScYDL108W (KIN28) - SH] complement...   504   0.0  
Kwal_23.3471                                                          428   e-153
KLLA0D11990g join(complement(1023928..1023944), gi|2499590|sp|Q9...   224   3e-72
CAGL0L12474g complement(1345044..1345952) highly similar to sp|P...   218   9e-70
Scas_568.9*                                                           216   6e-69
AGL242C [4070] [Homologous to ScYPL031C (PHO85) - SH] (246896..2...   216   1e-68
KLLA0B09790g complement(855327..856214) highly similar to sp|P00...   207   1e-65
ADR058C [1799] [Homologous to ScYBR160W (CDC28) - SH] (810941..8...   207   2e-65
Scas_721.46                                                           200   1e-62
YBR160W (CDC28) [345] chr2 (560034..560930) Cyclin-dependent pro...   199   2e-62
CAGL0H07535g 736241..737137 highly similar to sp|P00546 Saccharo...   199   2e-62
Scas_610.7                                                            197   4e-58
Kwal_27.11803                                                         184   5e-57
AFR205C [3397] [Homologous to ScYKL139W (CTK1) - SH] (805583..80...   186   2e-55
CAGL0I08349g complement(813728..815731) similar to sp|P23293 Sac...   187   3e-54
Scas_721.110                                                          183   6e-54
Kwal_26.7552                                                          181   9e-54
AFR019W [3211] [Homologous to ScYBL016W (FUS3) - SH] complement(...   179   1e-53
KLLA0E12177g 1080245..1081612 gi|4096112|gb|AAC99804.1 Kluyverom...   179   7e-53
Kwal_17.2687                                                          176   2e-52
Kwal_55.21900                                                         178   3e-51
CAGL0D02002g 207419..209080 similar to sp|Q03957 Saccharomyces c...   177   3e-51
ABR177C [770] [Homologous to ScYPR161C (SGV1) - SH] (735828..738...   179   3e-51
Kwal_27.11919                                                         167   5e-51
KLLA0D10527g 892955..894892 similar to sp|P23293 Saccharomyces c...   177   1e-50
Kwal_47.17868                                                         170   4e-50
Scas_710.28                                                           169   4e-50
KLLA0E10527g 929989..931104 similar to sp|P16892 Saccharomyces c...   168   2e-49
YBL016W (FUS3) [179] chr2 (192416..193477) Serine/threonine prot...   166   8e-49
CAGL0L06820g 767038..768138 highly similar to sp|P38615 Saccharo...   164   6e-48
CAGL0L12650g 1357789..1359492 similar to sp|P39073 Saccharomyces...   167   1e-47
CAGL0J04290g complement(400939..402012) similar to sp|P16892 Sac...   163   1e-47
Scas_623.11                                                           162   3e-47
KLLA0A02497g 218592..219680 highly similar to sp|P14681 Saccharo...   162   4e-47
Kwal_27.11830                                                         163   4e-46
KLLA0F17006g complement(1561859..1563106) gi|3127831|emb|CAA6115...   160   5e-46
ADR253W [1994] [Homologous to ScYMR139W (RIM11) - SH; ScYDL079C ...   158   1e-45
KLLA0D11814g complement(1007240..1009021) similar to sp|P39073 S...   162   2e-45
CAGL0J00539g 47095..48561 highly similar to sp|Q00772 Saccharomy...   159   4e-45
Kwal_14.1416                                                          156   5e-45
ACL191C [858] [Homologous to ScYGR040W (KSS1) - SH] (26475..2757...   153   1e-43
Scas_667.18                                                           154   2e-43
YGR040W (KSS1) [2006] chr7 (575400..576506) Serine/threonine pro...   152   3e-43
Scas_683.6                                                            151   6e-43
Scas_713.38                                                           151   2e-42
Scas_688.14                                                           151   3e-42
CAGL0D01694g complement(176981..178279) similar to sp|P41808 Sac...   150   4e-42
Kwal_56.23841                                                         150   5e-42
AGL249C [4063] [Homologous to ScYPL042C (SSN3) - SH] (234347..23...   152   5e-42
Kwal_23.5576                                                          151   6e-42
ADL315C [1426] [Homologous to ScYPR054W (SMK1) - SH] (146098..14...   149   1e-41
CAGL0K04169g 383738..384934 similar to sp|P14681 Saccharomyces c...   147   3e-41
KLLA0F20053g 1867209..1868543 highly similar to sp|P32485 Saccha...   148   3e-41
Kwal_27.12559                                                         147   6e-41
YHR030C (SLT2) [2317] chr8 complement(168882..170336) Serine/thr...   147   9e-41
CAGL0M11748g 1167306..1168649 highly similar to sp|P32485 Saccha...   146   1e-40
KLLA0B11902g 1041657..1043144 gi|7385125|gb|AAF61706.1|AF226711_...   147   2e-40
KLLA0B11946g complement(1048033..1049352) similar to sp|P41808 S...   142   3e-39
AGR048C [4358] [Homologous to ScYLR113W (HOG1) - SH] (807470..80...   143   3e-39
AER232C [2734] [Homologous to ScYHR030C - SH; ScYKL161C (SLT2) -...   144   7e-39
Scas_680.20                                                           142   8e-39
YDL079C (MRK1) [789] chr4 complement(312951..314044,314337..3147...   135   4e-36
Scas_22.1                                                             129   9e-36
Scas_678.13                                                           116   2e-29
AEL230W [2276] [Homologous to ScYDR477W (SNF1) - SH] complement(...   117   3e-29
Scas_711.15                                                           115   1e-28
YDR477W (SNF1) [1293] chr4 (1412361..1414262) Serine/threonine p...   114   2e-28
CAGL0G04455g 426386..428641 similar to sp|P32581 Saccharomyces c...   114   4e-28
Scas_660.28                                                           114   4e-28
YJL106W (IME2) [2809] chr10 (221307..223244) Serine/threonine pr...   114   4e-28
Kwal_55.22001                                                         111   4e-28
Kwal_47.18233                                                         113   6e-28
KLLA0A03806g complement(338807..340615) gi|2181934|emb|CAA61235....   113   6e-28
CAGL0M08910g complement(887703..889541) highly similar to sp|Q00...   112   1e-27
CAGL0E01683g complement(166584..167711) highly similar to sp|P21...   110   1e-27
Kwal_26.7276                                                          111   4e-27
KLLA0E07414g complement(672690..673787) highly similar to sp|P21...   107   9e-27
Scas_673.20*                                                          107   1e-25
ADL168C [1573] [Homologous to ScYNL307C (MCK1) - SH; ScYOL128C -...   103   2e-25
Scas_635.1                                                            103   4e-25
AFR076W [3268] [Homologous to ScYJL106W (IME2) - SH] complement(...   104   7e-25
KLLA0F02838g 264329..266596 some similarities with sp|P32581 Sac...   103   2e-24
CAGL0K05709g complement(555903..559214) similar to sp|Q12263 Sac...   102   4e-24
YDR507C (GIN4) [1321] chr4 complement(1462346..1465774) Serine/t...   101   1e-23
YCL024W (KCC4) [520] chr3 (79161..82274) Serine/threonine protei...    99   6e-23
Kwal_23.6325                                                           99   1e-22
CAGL0G02035g 179911..180930 highly similar to sp|P19454 Saccharo...    95   3e-22
CAGL0J11638g complement(1128620..1130860) highly similar to sp|P...    97   3e-22
KLLA0E03487g complement(323764..325707) similar to sgd|S0002874 ...    97   3e-22
ABR014W [605] [Homologous to ScYHL007C (STE20) - SH] complement(...    97   5e-22
AFR696C [3889] [Homologous to ScYDR507C (GIN4) - SH; ScYCL024W (...    97   5e-22
ADR204W [1945] [Homologous to ScYOR061W (CKA2) - SH] complement(...    94   7e-22
ACR249C [1296] [Homologous to ScYJL141C (YAK1) - SH] (797020..79...    96   7e-22
Scas_493.2                                                             96   9e-22
KLLA0F11143g complement(1026129..1028570) similar to sp|P22216 S...    95   1e-21
Kwal_26.7355                                                           96   1e-21
Kwal_26.7861                                                           95   1e-21
CAGL0K02673g complement(240509..243256) similar to sp|Q03497 Sac...    95   2e-21
Kwal_47.18098                                                          93   2e-21
CAGL0I05896g 560169..562505 some similarities with sp|P14680 Sac...    94   3e-21
KLLA0C01650g 128119..131457 similar to sp|Q12263 Saccharomyces c...    94   3e-21
CAGL0C05005g complement(467626..470856) similar to sp|P27636 Sac...    94   3e-21
Scas_668.22                                                            94   4e-21
YFR014C (CMK1) [1695] chr6 complement(172529..173869) Calcium/ca...    93   4e-21
YHL007C (STE20) [2279] chr8 complement(95113..97932) Serine/thre...    94   4e-21
Scas_648.17                                                            92   5e-21
YJL095W (BCK1) [2820] chr10 (247171..251607) Serine/threonine pr...    94   6e-21
KLLA0B13607g 1191592..1194561 weakly similar to sp|Q03497 Saccha...    93   9e-21
Kwal_0.96                                                              92   1e-20
KLLA0F16467g 1519800..1520822 highly similar to sp|P19454 Saccha...    91   1e-20
AFR092W [3284] [Homologous to ScYJL095W (BCK1) - SH] complement(...    92   2e-20
Scas_700.54                                                            91   2e-20
Kwal_33.13831                                                          91   3e-20
AFR377C [3569] [Homologous to ScYDR466W - SH] (1116595..1118775)...    91   3e-20
YAR019C (CDC15) [74] chr1 complement(172211..175135) MAP kinase ...    91   4e-20
Scas_698.37                                                            89   4e-20
KLLA0F14190g 1311121..1315137 gi|3021329|emb|CAA06336.1 Kluyvero...    91   5e-20
Scas_618.8                                                             90   6e-20
Scas_651.3                                                             90   6e-20
Scas_613.5                                                             89   1e-19
Kwal_55.21709                                                          88   1e-19
KLLA0F13552g complement(1252906..1256709) gi|33386566|emb|CAD877...    89   1e-19
YGL179C (TOS3) [1812] chr7 complement(163413..165095) Serine/thr...    89   2e-19
KLLA0C04191g 384198..386591 weakly similar to sp|P27636 Saccharo...    89   2e-19
KLLA0F23155g 2157146..2158429 similar to sp|P22517 Saccharomyces...    88   2e-19
CAGL0K08514g complement(853314..857783) similar to sp|P34244 Sac...    89   2e-19
YDL101C (DUN1) [768] chr4 complement(280307..281848) Protein kin...    88   2e-19
CAGL0F04741g 478256..479584 similar to sp|P22517 Saccharomyces c...    88   3e-19
KLLA0A05819g 541545..543659 similar to sp|P14680 Saccharomyces c...    88   3e-19
Scas_711.25                                                            89   3e-19
CAGL0L03520g complement(401103..405446) similar to sp|Q01389 Sac...    88   3e-19
KLLA0C08525g 744554..749209 similar to sp|P53599 Saccharomyces c...    88   4e-19
YJL141C (YAK1) [2777] chr10 complement(147885..150308) Serine/th...    88   4e-19
KLLA0E04136g 382874..383995 similar to sp|P15790 Saccharomyces c...    87   4e-19
CAGL0B02739g complement(262590..264620) similar to sp|P23561 Sac...    88   4e-19
Scas_644.15                                                            87   5e-19
AER264C [2766] [Homologous to ScYCR073C (SSK22) - SH; ScYNR031C ...    88   5e-19
ABL034W [558] [Homologous to ScYKL101W (HSL1) - SH] complement(3...    88   5e-19
ADL102C [1639] [Homologous to ScYIL035C (CKA1) - SH] (503670..50...    86   5e-19
AEL118C [2388] [Homologous to ScYKL168C (KKQ8) - SH; ScYJL165C (...    87   5e-19
KLLA0C06138g 540409..542535 similar to sp|P32562 Saccharomyces c...    87   5e-19
AER223C [2725] [Homologous to ScYAR019C (CDC15) - SH] (1044971.....    87   6e-19
CAGL0M02233g complement(267332..269635) highly similar to sp|P22...    87   8e-19
ABL011C [581] [Homologous to ScYLR362W (STE11) - SH] (378259..38...    87   9e-19
Kwal_55.20326                                                          87   9e-19
Scas_713.7                                                             87   1e-18
YCR073C (SSK22) [598] chr3 complement(242584..246579) Map kinase...    87   1e-18
CAGL0I05192g complement(493635..494756) highly similar to sp|P15...    85   1e-18
Kwal_26.8796                                                           86   1e-18
Kwal_26.7788                                                           86   1e-18
CAGL0L07326g 808532..810052 similar to sp|P39009 Saccharomyces c...    86   1e-18
AAR009W [195] [Homologous to ScYOL016C (CMK2) - SH; ScYFR014C (C...    85   2e-18
Kwal_33.13984                                                          86   2e-18
ACL006W [1043] [Homologous to ScYMR001C (CDC5) - SH] complement(...    86   2e-18
Scas_707.3                                                             86   3e-18
Scas_616.10                                                            85   4e-18
Kwal_56.22476                                                          84   6e-18
KLLA0A06820g complement(615686..618004) some similarities with s...    84   7e-18
Scas_653.25                                                            84   7e-18
KLLA0F11319g 1042436..1044967 similar to sgd|S0006071 Saccharomy...    84   8e-18
CAGL0K10604g complement(1029226..1030566) similar to sp|P27466 S...    83   9e-18
Scas_201.1*                                                            82   1e-17
AEL284C [2221] [Homologous to ScYGR052W - SH] (106480..107919) [...    83   1e-17
Scas_633.29                                                            83   1e-17
Kwal_26.8941                                                           83   1e-17
KLLA0E01584g 149713..150960 highly similar to sp|P39009 Saccharo...    83   1e-17
Scas_720.94                                                            83   2e-17
Scas_704.50                                                            82   2e-17
Kwal_33.13112                                                          82   2e-17
Scas_477.5                                                             83   2e-17
Kwal_26.8709                                                           82   3e-17
CAGL0M10153g complement(1010688..1013291) some similarities with...    82   3e-17
Scas_651.19                                                            82   5e-17
Kwal_27.9773                                                           81   5e-17
KLLA0E06413g complement(577669..581154) gi|22858696|gb|AAN05732....    82   5e-17
CAGL0M02299g 273725..276406 similar to tr|Q12152 Saccharomyces c...    82   5e-17
KLLA0F08877g 825217..826182 gi|27526975|emb|CAD36965.1 Kluyverom...    80   5e-17
KLLA0C17160g 1498959..1501454 similar to sp|P53104 Saccharomyces...    81   7e-17
YGL180W (ATG1) [1811] chr7 (160069..162762) Serine/threonine pro...    81   8e-17
Scas_640.14*                                                           81   8e-17
Scas_718.90                                                            81   8e-17
ACR142W [1189] [Homologous to ScYPL153C (RAD53) - SH] complement...    81   9e-17
Scas_700.34                                                            81   1e-16
CAGL0K12496g 1218391..1219473 similar to sp|P43568 Saccharomyces...    80   1e-16
CAGL0K01661g complement(146952..148400) some similarities with t...    80   1e-16
CAGL0K12562g 1234866..1239914 similar to sp|P43565 Saccharomyces...    80   2e-16
Scas_692.24                                                            80   2e-16
KLLA0D07304g 623352..624749 some similarities with sp|P32491 Sac...    79   2e-16
CAGL0C02893g complement(286017..287966) similar to tr|Q08732 Sac...    79   2e-16
ADR174C [1916] [Homologous to ScYOR267C - SH] (1008798..1010813)...    79   2e-16
YIL035C (CKA1) [2632] chr9 complement(287789..288907) Casein kin...    79   3e-16
CAGL0J03828g 362722..364125 similar to sp|P32490 Saccharomyces c...    79   3e-16
YFL033C (RIM15) [1651] chr6 complement(69113..74425) Serine/thre...    79   3e-16
Kwal_55.21545                                                          79   3e-16
Scas_700.28                                                            79   3e-16
Scas_683.12                                                            78   4e-16
Scas_715.34                                                            79   4e-16
KLLA0B13112g complement(1146006..1148198) similar to sp|P23561 S...    79   6e-16
Kwal_23.3590                                                           78   6e-16
Kwal_33.14434                                                          78   7e-16
CAGL0G09020g 860266..861351 highly similar to sp|P06245 Saccharo...    77   7e-16
Scas_660.20                                                            78   7e-16
Kwal_56.24059                                                          77   9e-16
Scas_690.13                                                            77   9e-16
Kwal_26.8751                                                           78   1e-15
ACR119W [1166] [Homologous to ScYPL141C - SH; ScYOR233W (KIN4) -...    78   1e-15
AFR335C [3527] [Homologous to ScYOL100W (PKH2) - SH; ScYDR490C (...    78   1e-15
Kwal_33.14167                                                          77   2e-15
CAGL0M09361g complement(928484..931918) highly similar to sp|P24...    77   2e-15
AFR724C [3917] [Homologous to ScYDR523C (SPS1) - SH] (1769897..1...    77   2e-15
AFL090W [3103] [Homologous to ScYPL203W (TPK2) - SH] complement(...    76   2e-15
Scas_707.7                                                             76   2e-15
Kwal_27.9763                                                           77   2e-15
YDL025C (YDL025C) [836] chr4 complement(405341..407203) Serine/t...    76   3e-15
YBL105C (PKC1) [98] chr2 complement(14241..17696) Protein kinase...    77   3e-15
KLLA0D07348g 626999..629728 weakly similar to sgd|S0006062 Sacch...    76   3e-15
Scas_685.24                                                            76   3e-15
CAGL0L06006g complement(670707..673535) similar to sp|P53104 Sac...    76   3e-15
CAGL0J03872g 365869..367854 similar to sp|Q01919 Saccharomyces c...    76   3e-15
KLLA0D03190g 267933..269051 highly similar to sp|P06245 Saccharo...    75   4e-15
ADR317C [2058] [Homologous to ScYDL028C (MPS1) - SH] (1263082..1...    76   4e-15
CAGL0I06248g 600351..602792 similar to sp|P38970 Saccharomyces c...    76   4e-15
CAGL0E05720g 569028..570104 similar to sp|P38991 Saccharomyces c...    75   5e-15
ACR191C [1238] [Homologous to ScYBL105C (PKC1) - SH] (680398..68...    76   5e-15
Scas_640.16                                                            75   8e-15
KLLA0B03586g complement(326871..329075) similar to sp|P11792 Sac...    75   9e-15
AEL205W [2301] [Homologous to ScYNL298W (CLA4) - SH; ScYOL113W (...    74   1e-14
ACR133C [1180] [Homologous to ScYPL150W - SH] (581468..584023) [...    74   1e-14
KLLA0D08415g 714473..716797 similar to sp|P22211 Saccharomyces c...    74   1e-14
Scas_689.24                                                            74   1e-14
Scas_580.6                                                             74   1e-14
AER222C [2724] [Homologous to ScYAR018C (KIN3) - SH] (1043479..1...    74   1e-14
Kwal_47.18307                                                          74   2e-14
KLLA0C07535g 658746..660620 some similarities with sgd|S0005793 ...    74   2e-14
ADL389W [1352] [Homologous to ScYHR205W (SCH9) - SH] complement(...    74   2e-14
Kwal_27.10581                                                          74   2e-14
Kwal_14.1249                                                           73   2e-14
CAGL0L11550g 1229719..1232937 similar to sp|P38692 Saccharomyces...    74   2e-14
KLLA0F09020g 836287..839073 weakly similar to sp|P43565 Saccharo...    74   2e-14
Scas_703.5                                                             74   2e-14
ACL054W [995] [Homologous to ScYGL180W (APG1) - SH] complement(2...    74   2e-14
CAGL0F09075g 894761..897001 similar to sp|P11792 Saccharomyces c...    74   2e-14
KLLA0B12716g 1109939..1112089 similar to sp|P12688 Saccharomyces...    74   2e-14
Kwal_33.14192                                                          73   3e-14
Kwal_26.7635                                                           73   3e-14
KLLA0B07205g complement(624606..625973) some similarities with s...    73   3e-14
AFL188C [3007] [Homologous to ScYDL101C (DUN1) - SH] (88793..902...    73   3e-14
YHR102W (KIC1) [2390] chr8 (316574..319816) Serine/threonine pro...    74   3e-14
AFR150C [3342] [Homologous to ScYFL029C (CAK1) - SH] (707306..70...    72   3e-14
Scas_598.6                                                             73   3e-14
Scas_651.18                                                            72   4e-14
Kwal_47.17252                                                          73   5e-14
CAGL0M08404g complement(836791..838179) some similarities with s...    72   5e-14
Kwal_33.13846                                                          72   5e-14
KLLA0E17127g complement(1515721..1518279) similar to sp|P38691 S...    72   6e-14
Scas_693.17                                                            72   6e-14
Kwal_14.1159                                                           72   7e-14
CAGL0I07513g 721775..725005 similar to sp|Q12236 Saccharomyces c...    72   7e-14
ACR218W [1265] [Homologous to ScYFL033C (RIM15) - SH] complement...    72   8e-14
KLLA0A07403g 661261..663900 similar to sp|P48562 Saccharomyces c...    72   8e-14
KLLA0F24618g complement(2288943..2290613) similar to sp|P38070 S...    72   8e-14
CAGL0M03729g complement(420316..422901) similar to sp|P48562 Sac...    72   9e-14
Kwal_56.22788                                                          72   1e-13
Kwal_56.22693                                                          72   1e-13
AFL101C [3094] [Homologous to ScYPL209C (IPL1) - SH] (249144..25...    70   1e-13
KLLA0E21780g complement(1936438..1939488) similar to sp|P38692 S...    71   2e-13
Kwal_14.1273                                                           70   2e-13
ACL104C [945] [Homologous to ScYHR102W (KIC1) - SH] (157357..160...    71   2e-13
Kwal_47.16761                                                          71   2e-13
CAGL0B01925g 176316..179150 similar to sp|P13185 Saccharomyces c...    71   2e-13
YHR205W (SCH9) [2490] chr8 (509361..511835) Serine/threonine pro...    71   2e-13
YDL159W (STE7) [712] chr4 (172482..174029) Serine/threonine/tyro...    71   2e-13
CAGL0K11550g 1118142..1119758 similar to sp|P28708 Saccharomyces...    70   2e-13
YFL029C (CAK1) [1654] chr6 complement(78053..79159) Cdk-activati...    70   2e-13
CAGL0I03498g 297344..298699 similar to sp|P06784 Saccharomyces c...    70   2e-13
CAGL0K04301g 404419..405486 similar to sp|P53233 Saccharomyces c...    70   2e-13
YJL164C (TPK1) [2757] chr10 complement(109959..111152) Catalytic...    70   3e-13
YDR283C (GCN2) [1112] chr4 complement(1025062..1030041) Serine/t...    70   3e-13
ABL028W [564] [Homologous to ScYKL126W (YPK1) - SH; ScYMR104C (Y...    70   3e-13
KLLA0E11979g complement(1060048..1061892) some similarities with...    70   3e-13
CAGL0J11308g 1097845..1100031 similar to sp|P22211 Saccharomyces...    70   3e-13
CAGL0I09504g 909319..910905 similar to sp|P38147 Saccharomyces c...    70   4e-13
Scas_678.24                                                            70   5e-13
Scas_700.35                                                            69   5e-13
Kwal_0.307                                                             69   5e-13
AEL115C [2391] [Homologous to ScYKL166C (TPK3) - SH; ScYJL164C (...    69   5e-13
AEL083W [2423] [Homologous to ScYBR028C - SH] complement(470964....    69   5e-13
ACR117W [1164] [Homologous to ScYOR231W (MKK1) - SH; ScYPL140C (...    69   5e-13
YCR008W (SAT4) [542] chr3 (128467..130278) Serine/threonine prot...    69   5e-13
CAGL0F03707g complement(359839..361665) similar to sp|Q08732 Sac...    69   6e-13
Scas_675.2                                                             69   6e-13
CAGL0K07458g complement(736336..738450) similar to sp|P12688 Sac...    69   7e-13
Kwal_56.24584                                                          69   7e-13
ACR281C [1328] [Homologous to ScYOL045W - SH; ScYAL017W (FUN31) ...    69   7e-13
YER129W (PAK1) [1559] chr5 (417277..420705) Protein kinase capab...    69   8e-13
YDR523C (SPS1) [1335] chr4 complement(1485554..1487026) Serine/t...    69   9e-13
Kwal_23.5290                                                           69   9e-13
AGR058W [4368] [Homologous to ScYLR096W (KIN2) - SH; ScYDR122W (...    69   9e-13
CAGL0H06259g 615045..619055 similar to sp|P31374 Saccharomyces c...    69   1e-12
KLLA0C00979g 73295..74746 similar to sp|P08458 Saccharomyces cer...    68   1e-12
KLLA0C16577g complement(1451181..1452695) some similarities with...    68   1e-12
Kwal_23.5668                                                           69   1e-12
CAGL0M08360g complement(833220..835520) some similarities with s...    69   1e-12
YGR052W (YGR052W) [2015] chr7 (593598..594707) Serine/threonine ...    68   1e-12
ADR313W [2054] [Homologous to ScYDL025C - SH] complement(1255932...    68   1e-12
Kwal_33.13222                                                          64   2e-12
CAGL0M11396g 1120559..1124137 similar to sp|P13186 Saccharomyces...    68   2e-12
CAGL0I04422g 394159..395427 some similarities with sp|P22209 Sac...    67   2e-12
CAGL0L07810g complement(857656..859446) similar to sp|P25333 Sac...    68   2e-12
Scas_655.2                                                             68   2e-12
Kwal_26.7682                                                           67   3e-12
Scas_502.2                                                             67   3e-12
Scas_689.25*                                                           67   3e-12
Scas_564.7                                                             67   3e-12
YDR466W (PKH3) [1284] chr4 (1395109..1397805) Serine/threonine p...    67   3e-12
CAGL0M02519g complement(290723..292993) highly similar to tr|Q03...    67   3e-12
KLLA0B02332g complement(206863..207948) similar to sp|P38991 Sac...    66   3e-12
YAL017W (PSK1) [51] chr1 (120228..124298) Serine/threonine prote...    67   4e-12
CAGL0D02244g complement(229504..230967) similar to sp|P24719 Sac...    67   4e-12
KLLA0F19536g 1808263..1811577 similar to sp|P13186 Saccharomyces...    67   4e-12
CAGL0F00913g 97023..100643 similar to sp|P31374 Saccharomyces ce...    67   4e-12
CAGL0C03509g complement(350846..353533) similar to sp|P53739 Sac...    67   4e-12
Scas_336.1                                                             66   5e-12
CAGL0K01617g complement(142479..144803) similar to sp|P54199 Sac...    67   5e-12
CAGL0K02167g complement(191468..194956) similar to sp|P38990 Sac...    67   5e-12
YBR274W (CHK1) [453] chr2 (749551..751134) Checkpoint kinase, re...    66   5e-12
KLLA0C04213g 386815..387999 similar to sp|P22209 Saccharomyces c...    66   5e-12
KLLA0F07623g 720246..723935 similar to sp|P31374 Saccharomyces c...    67   6e-12
KLLA0D12100g complement(1031728..1033161) some similarities with...    66   6e-12
YDR122W (KIN1) [969] chr4 (694694..697888) Serine/threonine prot...    66   7e-12
Scas_582.1                                                             66   8e-12
Scas_721.124                                                           66   9e-12
Scas_593.14d                                                           65   1e-11
AAL083W [104] [Homologous to ScYDR283C (GCN2) - SH] complement(1...    66   1e-11
CAGL0F03311g complement(327599..330736) similar to sp|P38691 Sac...    65   1e-11
KLLA0A02717g 245082..246380 some similarities with sp|P53233 Sac...    65   1e-11
Scas_584.11                                                            65   1e-11
CAGL0B04301g 420544..422172 similar to sp|P38070 Saccharomyces c...    65   1e-11
KLLA0C03938g complement(358851..360632) some similarities with s...    65   2e-11
YDL214C (PRR2) [660] chr4 complement(74447..76546) Serine/threon...    65   2e-11
KLLA0D07810g complement(669095..671251) gi|401646|sp|P31034|YL44...    65   2e-11
Kwal_26.7154                                                           65   2e-11
Kwal_33.14554                                                          65   2e-11
Kwal_26.8703                                                           65   2e-11
KLLA0C12485g 1060167..1062944 weakly similar to sp|Q12236 Saccha...    65   2e-11
Scas_627.7                                                             64   2e-11
Scas_628.9                                                             65   2e-11
YBR028C (YBR028C) [220] chr2 complement(294387..295964) Serine/t...    64   2e-11
AER195C [2697] [Homologous to ScYCR008W (SAT4) - SH] (1005431..1...    64   2e-11
Kwal_14.2497                                                           64   2e-11
Kwal_56.24091                                                          64   3e-11
CAGL0K03399g complement(310487..312598) highly similar to sp|P12...    64   3e-11
AFR035W [3227] [Homologous to ScYNL161W (CBK1) - SH] complement(...    64   3e-11
YDR490C (PKH1) [1306] chr4 complement(1431956..1434256) Serine/t...    64   3e-11
ADR163W [1905] [Homologous to ScYDR247W - SH; ScYPL026C (SKS1) -...    64   3e-11
CAGL0G04609g complement(437162..440059) similar to sp|Q12236 Sac...    64   3e-11
Scas_654.12                                                            64   3e-11
YDL028C (MPS1) [834] chr4 complement(400994..403288) Multi-funct...    64   3e-11
CAGL0H01199g 110610..115556 highly similar to sp|P15442 Saccharo...    64   3e-11
Scas_548.6                                                             64   4e-11
CAGL0J06072g complement(572377..574698) similar to sp|P53894 Sac...    64   4e-11
CAGL0J04972g 472984..474003 some similarities with tr|Q12100 Sac...    63   5e-11
Scas_619.5*                                                            63   5e-11
Scas_721.132                                                           63   6e-11
YCR091W (KIN82) [614] chr3 (274400..276562) Serine/threonine pro...    63   6e-11
Scas_643.20                                                            63   6e-11
CAGL0K00693g complement(74637..77267) similar to sp|P32944 Sacch...    63   7e-11
Scas_716.73                                                            62   9e-11
YAR018C (KIN3) [73] chr1 complement(170393..171700) Serine/threo...    62   9e-11
AFL217C [2978] [Homologous to ScYJL128C (PBS2) - SH] (30765..328...    63   9e-11
KLLA0C03828g 349187..351568 similar to sp|P54199 Saccharomyces c...    63   9e-11
KLLA0F01276g complement(120001..121560) similar to sp|P38147 Sac...    62   1e-10
KLLA0C14278g 1240990..1242615 similar to sp|P28708 Saccharomyces...    62   1e-10
Scas_568.13                                                            62   1e-10
Kwal_55.20221                                                          62   1e-10
Scas_677.18                                                            62   1e-10
Scas_634.5                                                             62   2e-10
ACR196C [1243] [Homologous to ScYDL159W (STE7) - SH] (692321..69...    62   2e-10
Scas_717.69                                                            61   2e-10
Kwal_27.11777                                                          61   2e-10
KLLA0C10802g complement(926916..931934) similar to sp|P15442 Sac...    62   2e-10
CAGL0I05390g complement(508677..510041) similar to sp|Q12505 Sac...    61   3e-10
KLLA0F01408g 135424..136302 weakly similar to sgd|S0002183 Sacch...    60   3e-10
Scas_721.61                                                            61   3e-10
KLLA0C18568g 1639958..1642282 gi|6967028|emb|CAB72435.1 Kluyvero...    61   3e-10
CAGL0G05720g complement(547617..549833) similar to sp|P22211 Sac...    61   3e-10
CAGL0L05632g 610481..612514 similar to sp|P08018 Saccharomyces c...    61   3e-10
Scas_713.21                                                            61   4e-10
KLLA0E15378g 1362851..1365025 some similarities with sp|P08018 S...    61   4e-10
YJL128C (PBS2) [2790] chr10 complement(178015..180021) MAP kinas...    61   4e-10
Kwal_23.6458                                                           61   4e-10
YJL187C (SWE1) [2737] chr10 complement(76802..79261) Serine/tyro...    61   4e-10
YJL165C (HAL5) [2756] chr10 complement(106887..109454) Serine/th...    61   4e-10
Kwal_33.13681                                                          60   4e-10
Scas_629.16                                                            61   4e-10
CAGL0H01639g 158967..160532 similar to sp|P08458 Saccharomyces c...    60   5e-10
YHR079C (IRE1) [2368] chr8 complement(258245..261592) Protein ki...    60   6e-10
Scas_544.6                                                             60   7e-10
YHR082C (KSP1) [2372] chr8 complement(268460..271549) Serine/thr...    60   8e-10
Kwal_56.23717                                                          60   8e-10
ADR300C [2042] [Homologous to ScYHR082C (KSP1) - SH] (1222346..1...    60   9e-10
ABL143C [449] [Homologous to ScYNL183C (NPR1) - SH; ScYDL214C (P...    60   9e-10
KLLA0F23507g complement(2198603..2200066) similar to sp|P24719 S...    59   1e-09
CAGL0K06479g 636296..639271 some similarities with tr|Q03306 Sac...    59   1e-09
Kwal_55.20189                                                          59   2e-09
Kwal_0.155                                                             58   3e-09
Scas_602.11                                                            58   3e-09
Kwal_23.4276                                                           58   3e-09
KLLA0B07579g 659591..661759 weakly similar to sp|P32944 Saccharo...    57   4e-09
AEL179W [2327] [Homologous to NOHBY] complement(302948..303817) ...    56   5e-09
Scas_707.34                                                            57   6e-09
CAGL0K11275g 1093797..1095374 similar to tr|Q03785 Saccharomyces...    57   7e-09
YDR247W (VHS1) [1081] chr4 (956005..957390) Serine/threonine pro...    57   8e-09
KLLA0A09713g 851952..853625 similar to sp|Q03533 Saccharomyces c...    57   8e-09
Scas_716.33                                                            57   8e-09
AEL185C [2321] [Homologous to ScYBR274W (CHK1) - SH] (291129..29...    57   9e-09
AGR334W [4645] [Homologous to ScYMR291W - SH] complement(1354612...    56   9e-09
ADR167W [1909] [Homologous to ScYNR047W - SH; ScYCR091W (KIN82) ...    57   1e-08
KLLA0F26983g 2489326..2490729 some similarities with sp|P32801 S...    56   1e-08
Scas_705.23                                                            56   1e-08
Scas_707.36                                                            56   1e-08
ADL043C [1698] [Homologous to ScYLL019C (KNS1) - SH] (612091..61...    56   2e-08
Kwal_33.14081                                                          55   2e-08
Kwal_47.17263                                                          55   2e-08
CAGL0H09152g complement(895722..898055) similar to sp|P47116 Sac...    55   2e-08
KLLA0D14905g 1256065..1257768 gi|28565036|gb|AAO32601.1 Kluyvero...    55   3e-08
ADR033W [1774] [Homologous to ScYGR092W (DBF2) - SH; ScYPR111W (...    55   3e-08
ADR293C [2034] [Homologous to ScYHR079C (IRE1) - SH] (1207023..1...    55   3e-08
YGR092W (DBF2) [2052] chr7 (668191..669909) Serine/threonine pro...    55   3e-08
ACL053C [996] [Homologous to ScYER129W (PAK1) - SH; ScYGL179C (T...    55   4e-08
KLLA0D09328g complement(788565..791705) some similarities with s...    55   4e-08
CAGL0B04147g 402798..404498 highly similar to sp|P22204 Saccharo...    54   4e-08
ADR379C [2120] [Homologous to ScYOR351C (MEK1) - SH] (1386601..1...    54   4e-08
Scas_720.103                                                           54   5e-08
YIL095W (PRK1) [2580] chr9 (183934..186366) Serine/threonine pro...    54   5e-08
Scas_601.6                                                             54   5e-08
ABL055C [537] [Homologous to ScYKL116C (PRR1) - SH] (295497..297...    54   7e-08
CAGL0F03245g complement(316924..320034) similar to sp|P32361 Sac...    54   7e-08
CAGL0H01837g complement(176352..178736) tr|Q9C1R8 Candida glabra...    54   7e-08
Kwal_23.3992                                                           54   9e-08
CAGL0D06600g 626571..628748 similar to tr|Q12399 Saccharomyces c...    54   1e-07
Scas_618.15                                                            53   1e-07
Scas_671.16                                                            53   1e-07
ADL217W [1524] [Homologous to ScYIL095W (PRK1) - SH; ScYNL020C (...    52   2e-07
Scas_703.47                                                            52   2e-07
AGR027C [4337] [Homologous to ScYBR059C (AKL1) - SH] (763309..76...    52   2e-07
AAL029W [158] [Homologous to ScYLR248W (RCK2) - SH; ScYGL158W (R...    52   3e-07
Scas_573.10                                                            52   3e-07
KLLA0F12188g 1122745..1124385 similar to sp|P38623 Saccharomyces...    52   4e-07
CAGL0F00649g 71961..73505 similar to sp|P38623 Saccharomyces cer...    51   4e-07
YGL158W (RCK1) [1831] chr7 (207036..208574) Serine/threonine pro...    51   4e-07
CAGL0G03047g 282299..283918 highly similar to sp|P22204 Saccharo...    51   5e-07
CAGL0J03432g 327428..329296 similar to sp|P53974 Saccharomyces c...    50   1e-06
KLLA0D13266g complement(1137750..1141208) similar to sp|P32361 S...    50   1e-06
CAGL0F03905g complement(377962..380088) similar to sp|Q03656 Sac...    50   1e-06
Kwal_47.17345                                                          49   2e-06
CAGL0M13541g 1332296..1334164 similar to sp|Q03533 Saccharomyces...    49   2e-06
Scas_584.8                                                             49   2e-06
Scas_673.34*                                                           49   2e-06
CAGL0G02607g complement(240244..242310) similar to sp|P40494 Sac...    49   3e-06
Scas_690.12                                                            48   4e-06
Kwal_27.11542                                                          48   6e-06
AEL149C [2357] [Homologous to ScYJL187C (SWE1) - SH] (348350..35...    48   6e-06
Scas_697.12                                                            47   8e-06
Scas_695.33                                                            47   9e-06
Scas_684.28                                                            47   1e-05
AFL091W [3102] [Homologous to ScYPL204W (HRR25) - SH] complement...    46   2e-05
Kwal_27.9804                                                           46   2e-05
YDL017W (CDC7) [843] chr4 (424206..425729) Protein kinase that a...    46   2e-05
Kwal_56.24064                                                          45   4e-05
Scas_720.24                                                            45   4e-05
Kwal_27.10004                                                          45   5e-05
KLLA0F22297g complement(2083448..2085547) some similarities with...    45   6e-05
KLLA0F18612g 1711131..1713575 some similarities with sp|P38080 S...    45   6e-05
CAGL0J05940g 560563..562023 similar to sp|P23291 Saccharomyces c...    44   7e-05
KLLA0E08371g complement(756205..758538) similar to sp|P40494 Sac...    45   7e-05
KLLA0C04345g 397899..399326 similar to sp|P06243 Saccharomyces c...    44   7e-05
CAGL0G06138g complement(585585..587204) similar to sp|P23291 Sac...    44   8e-05
AER216C [2718] [Homologous to ScYDL017W (CDC7) - SH] (1032840..1...    44   8e-05
CAGL0K01815g 162144..163658 similar to sp|P06243 Saccharomyces c...    44   8e-05
CAGL0H03553g complement(328668..330155) highly similar to sp|P29...    44   9e-05
Scas_718.72                                                            44   1e-04
Kwal_26.9032                                                           44   1e-04
Kwal_56.24274                                                          43   2e-04
CAGL0B03509g complement(349638..351431) similar to sp|P38623 Sac...    43   2e-04
YBR059C (AKL1) [250] chr2 complement(356821..360147) Serine/thre...    43   2e-04
AER348C [2849] [Homologous to ScYMR216C (SKY1) - SH] (1275897..1...    43   2e-04
Scas_653.33                                                            43   3e-04
KLLA0D03168g 265761..267278 some similarities with sp|P29295 Sac...    42   3e-04
YHR135C (YCK1) [2422] chr8 complement(372695..374311) Casein kin...    42   4e-04
Kwal_27.10945                                                          42   7e-04
Scas_661.27                                                            42   7e-04
Scas_649.30                                                            41   8e-04
Kwal_26.8347                                                           41   0.001
Scas_654.17                                                            41   0.001
YER123W (YCK3) [1553] chr5 (404809..406383) Casein kinase I isof...    40   0.001

>YDL108W (KIN28) [761] chr4 (267698..267725,267807..268699)
           Cyclin-dependent serine/threonine protein kinase,
           component of TFIIK subcomplex of transcription factor
           TFIIH, phosphorylates C-terminal domain (CTD) of Rpo21p
           [921 bp, 306 aa]
          Length = 306

 Score =  630 bits (1625), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/301 (100%), Positives = 301/301 (100%)

Query: 1   MKVNMEYTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQE 60
           MKVNMEYTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQE
Sbjct: 1   MKVNMEYTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQE 60

Query: 61  MQHPNVIELIDIFMAYDNLNLVLEFLPTDLEVVIKDKSILFTPADIKAWMLMTLRGVYHC 120
           MQHPNVIELIDIFMAYDNLNLVLEFLPTDLEVVIKDKSILFTPADIKAWMLMTLRGVYHC
Sbjct: 61  MQHPNVIELIDIFMAYDNLNLVLEFLPTDLEVVIKDKSILFTPADIKAWMLMTLRGVYHC 120

Query: 121 HRNFILHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAK 180
           HRNFILHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAK
Sbjct: 121 HRNFILHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAK 180

Query: 181 HYTSAIDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWPEVSSFMTYNK 240
           HYTSAIDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWPEVSSFMTYNK
Sbjct: 181 HYTSAIDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWPEVSSFMTYNK 240

Query: 241 LQIYPPPSRDELRKRFIAASEYALDFMCGMLTMNPQKRWTAVQCLESDYFKELPPPSDPS 300
           LQIYPPPSRDELRKRFIAASEYALDFMCGMLTMNPQKRWTAVQCLESDYFKELPPPSDPS
Sbjct: 241 LQIYPPPSRDELRKRFIAASEYALDFMCGMLTMNPQKRWTAVQCLESDYFKELPPPSDPS 300

Query: 301 S 301
           S
Sbjct: 301 S 301

>Scas_613.13*
          Length = 312

 Score =  565 bits (1456), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/295 (88%), Positives = 285/295 (96%)

Query: 6   EYTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEMQHPN 65
           EYTK KKVGEGTYAVVYLG + STGR+IA+KEIKTSEFKDGLDMSAIREVKYLQE+QH N
Sbjct: 13  EYTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIREVKYLQEIQHDN 72

Query: 66  VIELIDIFMAYDNLNLVLEFLPTDLEVVIKDKSILFTPADIKAWMLMTLRGVYHCHRNFI 125
           VIEL+DIFMAYDNLNLVLEFLP+DLEV+IKD+SILFTPADIK+WMLMTLRGV+HCHRNFI
Sbjct: 73  VIELVDIFMAYDNLNLVLEFLPSDLEVIIKDRSILFTPADIKSWMLMTLRGVHHCHRNFI 132

Query: 126 LHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKHYTSA 185
           LHRDLKPNNLL SPDG IKVADFGLARA+P+PHE+LTSNVVTRWYRAPELLFGAKHYTSA
Sbjct: 133 LHRDLKPNNLLLSPDGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELLFGAKHYTSA 192

Query: 186 IDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWPEVSSFMTYNKLQIYP 245
           IDIWSVGVIFAELMLRIPYLPGQND+DQMEVTFRALGTPTD++WPEVSSF +YNKLQIYP
Sbjct: 193 IDIWSVGVIFAELMLRIPYLPGQNDIDQMEVTFRALGTPTDKEWPEVSSFGSYNKLQIYP 252

Query: 246 PPSRDELRKRFIAASEYALDFMCGMLTMNPQKRWTAVQCLESDYFKELPPPSDPS 300
           PPS DELRKRFIAASE AL+FMCGMLTMNP+KRW A++CLES+YFKE+PPPSDPS
Sbjct: 253 PPSIDELRKRFIAASENALNFMCGMLTMNPKKRWNAIECLESEYFKEMPPPSDPS 307

>CAGL0H10318g complement(1006299..1007222) highly similar to
           sp|P06242 Saccharomyces cerevisiae YDL108w KIN28
           cyclin-dependent ser/thr protein kinase, hypothetical
           start
          Length = 307

 Score =  552 bits (1422), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 253/296 (85%), Positives = 283/296 (95%)

Query: 6   EYTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEMQHPN 65
           EYTKEKKVGEGTYAVVY+G + STGR+IA+KEIKTSEFKDGLDMSAIREVKYLQEMQH N
Sbjct: 5   EYTKEKKVGEGTYAVVYVGTKQSTGRRIAVKEIKTSEFKDGLDMSAIREVKYLQEMQHVN 64

Query: 66  VIELIDIFMAYDNLNLVLEFLPTDLEVVIKDKSILFTPADIKAWMLMTLRGVYHCHRNFI 125
           VIEL+DIFM+Y NLNLVLE+LPTDLEVVIKDKSILFTPADIK+WMLM++RGV+HCHRNFI
Sbjct: 65  VIELVDIFMSYGNLNLVLEYLPTDLEVVIKDKSILFTPADIKSWMLMSVRGVHHCHRNFI 124

Query: 126 LHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKHYTSA 185
           LHRDLKPNNLL +PDGQIKVADFGLARA+P+PHE+LTSNVVTRWYRAPELLFGAKHYTSA
Sbjct: 125 LHRDLKPNNLLIAPDGQIKVADFGLARAVPSPHEVLTSNVVTRWYRAPELLFGAKHYTSA 184

Query: 186 IDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWPEVSSFMTYNKLQIYP 245
           ID+WS+GVIFAELMLRIPYLPGQND++QMEVTFRALGTPTD+DWPEVSSF +YNKLQ+YP
Sbjct: 185 IDVWSLGVIFAELMLRIPYLPGQNDLEQMEVTFRALGTPTDKDWPEVSSFNSYNKLQMYP 244

Query: 246 PPSRDELRKRFIAASEYALDFMCGMLTMNPQKRWTAVQCLESDYFKELPPPSDPSS 301
           PPSRDELRKRFIAA+E AL+FM GM+ +NP KRW+  QCLES+YFKELP PSDP++
Sbjct: 245 PPSRDELRKRFIAATENALNFMNGMMCLNPAKRWSTAQCLESEYFKELPRPSDPAT 300

>KLLA0E14828g complement(1323743..1324675)
           gi|27526973|emb|CAD36964.1 Kluyveromyces lactis
           serine/threonine-protein kinase KIN28, start by
           similarity
          Length = 310

 Score =  513 bits (1321), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 232/294 (78%), Positives = 270/294 (91%)

Query: 6   EYTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEMQHPN 65
           +YTKEKK GEGTYAVVYLG + STGR IA+KEIKTS+FKDGLDMSA+REVK+LQE++H N
Sbjct: 9   DYTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALREVKFLQELKHVN 68

Query: 66  VIELIDIFMAYDNLNLVLEFLPTDLEVVIKDKSILFTPADIKAWMLMTLRGVYHCHRNFI 125
           VIEL+D+FMA DNLNLVLEFLP DLE++IKD SI+F+PADIK+W+LMTLRGV+HCHRNFI
Sbjct: 69  VIELVDVFMANDNLNLVLEFLPADLEIIIKDTSIMFSPADIKSWILMTLRGVHHCHRNFI 128

Query: 126 LHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKHYTSA 185
           LHRDLKPNNLL +PDGQ+K+ADFGLAR + +P EILTSNVVTRWYRAPELLFGAKHYTSA
Sbjct: 129 LHRDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELLFGAKHYTSA 188

Query: 186 IDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWPEVSSFMTYNKLQIYP 245
           +DIWSVGVIFAELMLRIPYLPG++DVDQ+ VTFRALGTPTD DWPEVSSF  YNK+QIYP
Sbjct: 189 VDIWSVGVIFAELMLRIPYLPGKDDVDQINVTFRALGTPTDADWPEVSSFSNYNKIQIYP 248

Query: 246 PPSRDELRKRFIAASEYALDFMCGMLTMNPQKRWTAVQCLESDYFKELPPPSDP 299
           PPSR+ELR+RFIAA+E AL+ + GM+ MNP+KRW AV+CL+S YF+ELP P+ P
Sbjct: 249 PPSREELRRRFIAATENALELISGMMIMNPKKRWDAVKCLQSQYFQELPEPTLP 302

>ADL283W [1458] [Homologous to ScYDL108W (KIN28) - SH]
           complement(205175..205199,205252..206147) [921 bp, 306
           aa]
          Length = 306

 Score =  504 bits (1298), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 229/296 (77%), Positives = 267/296 (90%)

Query: 5   MEYTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEMQHP 64
           + YTKEKKVGEGTYAVVYLG + + GR+IAIKEIKTS+FKDGLDMSAIREVKYLQE++H 
Sbjct: 4   VNYTKEKKVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYLQEIRHA 63

Query: 65  NVIELIDIFMAYDNLNLVLEFLPTDLEVVIKDKSILFTPADIKAWMLMTLRGVYHCHRNF 124
           NVIEL+D+FMA +NLNLVLEFLP DLE++IKD S+LFT ADIK+W+LMTLRGV+HCHR+F
Sbjct: 64  NVIELVDLFMAQENLNLVLEFLPADLEMLIKDSSLLFTQADIKSWLLMTLRGVHHCHRSF 123

Query: 125 ILHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKHYTS 184
           ILHRDLKPNNLL +PDGQ+K+ADFGLAR + APHE +TSNVVTRWYRAPELLFGA+HYT+
Sbjct: 124 ILHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFGARHYTA 183

Query: 185 AIDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWPEVSSFMTYNKLQIY 244
           A+D+WSVGVIFAELMLRIPYLPG++DVDQ++VTFRALGTPTD+DWPEVSSF  YNK+Q+Y
Sbjct: 184 AVDLWSVGVIFAELMLRIPYLPGRDDVDQIDVTFRALGTPTDKDWPEVSSFSAYNKIQVY 243

Query: 245 PPPSRDELRKRFIAASEYALDFMCGMLTMNPQKRWTAVQCLESDYFKELPPPSDPS 300
           PPPSR ELR RFIAA+E ALD MCGMLTM+P KRW   +CL S YF ELP  + P+
Sbjct: 244 PPPSRSELRSRFIAATENALDLMCGMLTMDPHKRWDTTRCLLSQYFVELPEATPPT 299

>Kwal_23.3471
          Length = 260

 Score =  428 bits (1101), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 195/252 (77%), Positives = 229/252 (90%)

Query: 49  MSAIREVKYLQEMQHPNVIELIDIFMAYDNLNLVLEFLPTDLEVVIKDKSILFTPADIKA 108
           MSAIREVKYLQE++H NVIELID++MA  NLNLVLEFLP DLE++IKD SILFT ADIK+
Sbjct: 1   MSAIREVKYLQEIRHVNVIELIDVYMAQSNLNLVLEFLPADLEMIIKDNSILFTQADIKS 60

Query: 109 WMLMTLRGVYHCHRNFILHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTR 168
           W+LMTLRGV+HCHRNFILHRDLKPNNLL +PDGQ+K+ADFGLAR + +P ++LTSNVVTR
Sbjct: 61  WLLMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDMLTSNVVTR 120

Query: 169 WYRAPELLFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRD 228
           WYRAPELLFGAKHYT AID+WSVGVIFAELMLRIPYLPG++D+DQ++VTFRALGTPTD+D
Sbjct: 121 WYRAPELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDDIDQIDVTFRALGTPTDKD 180

Query: 229 WPEVSSFMTYNKLQIYPPPSRDELRKRFIAASEYALDFMCGMLTMNPQKRWTAVQCLESD 288
           WPE+S+F TYNK+Q YPPPSR+E+R+RFIAA+E AL+ M GMLTMNP KRW  +QCL S+
Sbjct: 181 WPEISTFGTYNKIQFYPPPSREEMRRRFIAATENALNLMDGMLTMNPHKRWDPIQCLTSE 240

Query: 289 YFKELPPPSDPS 300
           YF ELP P+ PS
Sbjct: 241 YFVELPVPTTPS 252

>KLLA0D11990g join(complement(1023928..1023944),
           gi|2499590|sp|Q92241|PH85_KLULA Kluyveromyces lactis
           NEGATIVE REGULATOR OF THE PHO SYSTEM, hypothetical start
          Length = 304

 Score =  224 bits (572), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 114/297 (38%), Positives = 176/297 (59%), Gaps = 13/297 (4%)

Query: 6   EYTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEMQHPN 65
           ++ + +KVG GTYA VY G   +TG  +A+KE+K    ++G   +AIRE+  ++E++H N
Sbjct: 6   QFKQLEKVGNGTYATVYKGLNKTTGVYVALKEVKLDS-EEGTPSTAIREISLMKELKHDN 64

Query: 66  VIELIDIFMAYDNLNLVLEFLPTDLEVVIKDKSILFTPAD-----IKAWMLMTLRGVYHC 120
           ++ L D+    + L LV EF+  DL+  + +++   +        +K +    L+GV  C
Sbjct: 65  IVRLFDVIHTENKLTLVFEFMDNDLKKFMDNRNKGNSHKGLEMDLVKYFQWQLLQGVAFC 124

Query: 121 HRNFILHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAK 180
           H N ILHRDLKP NLL +  GQ+K+ DFGLARA   P    +S VVT WYRAP++L G++
Sbjct: 125 HENRILHRDLKPQNLLINNRGQLKLGDFGLARAFGIPVNTFSSEVVTLWYRAPDVLMGSR 184

Query: 181 HYTSAIDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWPEVSSFMTYNK 240
           +Y ++IDIWS G I AE+++  P  PG ND +Q+++ F  +GTP ++ WP+V+    YN 
Sbjct: 185 NYCTSIDIWSCGCILAEMIMGKPLFPGSNDEEQLKLIFDTMGTPVEQTWPQVTQLAKYNP 244

Query: 241 LQIYPPPSRDELRKRFIAASEYAL-----DFMCGMLTMNPQKRWTAVQCLESDYFKE 292
           L   PP    +L++     +E  L     D + G+L +NP  R +A   L   +F E
Sbjct: 245 L--LPPHMPRDLKQLLQNNTEEVLDDNVVDLLHGLLQLNPDARLSAKDALNHPWFAE 299

>CAGL0L12474g complement(1345044..1345952) highly similar to
           sp|P17157 Saccharomyces cerevisiae YPL031c
           cyclin-dependent protein kinase, start by similarity
          Length = 302

 Score =  218 bits (556), Expect = 9e-70,   Method: Compositional matrix adjust.
 Identities = 113/295 (38%), Positives = 172/295 (58%), Gaps = 9/295 (3%)

Query: 6   EYTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEMQHPN 65
           ++ + +K+G GTYA VY G   STG  +A+KE+K    ++G   +AIRE+  ++E++H N
Sbjct: 5   QFKQLEKLGNGTYATVYKGLNKSTGVYVALKEVKLDS-EEGTPSTAIREISLMKELKHDN 63

Query: 66  VIELIDIFMAYDNLNLVLEFLPTDLEVVIKDKSILFTPAD-----IKAWMLMTLRGVYHC 120
           ++ L D+    + L LV E++  DL+  +  +++   P       +K +    L G+  C
Sbjct: 64  IVRLYDVIHTENKLTLVFEYMDNDLKKYMDSRTVGNAPRGLEMNLVKYFQWQLLEGLAFC 123

Query: 121 HRNFILHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAK 180
           H N ILHRDLKP NLL +  GQ+K+ DFGLARA   P    +S VVT WYRAP++L G++
Sbjct: 124 HENKILHRDLKPQNLLITKRGQLKLGDFGLARAFGIPVNTFSSEVVTLWYRAPDVLMGSR 183

Query: 181 HYTSAIDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWPEVSSFMTYNK 240
            Y+++IDIWS G I AE++   P  PG ND +Q+++ F  +GTP +  WP V+S   YN 
Sbjct: 184 TYSTSIDIWSCGCILAEMITGKPLFPGTNDEEQLKLIFDKMGTPNETTWPGVTSLPKYNP 243

Query: 241 --LQIYPPPSRDELRKRFIA-ASEYALDFMCGMLTMNPQKRWTAVQCLESDYFKE 292
              Q  P   + EL+        +  +D + G+L +NP  R +A Q L   +F E
Sbjct: 244 NFQQRLPKDLKAELQPYVKEPLDDNVIDLLHGLLQLNPDMRLSAKQALLHPWFSE 298

>Scas_568.9*
          Length = 306

 Score =  216 bits (551), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 116/308 (37%), Positives = 176/308 (57%), Gaps = 16/308 (5%)

Query: 7   YTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEMQHPNV 66
           + + +K+G GTYA VY G   +TG  +A+KE+K    ++G   +AIRE+  ++E++H N+
Sbjct: 2   FKQLEKLGNGTYATVYKGLNKTTGAYVALKEVKLDS-EEGTPSTAIREISLMKELKHENI 60

Query: 67  IELIDIFMAYDNLNLVLEFLPTDLEVVIKDKSILFTPAD-----IKAWMLMTLRGVYHCH 121
           + L D+    + L LV E++  DL+  +  +++  +P       +K +    L G+  CH
Sbjct: 61  VRLYDVIHTENKLTLVFEYMDNDLKKYMDSRTVGNSPRGLELNLVKYFQWQLLEGLAFCH 120

Query: 122 RNFILHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKH 181
            N ILHRDLKP NLL +  G +K+ DFGLARA   P    +S VVT WYRAP++L G++ 
Sbjct: 121 ENKILHRDLKPQNLLINKKGALKLGDFGLARAFGIPVNTFSSEVVTLWYRAPDVLMGSRT 180

Query: 182 YTSAIDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWPEVSSFMTYNKL 241
           Y+++IDIWS G I AE++   P  PG ND +Q+++ F  +GTPT+  WP VS+   YN  
Sbjct: 181 YSTSIDIWSCGCILAEMITGKPLFPGSNDEEQLKLIFETMGTPTEATWPGVSALPKYNP- 239

Query: 242 QIYPPPSRDELRKRFIAASEYAL-----DFMCGMLTMNPQKRWTAVQCLESDYFKEL--- 293
             +P     +LR       +  L     D + G+L +NP  R +A Q L   +F E    
Sbjct: 240 -NFPQRLPKDLRMVLQPYCKEPLDDNVIDLLHGLLQLNPDMRLSAKQALHHPWFAEYYQH 298

Query: 294 PPPSDPSS 301
             P+ PSS
Sbjct: 299 YTPAPPSS 306

>AGL242C [4070] [Homologous to ScYPL031C (PHO85) - SH]
           (246896..247790,247838..247854) [912 bp, 303 aa]
          Length = 303

 Score =  216 bits (549), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 111/297 (37%), Positives = 174/297 (58%), Gaps = 9/297 (3%)

Query: 4   NMEYTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEMQH 63
           ++ + + +++G GTYA VY G   +TG  +A+KE+K    ++G   +AIRE+  ++E++H
Sbjct: 6   HIRFKQLERLGNGTYATVYKGLNKTTGLYVALKEVKLDS-EEGTPSTAIREISLMKELKH 64

Query: 64  PNVIELIDIFMAYDNLNLVLEFLPTDLEVVIKDKSILFTPAD-----IKAWMLMTLRGVY 118
            N++ L D+    + L LV EF+  DL+  +  +     P       +K +    L+GV 
Sbjct: 65  ENIVRLYDVIHTENKLTLVFEFMDNDLKKFMDSRLDREMPRGLELSLVKYFQWQLLQGVA 124

Query: 119 HCHRNFILHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFG 178
            CH N ILHRDLKP NLL +  GQ+K+ DFGLARA   P    +S VVT WYRAP++L G
Sbjct: 125 FCHENRILHRDLKPQNLLINNKGQLKLGDFGLARAFGIPVNTFSSEVVTLWYRAPDVLMG 184

Query: 179 AKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWPEVSSFMTY 238
           ++ Y ++IDIWS G I AE+++     PG ND +Q+++ F  +GTPT++ W  VS    Y
Sbjct: 185 SRTYCTSIDIWSCGCILAEMIMGKALFPGTNDDEQLKLIFETMGTPTEQTWVGVSQLPKY 244

Query: 239 N-KLQIYPPPSRDELRKRFIAA--SEYALDFMCGMLTMNPQKRWTAVQCLESDYFKE 292
           N ++ +YP     +L +       S+  ++ + G+L +NP  R +A Q L    F+E
Sbjct: 245 NPQIPLYPNKDIKQLLQATTKEQISDVLVNLIQGLLQLNPSMRLSAQQALSHPLFEE 301

>KLLA0B09790g complement(855327..856214) highly similar to sp|P00546
           Saccharomyces cerevisiae YBR160w CDC28 cyclin-dependent
           protein kinase, start by similarity
          Length = 295

 Score =  207 bits (528), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 111/292 (38%), Positives = 169/292 (57%), Gaps = 10/292 (3%)

Query: 7   YTKEKKVGEGTYAVVYLGCQ-HSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEMQHPN 65
           Y + +KVGEGTY VVY         R +A+K+I+     +G+  +AIRE+  L+E++  N
Sbjct: 7   YKRLEKVGEGTYGVVYKAVDLRHQNRVVAMKKIRLESEDEGVPSTAIREISLLKELKDDN 66

Query: 66  VIELIDIFMA-YDNLNLVLEFLPTDL----EVVIKDKSILFTPADIKAWMLMTLRGVYHC 120
           ++ L DI  +    L LV EFL  DL    E + KD+ +      IK +M+   +G+ +C
Sbjct: 67  IVRLYDIVHSDAHKLYLVFEFLDLDLKRYMESIPKDQPL--GGNIIKKFMMQLCKGIAYC 124

Query: 121 HRNFILHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAK 180
           H + I+HRDLKP NLL + DG +K+ DFGLARA   P    T  +VT WYRAPE+L G K
Sbjct: 125 HAHRIIHRDLKPQNLLINRDGNLKLGDFGLARAFGVPLRAYTHEIVTLWYRAPEVLLGGK 184

Query: 181 HYTSAIDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWPEVSSFMTYNK 240
            Y++ +D+WS+G IFAE+  R P   G +++DQ+   FR LGTP +R WP++     +  
Sbjct: 185 QYSTGVDVWSIGCIFAEMCNRKPLFSGDSEIDQIFKIFRVLGTPNERTWPDIIYLPDFK- 243

Query: 241 LQIYPPPSRDELRKRFIAASEYALDFMCGMLTMNPQKRWTAVQCLESDYFKE 292
              +P  +R  L +   +     +D +  ++T +P  R +A + ++  YFKE
Sbjct: 244 -TTFPKWNRRNLSEVIPSLDANGIDLLDKLITYDPIHRISAKRAVQHPYFKE 294

>ADR058C [1799] [Homologous to ScYBR160W (CDC28) - SH]
           (810941..811828) [888 bp, 295 aa]
          Length = 295

 Score =  207 bits (526), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 112/292 (38%), Positives = 172/292 (58%), Gaps = 10/292 (3%)

Query: 7   YTKEKKVGEGTYAVVYLGCQHSTGRKI-AIKEIKTSEFKDGLDMSAIREVKYLQEMQHPN 65
           Y + +KVGEGTY VVY       G++I A+K+I+     +G+  +AIRE+  L+E++  N
Sbjct: 7   YKRLEKVGEGTYGVVYKAVDLRHGQRIVALKKIRLESEDEGVPSTAIREISLLKELKDDN 66

Query: 66  VIELIDIFMA-YDNLNLVLEFLPTDL----EVVIKDKSILFTPADIKAWMLMTLRGVYHC 120
           ++ L DI  +    L LV EFL  DL    E V KD+ +      IK +M+   +G+ +C
Sbjct: 67  IVRLYDIVHSDAHKLYLVFEFLELDLKRYMESVPKDQPL--GDKIIKKFMMQLCKGIAYC 124

Query: 121 HRNFILHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAK 180
           H + I+HRDLKP NLL + +G +K+ DFGLARA   P    T  +VT WYRAPE+L G K
Sbjct: 125 HAHRIIHRDLKPQNLLINRNGNLKLGDFGLARAFGVPLRAYTHEIVTLWYRAPEVLLGGK 184

Query: 181 HYTSAIDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWPEVSSFMTYNK 240
            Y++ +D+WS+G IFAE+  R P   G +++DQ+   FR LGTP +  WP++     +  
Sbjct: 185 QYSTGVDVWSIGCIFAEMCNRKPLFSGDSEIDQIFKIFRLLGTPNESVWPDIVYLPDFK- 243

Query: 241 LQIYPPPSRDELRKRFIAASEYALDFMCGMLTMNPQKRWTAVQCLESDYFKE 292
              +P   R +L +   + +E+ LD +  ++T +P  R +A + +   YFK+
Sbjct: 244 -PTFPKWQRRDLAQVVPSLNEHGLDLLDKLVTYDPIHRISAKRAVTHPYFKD 294

>Scas_721.46
          Length = 296

 Score =  200 bits (509), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 110/292 (37%), Positives = 167/292 (57%), Gaps = 10/292 (3%)

Query: 7   YTKEKKVGEGTYAVVYLGCQHSTG-RKIAIKEIKTSEFKDGLDMSAIREVKYLQEMQHPN 65
           Y + +KVGEGTY VVY       G R +A+K+I+     +G+  +AIRE+  L+E++  N
Sbjct: 8   YKRLEKVGEGTYGVVYKALDMRQGQRVVALKKIRLESEDEGVPSTAIREISLLKELKDDN 67

Query: 66  VIELIDIFMA-YDNLNLVLEFLPTDL----EVVIKDKSILFTPADIKAWMLMTLRGVYHC 120
           ++ L DI  +    L LV EFL  DL    E + KD+S+      IK +M    +G+ +C
Sbjct: 68  IVRLYDIVHSDAHKLYLVFEFLDLDLKRYMESIPKDQSL--GSDIIKKFMRQLCKGIAYC 125

Query: 121 HRNFILHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAK 180
           H + ILHRDLKP NLL + +G +K+ DFGLARA   P    T  +VT WYRAPE+L G K
Sbjct: 126 HAHRILHRDLKPQNLLINKEGNLKLGDFGLARAFGVPLRAYTHEIVTLWYRAPEVLLGGK 185

Query: 181 HYTSAIDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWPEVSSFMTYNK 240
            Y++ +D WS+G IFAE+  R P   G +++DQ+   FR LGTP +  WP++     +  
Sbjct: 186 QYSTGVDTWSIGCIFAEMCNRSPIFSGDSEIDQIFKIFRILGTPNESVWPDIVYLPDFKP 245

Query: 241 LQIYPPPSRDELRKRFIAASEYALDFMCGMLTMNPQKRWTAVQCLESDYFKE 292
              +P   R +L++   +     +D +  +L  +P  R +A + +   YF++
Sbjct: 246 --NFPQWRRKDLKQVVPSLDPQGIDLLDKLLAYDPINRISARRAVVHPYFQQ 295

>YBR160W (CDC28) [345] chr2 (560034..560930) Cyclin-dependent
           protein kinase essential for completion of START and for
           mitosis, associates with Cks1p and cyclins [897 bp, 298
           aa]
          Length = 298

 Score =  199 bits (507), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 113/295 (38%), Positives = 167/295 (56%), Gaps = 14/295 (4%)

Query: 7   YTKEKKVGEGTYAVVYLGCQHSTG---RKIAIKEIKTSEFKDGLDMSAIREVKYLQEMQH 63
           Y + +KVGEGTY VVY       G   R +A+K+I+     +G+  +AIRE+  L+E++ 
Sbjct: 8   YKRLEKVGEGTYGVVYKALDLRPGQGQRVVALKKIRLESEDEGVPSTAIREISLLKELKD 67

Query: 64  PNVIELIDIFMA-YDNLNLVLEFLPTDL----EVVIKDKSILFTPADI-KAWMLMTLRGV 117
            N++ L DI  +    L LV EFL  DL    E + KD+ +    ADI K +M+   +G+
Sbjct: 68  DNIVRLYDIVHSDAHKLYLVFEFLDLDLKRYMEGIPKDQPL---GADIVKKFMMQLCKGI 124

Query: 118 YHCHRNFILHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLF 177
            +CH + ILHRDLKP NLL + DG +K+ DFGLARA   P    T  +VT WYRAPE+L 
Sbjct: 125 AYCHSHRILHRDLKPQNLLINKDGNLKLGDFGLARAFGVPLRAYTHEIVTLWYRAPEVLL 184

Query: 178 GAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWPEVSSFMT 237
           G K Y++ +D WS+G IFAE+  R P   G +++DQ+   FR LGTP +  WP++     
Sbjct: 185 GGKQYSTGVDTWSIGCIFAEMCNRKPIFSGDSEIDQIFKIFRVLGTPNEAIWPDIVYLPD 244

Query: 238 YNKLQIYPPPSRDELRKRFIAASEYALDFMCGMLTMNPQKRWTAVQCLESDYFKE 292
           +     +P   R +L +   +     +D +  +L  +P  R +A +     YF+E
Sbjct: 245 FKP--SFPQWRRKDLSQVVPSLDPRGIDLLDKLLAYDPINRISARRAAIHPYFQE 297

>CAGL0H07535g 736241..737137 highly similar to sp|P00546
           Saccharomyces cerevisiae YBR160w CDC28, start by
           similarity
          Length = 298

 Score =  199 bits (506), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 111/294 (37%), Positives = 166/294 (56%), Gaps = 12/294 (4%)

Query: 7   YTKEKKVGEGTYAVVYLGCQHSTG---RKIAIKEIKTSEFKDGLDMSAIREVKYLQEMQH 63
           Y + +KVGEGTY VVY       G   R +A+K+I+     +G+  +AIRE+  L+E++ 
Sbjct: 8   YKRLEKVGEGTYGVVYKALDLRPGKGQRVVALKKIRLESEDEGVPSTAIREISLLKELKD 67

Query: 64  PNVIELIDIFMA-YDNLNLVLEFLPTDL----EVVIKDKSILFTPADIKAWMLMTLRGVY 118
            N++ L DI  +    L LVLEFL  DL    E + KD+ +      IK +M+   +G+ 
Sbjct: 68  DNIVRLYDIVHSDAHKLYLVLEFLDLDLKRYMESIPKDQPLGVNI--IKKFMVQLCKGIA 125

Query: 119 HCHRNFILHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFG 178
           +CH + ILHRDLKP NLL   +G +K+ DFGLARA   P    T  +VT WYRAPE+L G
Sbjct: 126 YCHAHRILHRDLKPQNLLIDKEGNLKLGDFGLARAFGVPLRAYTHEIVTLWYRAPEVLLG 185

Query: 179 AKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWPEVSSFMTY 238
            K Y++ +D WS+G IFAE+  R P   G +++DQ+   FR LGTP++  WP++     +
Sbjct: 186 GKQYSTGVDTWSIGCIFAEMCNRKPIFSGDSEIDQIFKIFRILGTPSEAVWPDIVYLPDF 245

Query: 239 NKLQIYPPPSRDELRKRFIAASEYALDFMCGMLTMNPQKRWTAVQCLESDYFKE 292
                +P   R +L +   +   + +D +  +L  +P  R +A +     YF E
Sbjct: 246 K--PSFPQWRRKDLAEVVPSLDPHGIDLLDKLLAYDPINRISARRAANHPYFHE 297

>Scas_610.7
          Length = 668

 Score =  197 bits (501), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 119/337 (35%), Positives = 180/337 (53%), Gaps = 56/337 (16%)

Query: 7   YTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEMQHPNV 66
           Y ++KK+G+GT+  VY G   +T R+IA+K+I  +  KD   ++A RE+  L+ + H N+
Sbjct: 72  YREDKKLGQGTFGEVYKGVHLATQRQIAMKKILVNVEKDLFPITAQREIVILKRLNHKNI 131

Query: 67  IELIDIFMAY--------------------------DNLNLVLEFLPTDLEVVIKDKSIL 100
           I+LI++   Y                           +  ++L ++  DL  ++ +  I 
Sbjct: 132 IKLIEMVYDYAPDSSSSRAAEVKSLSTAAGPPASPSKHFYMILPYMVADLSGILHNPRIT 191

Query: 101 FTPADIKAWMLMTLRGVYHCHRNFILHRDLKPNNLLFSPDGQIKVADFGLARAI-PAPHE 159
               DIK  ML  L GV + H    +HRD+K  N+L   +G +K+ADFGLAR    +P  
Sbjct: 192 LEMPDIKNIMLQVLEGVNYIHCQKFMHRDIKAANILIDHNGILKLADFGLARTYYGSPPN 251

Query: 160 I-----------LTSNVVTRWYRAPELLFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQ 208
           +            TS VVTRWYRAPEL+ G KHYT+A+DIW VG +FAEL  + P L G 
Sbjct: 252 LKYPGGAGSGAKYTSVVVTRWYRAPELVLGDKHYTTAVDIWGVGCVFAELFEKKPILQGS 311

Query: 209 NDVDQMEVTFRALGTPTDRDWPEVSSFMTYNKLQIYPPPS-------RDELRKRFIA-AS 260
           +D+DQ  + F+ +GTPT+ +W          KL  Y P S       +  + +RF     
Sbjct: 312 SDIDQGHIIFKLMGTPTEEEW----------KLAHYLPGSELTRTNYKSTIDERFGKWLD 361

Query: 261 EYALDFMCGMLTMNPQKRWTAVQCLESDYFKELPPPS 297
           +  LDF+ G+L ++P KR TA+  ++ ++FKE P PS
Sbjct: 362 KSGLDFLKGLLALDPYKRLTAMSAVKHEFFKEEPLPS 398

>Kwal_27.11803
          Length = 246

 Score =  184 bits (467), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 97/243 (39%), Positives = 142/243 (58%), Gaps = 8/243 (3%)

Query: 58  LQEMQHPNVIELIDIFMAYDNLNLVLEFLPTDLEVVIKDKSILFTP-----ADIKAWMLM 112
           ++E++H N++ L D+    + L LV EF+  DL+  +  + +  TP     + +K +   
Sbjct: 1   MKELKHENIVRLYDVIHTENKLTLVFEFMDNDLKKYMDSRIVGNTPYGFEMSLVKYFEWQ 60

Query: 113 TLRGVYHCHRNFILHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRA 172
            L+GV  CH N ILHRDLKP NLL +  GQ+K+ DFGLARA   P    +S VVT WYRA
Sbjct: 61  LLQGVAFCHENRILHRDLKPQNLLINNKGQLKLGDFGLARAFGIPVNTFSSEVVTLWYRA 120

Query: 173 PELLFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWPEV 232
           P++L G++ Y+++IDIWS G I AE++   P  PG ND +Q+++ F  +GTPT+R WP V
Sbjct: 121 PDVLMGSRTYSTSIDIWSCGCILAEMITGRPLFPGTNDEEQLKLIFETMGTPTERTWPGV 180

Query: 233 SSFMTYNKL--QIYPPPSRDELRKRFIAASEYAL-DFMCGMLTMNPQKRWTAVQCLESDY 289
           S+   YN    Q  P      L+ +     +  L D + G+L  NP +R +A Q L   +
Sbjct: 181 STLPKYNPQLPQHLPKDLGALLQSQTREKMDLTLIDLLYGLLQPNPDRRLSAKQALNHPW 240

Query: 290 FKE 292
           F E
Sbjct: 241 FAE 243

>AFR205C [3397] [Homologous to ScYKL139W (CTK1) - SH]
           (805583..806956) [1374 bp, 457 aa]
          Length = 457

 Score =  186 bits (472), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 102/300 (34%), Positives = 164/300 (54%), Gaps = 9/300 (3%)

Query: 3   VNMEYTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEMQ 62
           V   Y +  +VGEGTY  VY      T + +A+K+++    +DG  +++IRE+K LQ  Q
Sbjct: 118 VESSYQRITQVGEGTYGKVYKCRNIYTNKLVALKKLRLETERDGFPITSIREIKLLQHCQ 177

Query: 63  HPNVIELIDIFM-AYDNLNLVLEFLPTDLEVVIKDKSILFTPADIKAWMLMTLRGVYHCH 121
           H NV  + +I   A   + ++ E+   DL  ++ +K I F+ A+ K      L+G+ + H
Sbjct: 178 HENVSTIAEIMCEAQKTVYMIFEYADNDLSGLLMNKEIHFSDANCKHLFRQLLKGMEYLH 237

Query: 122 RNFILHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKH 181
              ILHRD+K +N+L    G +K+ DFGLAR +    +  T+ V+T WYR PELL G   
Sbjct: 238 ECRILHRDIKGSNILIDNRGNLKITDFGLARKMKQEPDY-TNRVITLWYRPPELLLGTTR 296

Query: 182 YTSAIDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWPEVSS-----FM 236
           Y + +D+W  G +  EL L+  +  G N+++Q+   F+ LGTPT   WP +        M
Sbjct: 297 YGTEVDMWGCGCLLVELFLKAAFFQGTNELEQLRCIFQVLGTPTIEQWPGLFDMPWWFMM 356

Query: 237 TYNKLQIYPPPSRDELRKRFIAASEYALDFMCGMLTMNPQKRWTAVQCLESDYFKELPPP 296
              + + Y  PSR + +   +  ++   D   G+L  + +KR++A + L+S YF ELP P
Sbjct: 357 IPQQKENY--PSRFDEKVSGVLPTQSCRDLARGLLLYDQKKRFSASEALKSAYFYELPRP 414

>CAGL0I08349g complement(813728..815731) similar to sp|P23293
           Saccharomyces cerevisiae YPR161c SGV1 ser/thr protein
           kinase, hypothetical start
          Length = 667

 Score =  187 bits (474), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 115/332 (34%), Positives = 178/332 (53%), Gaps = 45/332 (13%)

Query: 7   YTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEMQHPNV 66
           Y +E+K+G+GT+  VY G    T RK+A+K I  ++  D   ++A RE+  L+ + H N+
Sbjct: 60  YKEEEKLGQGTFGEVYKGLHLQTQRKVAMKRIIVNQENDLFPITAQREITILKRLNHKNI 119

Query: 67  IELIDIFMAYD-------------NLN--------------LVLEFLPTDLEVVIKDKSI 99
           I+L++  M YD             N N              ++L ++  DL  ++ +  I
Sbjct: 120 IKLLE--MVYDFPPESNNKDYAQFNQNNSANPPAVPKKFFYMILPYMVADLSGILHNPRI 177

Query: 100 LFTPADIKAWMLMTLRGVYHCHRNFILHRDLKPNNLLFSPDGQIKVADFGLARAI-PAPH 158
               ADIK  M   L GV   H +  +HRD+K  NLL   +G +K+ADFGLAR    +P 
Sbjct: 178 ELKMADIKNMMKQILEGVNFIHCSKFMHRDIKTANLLIDHNGVLKLADFGLARQYYGSPP 237

Query: 159 EI-----------LTSNVVTRWYRAPELLFGAKHYTSAIDIWSVGVIFAELMLRIPYLPG 207
            I            TS VVTRWYRAPEL+ G K+YT+A+DIW VG +FAE   + P L G
Sbjct: 238 NIKFPGSAGSGAKYTSVVVTRWYRAPELVLGDKYYTTAVDIWGVGCVFAEFFEKKPILQG 297

Query: 208 QNDVDQMEVTFRALGTPTDRDWPEVSSFMTYNKLQIYPPPSRDELRKRFIAA-SEYALDF 266
           + D+DQ  V F+ +GTP +R W E++ ++     ++     +  + +RF    +   L F
Sbjct: 298 KTDIDQGHVIFKLMGTPDERTW-ELAKYLP--GAELTKTEYKSTIDERFGKHLTPTGLSF 354

Query: 267 MCGMLTMNPQKRWTAVQCLESDYFKELPPPSD 298
           + G+L ++P KR TA+  ++  +F+E P  +D
Sbjct: 355 LKGLLALDPYKRLTAMSAMKHPFFQEEPLAAD 386

>Scas_721.110
          Length = 520

 Score =  183 bits (465), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 101/300 (33%), Positives = 161/300 (53%), Gaps = 11/300 (3%)

Query: 7   YTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEMQHPNV 66
           Y +  +VGEGTY  VY      T   +A+K+++ +  KDG  +++IRE+K LQ   HPN+
Sbjct: 185 YERIVQVGEGTYGKVYKARNEVTSHLVALKKLRLNNEKDGFPITSIREIKLLQTFHHPNI 244

Query: 67  IELIDIFMAYDNL-NLVLEFLPTDLEVVIKDKSILFTPADIKAWMLMTLRGVYHCHRNFI 125
             L++I +    +  ++ E+   DL  ++ DK+++ +    K      LRGV + H + I
Sbjct: 245 ATLVEIMVESSKMVYMIFEYADNDLTGLLGDKNVVMSLGQRKHLFQQLLRGVKYLHDSLI 304

Query: 126 LHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSN-----VVTRWYRAPELLFGAK 180
           LHRD+K +N+L    G +K+ DFGLAR +    +   SN     V+T WYR PELL G  
Sbjct: 305 LHRDIKGSNILIDNKGNLKITDFGLARKMHVKSDSDGSNDYTNRVITLWYRPPELLMGTT 364

Query: 181 HYTSAIDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWPEVSS----FM 236
           +Y++ +D+W  G I  EL   +    GQN+++Q+   F+ +G+P   +WP        FM
Sbjct: 365 NYSTEVDMWGCGCILMELFNNVSIFQGQNEIEQLLSIFKIMGSPNLDNWPNFFEMPWFFM 424

Query: 237 TYNKLQIYPPPSRDELRKRFIAASEYALDFMCGMLTMNPQKRWTAVQCLESDYFKELPPP 296
               L    P   +E  K  + +SE   +   G+L  + +KR +A + L+S YF E P P
Sbjct: 425 IIPMLTEKYPDLFEEKYKNLLPSSE-CFNLAKGLLLYDQKKRLSAEEALKSPYFTEDPQP 483

>Kwal_26.7552
          Length = 461

 Score =  181 bits (460), Expect = 9e-54,   Method: Compositional matrix adjust.
 Identities = 98/294 (33%), Positives = 161/294 (54%), Gaps = 5/294 (1%)

Query: 7   YTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEMQHPNV 66
           Y + ++VGEGTY  VY      TG+ +A+K ++    ++G  +++IRE+K LQ   H N+
Sbjct: 131 YERIQQVGEGTYGKVYKARNTVTGQLVALKRLRLEGEREGFPITSIREIKLLQSFDHRNI 190

Query: 67  IELIDIFM-AYDNLNLVLEFLPTDLEVVIKDKSILFTPADIKAWMLMTLRGVYHCHRNFI 125
             L +I + +   + ++ E+   DL  ++ ++ I  + A+ K      L G+++ H N I
Sbjct: 191 STLSEIMVESQKTVYMIFEYADNDLSGLLMNEQITLSNANCKHLFKSLLEGIHYLHDNGI 250

Query: 126 LHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKHYTSA 185
           LHRD+K +N+L    GQ+K+ DFGLAR +    +  T+ V+T WYR PELL G+ +Y +A
Sbjct: 251 LHRDIKGSNILIDNKGQLKITDFGLARKMRDDSD-YTNRVITLWYRPPELLMGSTNYGTA 309

Query: 186 IDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWP---EVSSFMTYNKLQ 242
           +D+W  G +  EL  +     G N+V+Q+   F  +GTPT   WP   E+  F      Q
Sbjct: 310 VDMWGCGCLLVELFKKTAIFQGTNEVEQLNAIFSIMGTPTVEQWPNLFEMPWFFMMIPQQ 369

Query: 243 IYPPPSRDELRKRFIAASEYALDFMCGMLTMNPQKRWTAVQCLESDYFKELPPP 296
                S+ + +   I  S  A D   G+L  + ++R++A   L+  YF+E P P
Sbjct: 370 TRKHESKFDEKFGPILPSSAAADLAKGLLLYDEKRRFSASDALKHQYFREEPEP 423

>AFR019W [3211] [Homologous to ScYBL016W (FUS3) - SH]
           complement(471481..472560) [1080 bp, 359 aa]
          Length = 359

 Score =  179 bits (453), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 105/308 (34%), Positives = 158/308 (51%), Gaps = 15/308 (4%)

Query: 3   VNMEYTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEMQ 62
           ++ E+  +  +GEG Y +V       +G  +AIK+I+  E +    +  +RE+K L+  Q
Sbjct: 9   ISSEFQLKALLGEGAYGIVCSAVHKPSGEVVAIKKIEPFE-RTLFSLRTLREIKILKHFQ 67

Query: 63  HPNVIELIDI-----FMAYDNLNLVLEFLPTDLEVVIKDKSILFTPADIKAWMLMTLRGV 117
           H N+I + DI     F  ++ + ++ E + TDL  VI  + +  +   I+ ++  TLRG+
Sbjct: 68  HENIISIYDIQKPASFDTFNEVYIIQELMQTDLHRVIATQPL--SDDHIQYFIYQTLRGL 125

Query: 118 YHCHRNFILHRDLKPNNLLFSPDGQIKVADFGLARA-------IPAPHEILTSNVVTRWY 170
              H + I+HRDLKP+NLL + +  +K+ DFGLAR        +  P   +T  V TRWY
Sbjct: 126 KALHGSGIIHRDLKPSNLLLNANCDLKICDFGLARIEHGGAADLEHPQAGMTEYVATRWY 185

Query: 171 RAPELLFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWP 230
           RAPE++  A  YT AIDIWS G I AEL ++ P   G++   Q+ + F  LGTP   D  
Sbjct: 186 RAPEVMLTAAQYTKAIDIWSSGCILAELFMKRPLFAGKDYKHQLMLIFELLGTPQGDDLA 245

Query: 231 EVSSFMTYNKLQIYPPPSRDELRKRFIAASEYALDFMCGMLTMNPQKRWTAVQCLESDYF 290
            V S      +   P   R  LR     A+   LD +  ML  +P++R TA   L   Y 
Sbjct: 246 AVKSRRAREYIATLPRYRRASLRAVIPHANPLGLDLLQRMLVFDPRRRITAADALRHPYL 305

Query: 291 KELPPPSD 298
                P D
Sbjct: 306 ATYHDPRD 313

>KLLA0E12177g 1080245..1081612 gi|4096112|gb|AAC99804.1
           Kluyveromyces lactis CTD kinase largest subunit,
           hypothetical start
          Length = 455

 Score =  179 bits (454), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 101/296 (34%), Positives = 160/296 (54%), Gaps = 18/296 (6%)

Query: 12  KVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEMQHPNVIELID 71
           +VGEGTY  VY      TG+ IA+K ++  + +DG  +++IRE+K LQ++ HPN+  + +
Sbjct: 134 QVGEGTYGKVYKAENVHTGKLIALKRLRLEQERDGFPITSIREIKLLQQLNHPNISLIHE 193

Query: 72  IFMAYDN-LNLVLEFLPTDLEVVIKDKSILFTPADIKAWMLMTLRGVYHCHRNFILHRDL 130
           I ++  N +++  +++  DL  ++ DKSI F+ ++IK  M     G+ + H+  I+HRD+
Sbjct: 194 IIVSDKNTISMGFQYMENDLSGMLMDKSIQFSDSNIKHLMKQLFVGLQYLHQQQIVHRDI 253

Query: 131 KPNNLLFSPDGQIKVADFGLARAI-----PAPHEILTSNVVTRWYRAPELLFGAKHYTSA 185
           K +NLL    G +K+ DFGLA+ +     PA +   T+ V+T WYR PELL GA  Y   
Sbjct: 254 KGSNLLIDNRGNLKITDFGLAKKLTDVSSPASN---TNRVITLWYRPPELLLGATDYKYE 310

Query: 186 IDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWPEVSS----FMTYNKL 241
           +D W  G +  EL       PG N+VDQ +     +G+PT   WP++      FM   ++
Sbjct: 311 VDCWGCGCLLVELFAGAAIFPGSNEVDQFQRILSIMGSPTLEQWPKMLDMPWWFMLVPQI 370

Query: 242 -QIYPPPSRDELRKRFIAASEYALDFMCGMLTMNPQKRWTAVQCLESDYFKELPPP 296
            + Y     DE    F    + ALD    +L  +   R+T  + L+  YF   P P
Sbjct: 371 SKTYKNVFFDE----FSKVPQDALDLASKLLRYDQDTRFTTTEALQHHYFTNEPKP 422

>Kwal_17.2687
          Length = 362

 Score =  176 bits (445), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 106/313 (33%), Positives = 167/313 (53%), Gaps = 20/313 (6%)

Query: 3   VNMEYTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEMQ 62
           ++ E+  ++ +GEG Y VV       TG+ +AIK+I+  + +    +  +RE+K L+  Q
Sbjct: 9   ISSEFQLQQLLGEGAYGVVCSARHLPTGQMVAIKKIEPFD-RPLFCLRTLREIKLLRCFQ 67

Query: 63  HPNVIELIDI-----FMAYDNLNLVLEFLPTDLEVVIKDKSILFTPADIKAWMLMTLRGV 117
           H N+I + DI     F  ++ + ++ E + TDL  VI  +++  +   I+ ++   LR +
Sbjct: 68  HENIISIFDIQRPASFETFNEVYIIQELMDTDLHRVIATQTL--SDDHIQYFVYQILRAL 125

Query: 118 YHCHRNFILHRDLKPNNLLFSPDGQIKVADFGLARAI---PAPHEI--------LTSNVV 166
              H   ++HRDLKP NLL + +  +K+ DFGLAR     P             +T  V 
Sbjct: 126 KCLHGAEVIHRDLKPANLLVNANCDVKLCDFGLARCAGMGPGASNTGKAGEAGQMTEYVA 185

Query: 167 TRWYRAPELLFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTD 226
           TRWYRAPE++  A  YT A+D+WS G I AEL+LR P  PG++   Q+ + F+ +G+PT+
Sbjct: 186 TRWYRAPEVMLTAAEYTFAMDVWSCGCILAELLLRRPLFPGKDYHHQLLLIFQVIGSPTE 245

Query: 227 RDWPEVSSFMTYNKLQIYPP-PSRDELRKRFIAASEYALDFMCGMLTMNPQKRWTAVQCL 285
            D   V S      L   P   +R+ LR+    AS  ALD +  ML  +P++R +A Q L
Sbjct: 246 ADLECVRSRRARQYLGTLPRYAAREGLRQLLPQASAEALDLLKRMLVFDPRRRISAAQAL 305

Query: 286 ESDYFKELPPPSD 298
              Y +    P D
Sbjct: 306 RHPYLRAYHDPQD 318

>Kwal_55.21900
          Length = 625

 Score =  178 bits (452), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 117/330 (35%), Positives = 173/330 (52%), Gaps = 48/330 (14%)

Query: 7   YTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEMQHPNV 66
           Y ++KK+G+GT+  VY G    T R++A+K       KD   ++A RE+  L+++ H NV
Sbjct: 57  YKEDKKLGQGTFGEVYRGVHLETQRQVAMKRTIVKAEKDLFPITAQREITILRKLNHKNV 116

Query: 67  IELIDIFMAYD--------------NLN--------LVLEFLPTDLEVVIKDKSILFTPA 104
           I+LI++   Y               N N        ++L ++  DL  ++ +  I     
Sbjct: 117 IKLIEMVYDYPPTSSNGSSNTTTLPNPNTPSTKSFYMILPYMIADLSGILHNPRIKLGME 176

Query: 105 DIKAWMLMTLRGVYHCHRNFILHRDLKPNNLLFSPDGQIKVADFGLARAI-PAPHEI--- 160
            IK  +L  L G+ + H    +HRD+K  NLL    G +K+ADFGLAR    AP  +   
Sbjct: 177 GIKNILLQILEGINYIHCQKFMHRDIKAANLLLDHKGVLKIADFGLARNYYGAPPNLKYP 236

Query: 161 --------LTSNVVTRWYRAPELLFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDVD 212
                    TS VVTRWYRAPEL+ G KHYT+A+D+W VG +F EL  + P L GQ D+D
Sbjct: 237 GGAGVDAKYTSVVVTRWYRAPELVLGDKHYTTAVDMWGVGCVFGELFEKKPILQGQTDID 296

Query: 213 QMEVTFRALGTPTDRDWPEVSSFMTYNKL--QIYPPPSRDELRKRFIAASEYALD----F 266
           Q  V F+ LGTP++ +WP ++ F+   +L    Y P     +R+RF    EY  D     
Sbjct: 297 QGHVIFKLLGTPSEEEWP-LARFLPGAELTRTKYSP----NIRERF---GEYLTDTGLDL 348

Query: 267 MCGMLTMNPQKRWTAVQCLESDYFKELPPP 296
           +  +L ++P KR TA+   +  +F E P P
Sbjct: 349 LSQLLCLDPYKRLTAMAAKKHPFFTEEPLP 378

>CAGL0D02002g 207419..209080 similar to sp|Q03957 Saccharomyces
           cerevisiae YKL139w CTK1 carboxy-terminal domain kinase,
           hypothetical start
          Length = 553

 Score =  177 bits (448), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 96/292 (32%), Positives = 154/292 (52%), Gaps = 7/292 (2%)

Query: 12  KVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEMQHPNVIELID 71
           +VGEGTY  VY      T   +A+K+++    ++G  +++IRE+K LQ   H NV  + +
Sbjct: 226 QVGEGTYGKVYKARNTVTKELVALKKLRLQGEREGFPITSIREIKLLQSFNHENVSTIKE 285

Query: 72  IFMAYDNL-NLVLEFLPTDLEVVIKDKSILFTPADIKAWMLMTLRGVYHCHRNFILHRDL 130
           I +    +  ++ E+   DL  ++ +K I    A  K      L G+ + H N ILHRD+
Sbjct: 286 IMVESQKIIYMIFEYADNDLGGLLLNKQININAAQSKHIFKQILHGIEYLHDNNILHRDI 345

Query: 131 KPNNLLFSPDGQIKVADFGLARAIPAPHEIL---TSNVVTRWYRAPELLFGAKHYTSAID 187
           K +N+L    G +K+ DFGLAR I    + +   T+ V+T WYR PELL G  +Y   +D
Sbjct: 346 KGSNILIDNQGSLKLTDFGLARKIDCNRDAIRDYTNRVITIWYRPPELLLGTTNYGPEVD 405

Query: 188 IWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWPEVSS---FMTYNKLQIY 244
           +W  G I  EL  ++    G N+++Q+E  F+ +G+P+   WP +     F      Q  
Sbjct: 406 MWGCGCILVELFNKMAIFQGTNELEQLEAIFKVMGSPSIEQWPNIFDMPWFFMIMPQQAT 465

Query: 245 PPPSRDELRKRFIAASEYALDFMCGMLTMNPQKRWTAVQCLESDYFKELPPP 296
             P+  E + R +  ++       G+L  + +KR TA + L+S+YFKE P P
Sbjct: 466 KYPNVFEEKFRAVLETDNCFKLAQGLLRYDQEKRLTASEALQSEYFKEDPQP 517

>ABR177C [770] [Homologous to ScYPR161C (SGV1) - SH]
           (735828..738089) [2262 bp, 753 aa]
          Length = 753

 Score =  179 bits (455), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 111/327 (33%), Positives = 176/327 (53%), Gaps = 41/327 (12%)

Query: 7   YTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEMQHPNV 66
           Y +EKK+G+GT+  VY G   +T R++A+K+I      D   ++A RE+  L+ + H NV
Sbjct: 56  YKEEKKLGQGTFGEVYRGVHLATQRQVAMKKILVKTENDLFPITAQREITILKRLNHRNV 115

Query: 67  IELIDIFMAY-----------------------DNLNLVLEFLPTDLEVVIKDKSILFTP 103
           ++LI++   Y                        +  ++L ++  DL  ++ +  +    
Sbjct: 116 VQLIEMVYDYPPAQNGAAYGQDSSQASASADTMKSFYMILPYMVADLSGILHNPRVTLEM 175

Query: 104 ADIKAWMLMTLRGVYHCHRNFILHRDLKPNNLLFSPDGQIKVADFGLARAI-PAPHEI-- 160
           ADIK  ML  L G+ + H    +HRD+K  N+L    G +K+ADFGLAR    AP  +  
Sbjct: 176 ADIKNMMLQILEGINYIHCKKFMHRDIKTANILLDHKGILKIADFGLARNYYGAPPNLKY 235

Query: 161 ---------LTSNVVTRWYRAPELLFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDV 211
                     TS VVTRWYRAPEL+ G K+YT+A+DIW +G +FAE   + P L G+ D+
Sbjct: 236 PGGAGTDAKYTSVVVTRWYRAPELVLGDKNYTTAVDIWGIGCVFAEFFEKRPILQGKTDI 295

Query: 212 DQMEVTFRALGTPTDRDWPEVSSFMTYNKL--QIYPPPSRDELRKRFIAASEYALDFMCG 269
           DQ  V F+ +GTP+D DW +++ ++   +L    Y P  ++   K     +E  LD +  
Sbjct: 296 DQGHVIFKLMGTPSDSDW-QLARYLPGAELTRTSYEPTYKERFGKYL---TEKGLDLLST 351

Query: 270 MLTMNPQKRWTAVQCLESDYFKELPPP 296
           +L+++P KR TA+  ++  +F E P P
Sbjct: 352 LLSLDPYKRLTAMAAMQHPFFSEDPLP 378

>Kwal_27.11919
          Length = 209

 Score =  167 bits (423), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 91/204 (44%), Positives = 128/204 (62%), Gaps = 10/204 (4%)

Query: 7   YTKEKKVGEGTYAVVY--LGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEMQHP 64
           Y + +KVGEGTY VVY  L  +H   R +A+K+I+     +G+  +AIRE+  L+E++  
Sbjct: 7   YKRLEKVGEGTYGVVYKALDLRHGQ-RVVALKKIRLESEDEGVPSTAIREISLLKELKDD 65

Query: 65  NVIELIDIFMA-YDNLNLVLEFLPTDL----EVVIKDKSILFTPADIKAWMLMTLRGVYH 119
           N++ L DI  +    L LV EFL  DL    E + K++ +      IK +M+   +G+ +
Sbjct: 66  NIVRLYDIVHSDAHKLYLVFEFLDLDLKRYMEAIPKEQPL--GDNIIKKFMMQLCKGIAY 123

Query: 120 CHRNFILHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGA 179
           CH + ILHRDLKP NLL + DG +K+ADFGLARA   P    T  +VT WYRAPE+L G 
Sbjct: 124 CHSHRILHRDLKPQNLLINRDGNMKLADFGLARAFGVPLRAYTHEIVTLWYRAPEVLLGG 183

Query: 180 KHYTSAIDIWSVGVIFAELMLRIP 203
           K Y++ +DIWS+G IFAE+  R P
Sbjct: 184 KQYSTGVDIWSIGCIFAEMCNRKP 207

>KLLA0D10527g 892955..894892 similar to sp|P23293 Saccharomyces
           cerevisiae YPR161c SGV1 ser/thr protein kinase,
           hypothetical start
          Length = 645

 Score =  177 bits (448), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 114/342 (33%), Positives = 174/342 (50%), Gaps = 61/342 (17%)

Query: 7   YTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEMQHPNV 66
           Y +E+K+G+GT+  V+ G    T RK+AIK I     KD   ++A RE+  L+ M H N+
Sbjct: 55  YREEEKLGQGTFGEVFKGIHLGTNRKVAIKRILVRAEKDLFPITAQREITILKRMNHKNI 114

Query: 67  IELIDI--------------------FMAYDNLN-----------LVLEFLPTDLEVVIK 95
           ++LI+I                    +   +  N           ++L ++ +DL  ++ 
Sbjct: 115 VKLIEIVYDESPTPKTDSTSPRPVGNYHGNNTANQQKLITGKHFFMILPYMVSDLTGLLH 174

Query: 96  DKSILFTPADIKAWMLMTLRGVYHCHRNFILHRDLKPNNLLFSPDGQIKVADFGLAR--- 152
           +  + F  AD+K  ML  L G+ + H N  LHRD+K  N+L    G +K+ADFGLAR   
Sbjct: 175 NPRVEFGMADVKNIMLQLLEGINYIHCNKFLHRDIKTANILIDHKGVVKIADFGLARNYY 234

Query: 153 ---------AIPAPHEILTSNVVTRWYRAPELLFGAKHYTSAIDIWSVGVIFAELMLRIP 203
                             TS VVTRWYRAPE++ G +HYT+A+DIW +G +FAE   + P
Sbjct: 235 GSPPNLKYPGGAGSGAKYTSVVVTRWYRAPEIVLGDRHYTTAVDIWGIGCVFAEFFEKKP 294

Query: 204 YLPGQNDVDQMEVTFRALGTPTDRDWPEVSSFMTYNKLQIYPPPS-------RDELRKRF 256
            L GQ D+DQ  V F+ +GTP+  +W           L  + P S       +  L++RF
Sbjct: 295 ILQGQTDIDQGHVIFKLMGTPSMDEW----------GLAYHLPGSELTKTNYKSTLQERF 344

Query: 257 IAA-SEYALDFMCGMLTMNPQKRWTAVQCLESDYFKELPPPS 297
             A +E  LD +  +L ++P KR TA++  +  +F E P P+
Sbjct: 345 SKALNETGLDLLSKLLALDPYKRVTAMKAKKHPFFFEEPLPN 386

>Kwal_47.17868
          Length = 365

 Score =  170 bits (430), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 105/308 (34%), Positives = 171/308 (55%), Gaps = 24/308 (7%)

Query: 3   VNMEYTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEI-KTSEFKDGLDMSAIREVKYLQEM 61
           +++ Y   + VG G++ VV+      TG ++AIK++ +   FK+       RE++ ++++
Sbjct: 32  ISISYPATEVVGHGSFGVVFTTQVRETGDRVAIKKVLQDRRFKN-------RELEIMKQL 84

Query: 62  QHPNVIELIDIFMAYD-----NLNLVLEFLPTDLEVVIK---DKSILFTPADIKAWMLMT 113
           QHP V++L   F   D      LNL+LE++P  L   ++    +       +IK +M   
Sbjct: 85  QHPQVVDLKYYFYETDPQGEVYLNLILEYMPQSLYQRLRHFVSQRSNMPRIEIKLYMYQL 144

Query: 114 LRGVYHCHRNF-ILHRDLKPNNLLFSPDG-QIKVADFGLARAIPAPHEILTSNVVTRWYR 171
            + + + H N  + HRD+KP NLL  P    +K+ DFG A+ +  P E   S + +R+YR
Sbjct: 145 AKSLNYLHTNARVCHRDIKPQNLLVDPQTFALKLCDFGSAKQL-KPSEPNVSYICSRYYR 203

Query: 172 APELLFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWPE 231
           APEL+FGA +YT  IDIWS G + AEL+L  P  PG++ +DQ+    + LGTPT ++   
Sbjct: 204 APELIFGASNYTVQIDIWSSGCVMAELILGQPMFPGESGIDQLVEIIKILGTPTKQEICS 263

Query: 232 VS-SFMTYNKLQIYPPPSRDELRKRFIAASEYALDFMCGMLTMNPQKRWTAVQCLESDYF 290
           ++ ++M +   QI P P    L K F    +  + F+  +L  +P +R+TA+QCL + YF
Sbjct: 264 MNPNYMEHKFPQIRPIP----LAKVFKREDDETIRFLFDVLRYDPTERYTALQCLCAPYF 319

Query: 291 KELPPPSD 298
            EL    D
Sbjct: 320 DELRTTQD 327

>Scas_710.28
          Length = 352

 Score =  169 bits (428), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 102/313 (32%), Positives = 160/313 (51%), Gaps = 18/313 (5%)

Query: 1   MKVNMEYTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQE 60
             ++ ++  +  +GEG Y VV       TG  +AIK+I+  + K    +  +RE+K L+ 
Sbjct: 7   FNISSDFQLKSLLGEGAYGVVCSAVHKPTGEIVAIKKIEPFD-KPLFALRTLREIKILKH 65

Query: 61  MQHPNVIELIDI-----FMAYDNLNLVLEFLPTDLEVVIKDKSILFTPADIKAWMLMTLR 115
            QH N+I + DI     F  ++ + ++ E + TDL  VI  +++  T   I+ ++  TLR
Sbjct: 66  FQHENIISIFDIQRPESFENFNEVYIIQELMQTDLHRVISTQNL--TDDHIQYFIYQTLR 123

Query: 116 GVYHCHRNFILHRDLKPNNLLFSPDGQIKVADFGLARAIPAP----------HEILTSNV 165
            V   H + ++HRDLKP+NLL + +  +K+ DFGLAR I                +T  V
Sbjct: 124 AVKVLHGSNVIHRDLKPSNLLINSNCDLKICDFGLARIIEEDTGDDEPNAQLQNGMTEYV 183

Query: 166 VTRWYRAPELLFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTPT 225
            TRWYRAPE++  A  Y+ A+DIWS G I AEL ++ P  PG++   Q+ + F  +GTP+
Sbjct: 184 ATRWYRAPEVMLTAARYSKAMDIWSCGCILAELFMKRPIFPGKDYRHQLMLIFGLIGTPS 243

Query: 226 DRDWPEVSSFMTYNKLQIYPPPSRDELRKRFIAASEYALDFMCGMLTMNPQKRWTAVQCL 285
            RD   + S      +   P        K F   +   +D +  ML  +P+ R TA + L
Sbjct: 244 GRDLLCIESRRAREYITTLPKYEPVPWEKVFPNVNPLGIDLLQRMLIFDPRSRITAEEAL 303

Query: 286 ESDYFKELPPPSD 298
              Y K    P+D
Sbjct: 304 AHPYLKTYHDPND 316

>KLLA0E10527g 929989..931104 similar to sp|P16892 Saccharomyces
           cerevisiae YBL016w FUS3 mitogen-activated protein kinase
           (MAP kinase), start by similarity
          Length = 371

 Score =  168 bits (425), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 103/332 (31%), Positives = 169/332 (50%), Gaps = 37/332 (11%)

Query: 1   MKVNMEYTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQE 60
             ++ E+  +  +GEG Y VV       +G  +AIK+I+  E K    +  +RE+K L+ 
Sbjct: 7   FNISSEFQLQSLLGEGAYGVVCSAKHKPSGEIVAIKKIEPFE-KPLFSIRTLREIKILKH 65

Query: 61  MQHPNVIELIDI-----FMAYDNLNLVLEFLPTDLEVVIKDKSILFTPADIKAWMLMTLR 115
            QH N+I + D+     F  ++ + ++ E + TDL  VI  + +  +   ++ ++  TLR
Sbjct: 66  FQHENIISIFDVQKPSSFEQFNEVYIIQELMQTDLHRVIVTQEL--SEDHVQYFVYQTLR 123

Query: 116 GVYHCHRNFILHRDLKPNNLLFSPDGQIKVADFGLARAIP------------------AP 157
            +   H + ++HRDLKP+NLL + +  +K+ DFGLAR +                   +P
Sbjct: 124 ALKVLHGSNVIHRDLKPSNLLLNSNCDLKICDFGLARIVSERATDGDAHVDADDTDDNSP 183

Query: 158 HEI----------LTSNVVTRWYRAPELLFGAKHYTSAIDIWSVGVIFAELMLRIPYLPG 207
                        +T  V TRWYRAPE++  A  Y+ ++D+WS G I AEL+ + P  PG
Sbjct: 184 SSAANDGDPAISGMTEYVATRWYRAPEVMLTAAQYSKSMDVWSCGCILAELLGKQPLFPG 243

Query: 208 QNDVDQMEVTFRALGTPTDRDWPE-VSSFMTYNKLQIYPPPSRDELRKRFIAASEYALDF 266
           ++  DQ+ + F+ LGTPT+++  E V +      ++  P   +   R+RF  AS  ALD 
Sbjct: 244 KDYRDQLILIFQTLGTPTEQELVELVENRRAREYIRSLPKHPKINWRRRFPNASAAALDL 303

Query: 267 MCGMLTMNPQKRWTAVQCLESDYFKELPPPSD 298
           +  ML  +P+ R TA + L   Y      P D
Sbjct: 304 LDRMLQFDPRLRITATEALSHPYLVSYHDPDD 335

>YBL016W (FUS3) [179] chr2 (192416..193477) Serine/threonine protein
           kinase required for cell cycle arrest and for cell
           fusion during mating, member of the MAP kinase family of
           protein kinases [1062 bp, 353 aa]
          Length = 353

 Score =  166 bits (420), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 102/312 (32%), Positives = 162/312 (51%), Gaps = 19/312 (6%)

Query: 3   VNMEYTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEMQ 62
           ++ ++  +  +GEG Y VV       TG  +AIK+I+  + K    +  +RE+K L+  +
Sbjct: 9   ISSDFQLKSLLGEGAYGVVCSATHKPTGEIVAIKKIEPFD-KPLFALRTLREIKILKHFK 67

Query: 63  HPNVIELIDI-----FMAYDNLNLVLEFLPTDLEVVIKDKSILFTPADIKAWMLMTLRGV 117
           H N+I + +I     F  ++ + ++ E + TDL  VI  +  + +   I+ ++  TLR V
Sbjct: 68  HENIITIFNIQRPDSFENFNEVYIIQELMQTDLHRVISTQ--MLSDDHIQYFIYQTLRAV 125

Query: 118 YHCHRNFILHRDLKPNNLLFSPDGQIKVADFGLARAI----------PAPHEILTSNVVT 167
              H + ++HRDLKP+NLL + +  +KV DFGLAR I                +T  V T
Sbjct: 126 KVLHGSNVIHRDLKPSNLLINSNCDLKVCDFGLARIIDESAADNSEPTGQQSGMTEYVAT 185

Query: 168 RWYRAPELLFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTP-TD 226
           RWYRAPE++  +  Y+ A+D+WS G I AEL LR P  PG++   Q+ + F  +GTP +D
Sbjct: 186 RWYRAPEVMLTSAKYSRAMDVWSCGCILAELFLRRPIFPGRDYRHQLLLIFGIIGTPHSD 245

Query: 227 RDWPEVSSFMTYNKLQIYPPPSRDELRKRFIAASEYALDFMCGMLTMNPQKRWTAVQCLE 286
            D   + S      ++  P      L K F   +   +D +  ML  +P KR TA + LE
Sbjct: 246 NDLRCIESPRAREYIKSLPMYPAAPLEKMFPRVNPKGIDLLQRMLVFDPAKRITAKEALE 305

Query: 287 SDYFKELPPPSD 298
             Y +    P+D
Sbjct: 306 HPYLQTYHDPND 317

>CAGL0L06820g 767038..768138 highly similar to sp|P38615
           Saccharomyces cerevisiae YMR139w MDS1
           Serine/threonine-protein kinase, start by similarity
          Length = 366

 Score =  164 bits (414), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 100/303 (33%), Positives = 167/303 (55%), Gaps = 24/303 (7%)

Query: 3   VNMEYTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEI-KTSEFKDGLDMSAIREVKYLQEM 61
           + + +   + VG G++ VV+      T  K+AIK++ +   FK+       RE++ ++ +
Sbjct: 33  ITISFPATEVVGHGSFGVVFTTVIQETNEKVAIKKVLQDKRFKN-------RELEIMKML 85

Query: 62  QHPNVIELIDIFMAYDN-----LNLVLEFLPTDLEVVIKDKSILFTPA---DIKAWMLMT 113
           QH N+I+L   F   D      LNL+L+++P  L   ++      TP    +IK +M   
Sbjct: 86  QHRNIIDLKYYFYEIDEREDVFLNLILDYMPQSLYQRLRHFVHQRTPMPRLEIKIYMYQL 145

Query: 114 LRGVYHCHRNF-ILHRDLKPNNLLFSPDG-QIKVADFGLARAIPAPHEILTSNVVTRWYR 171
            + + + H    + HRD+KP NLL  P+   +++ DFG A+ +  P E   S + +R+YR
Sbjct: 146 FKALNYLHHTANVCHRDIKPQNLLVDPNSWCLRLCDFGSAKQL-KPTEPNVSYICSRYYR 204

Query: 172 APELLFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWPE 231
           APEL+FGA +YT+ IDIWS G + AEL+L  P  PG++ +DQ+    + LGTPT ++   
Sbjct: 205 APELIFGATNYTNQIDIWSSGCVMAELLLGQPMFPGESGIDQLVEIIKILGTPTKQEICV 264

Query: 232 VS-SFMTYNKLQIYPPPSRDELRKRFIAASEYALDFMCGMLTMNPQKRWTAVQCLESDYF 290
           ++ ++M +   QI P P    L K F    E  +DF+      +P +R+ ++QCL + YF
Sbjct: 265 MNPNYMEHKFPQIKPIP----LAKVFKKEDEVTVDFLSNTFKYDPTQRYHSLQCLCTPYF 320

Query: 291 KEL 293
            E+
Sbjct: 321 DEI 323

>CAGL0L12650g 1357789..1359492 similar to sp|P39073 Saccharomyces
           cerevisiae YPL042c cyclin-dependent CTD kinase,
           hypothetical start
          Length = 567

 Score =  167 bits (424), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 104/310 (33%), Positives = 164/310 (52%), Gaps = 29/310 (9%)

Query: 2   KVNMEYTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEM 61
           K N E T  ++  E T   +Y   +     K  I+++  +    G+  SA RE+   +E+
Sbjct: 169 KRNSENTDNRRKAETT---MYYAIKKFKTEKDGIEQLHYT----GISQSACREMALCREL 221

Query: 62  QHPNVIELIDIFMAYDNLNLVLEFLPTDLEVVIKDKS----ILFTPADIKAWMLMTLRGV 117
            + ++ +L++IF+   ++ +V EF   DL  +I   S     +  P  I++ M   L GV
Sbjct: 222 DNNHLTKLVEIFLQKKSIYMVYEFAEHDLLQIIHFHSHPEKRMIPPRMIRSIMWQILDGV 281

Query: 118 YHCHRNFILHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSN---VVTRWYRAPE 174
            + H+N++LHRDLKP N++ + DG +K+ D GLAR      + + +    VVT WYRAPE
Sbjct: 282 SYLHQNWVLHRDLKPANIMVTMDGVVKIGDLGLARKFSNMLQTMYTGDKVVVTIWYRAPE 341

Query: 175 LLFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQN-----------DVDQMEVTFRALGT 223
           LL GA+HYT AID+W+VG IFAEL+   P   G+              +Q++   + LGT
Sbjct: 342 LLLGARHYTPAIDLWAVGCIFAELIGLQPIFKGEEAKMDSKKTVPFQANQLQRILKILGT 401

Query: 224 PTDRDWPEVSSFMTYNKLQIYPPPSRDELRKRFIAAS---EYALDFMCGMLTMNPQKRWT 280
           PT + WP +  +  Y +L  + P  RD L   F +A    ++AL  +  +L  NP +R  
Sbjct: 402 PTPKSWPHLQKYPEYEQLSKF-PKYRDNLPGWFHSAGGRDKHALSLLYHLLNYNPIERID 460

Query: 281 AVQCLESDYF 290
           A+  L+  YF
Sbjct: 461 AINALDHSYF 470

>CAGL0J04290g complement(400939..402012) similar to sp|P16892
           Saccharomyces cerevisiae YBL016w FUS3 or sp|P14681
           Saccharomyces cerevisiae YGR040w KSS1, start by
           similarity
          Length = 357

 Score =  163 bits (412), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 103/314 (32%), Positives = 164/314 (52%), Gaps = 23/314 (7%)

Query: 3   VNMEYTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEMQ 62
           ++ ++  +  +GEG Y VV       TG  +AIK+I   + K    +  +RE+K L+  Q
Sbjct: 9   ISSDFQLKSLLGEGAYGVVCSAVHKPTGEIVAIKKIVPFD-KPLFALRTLREIKILRRFQ 67

Query: 63  HPNVIELIDI-----FMAYDNLNLVLEFLPTDLEVVIKDKSILFTPADIKAWMLMTLRGV 117
           H N+I + DI     F  ++ + ++ E + TDL  VI  +++  T   I+ ++  TLR +
Sbjct: 68  HENIISIFDIQKPESFEKFNEVYIIQELMQTDLHRVIATQTL--TDDHIQYFIYQTLRAI 125

Query: 118 YHCHRNFILHRDLKPNNLLFSPDGQIKVADFGLARAIPA----PHEI----LTSNVVTRW 169
              H + ++HRDLKP+N+L + +  +KV DFGLAR I +     +E+    +T  V TRW
Sbjct: 126 KTLHGSNVIHRDLKPSNILINSNCDLKVCDFGLARIIDSGENGDNEVDKIGMTEYVATRW 185

Query: 170 YRAPELLFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTP--TDR 227
           YRAPE++     Y+ A+DIWS G I  EL L+ P  PG++   Q+ + F  +GTP  +D+
Sbjct: 186 YRAPEVMLTNAKYSRAMDIWSCGCILGELFLKRPLFPGKDYRHQLLLIFGLIGTPDSSDK 245

Query: 228 DWPEVSSFMTYN---KLQIYPPPSRDELRKRFIAASEYALDFMCGMLTMNPQKRWTAVQC 284
               + S         LQ YPP     L+K F   +   +D +  ML  +P++R +A   
Sbjct: 246 SMECIESRRARQYIASLQKYPPVR--PLQKAFPGVNPVGVDLLSRMLVFDPRERISADDA 303

Query: 285 LESDYFKELPPPSD 298
           L   Y      P D
Sbjct: 304 LAHPYLSTYHVPED 317

>Scas_623.11
          Length = 378

 Score =  162 bits (411), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 100/295 (33%), Positives = 166/295 (56%), Gaps = 28/295 (9%)

Query: 13  VGEGTYAVVYLGCQHSTGRKIAIKEI-KTSEFKDGLDMSAIREVKYLQEMQHPNVIELID 71
           +G+G++ +V+      T   +AIK++ +   FK+       RE++ ++ +QHPNVI L  
Sbjct: 53  IGKGSFGLVFCTTIRETDEVVAIKKVLQDRRFKN-------RELEIMKLIQHPNVINLKY 105

Query: 72  IFMAYD-----NLNLVLEFLPTDL-----EVVIKDKSILFTPADIKAWMLMTLRGVYHCH 121
            F   D      LNL+L+++P  L       V + +S+  +  +IK +M    + + + H
Sbjct: 106 YFYEKDVDDEVYLNLILDYMPQSLYQRLRHFVHQRQSM--SRLEIKFYMFQLFKSLNYLH 163

Query: 122 R-NFILHRDLKPNNLLFSPDG-QIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGA 179
               + HRD+KP N+L  P+   +K+ DFG A+ +  P E   S + +R+YRAPEL+FGA
Sbjct: 164 NAKNVCHRDIKPQNILVDPNSWNLKLCDFGSAKQL-KPTEPNVSYICSRYYRAPELIFGA 222

Query: 180 KHYTSAIDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWPEVS-SFMTY 238
            +Y++ IDIWS G + AEL+L  P  PG++ +DQ+    + LGTP+ ++   ++ ++M +
Sbjct: 223 TNYSNQIDIWSSGCVMAELLLGQPMFPGESGIDQLVEIIKILGTPSKQEICAMNPNYMEH 282

Query: 239 NKLQIYPPPSRDELRKRFIAASEYALDFMCGMLTMNPQKRWTAVQCLESDYFKEL 293
              QI P P    L K F    E  +DF+   L  +P +R+ ++QCL S YF EL
Sbjct: 283 KFPQIKPIP----LAKVFKKEDELTVDFLINTLKYDPMERFNSLQCLCSTYFDEL 333

>KLLA0A02497g 218592..219680 highly similar to sp|P14681
           Saccharomyces cerevisiae YGR040w KSS1 ser/thr protein
           kinase of the MAP kinase family, start by similarity
          Length = 362

 Score =  162 bits (409), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 101/304 (33%), Positives = 161/304 (52%), Gaps = 25/304 (8%)

Query: 13  VGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMS-AIREVKYLQEMQ-HPNVIELI 70
           VGEG Y  V       T  K+AIK+I+   F   + ++  +RE+K L+    H N+I ++
Sbjct: 19  VGEGAYGTVCSAIHKPTNTKVAIKKIQP--FSRSMFVTRTLRELKLLKFFHSHENIISVL 76

Query: 71  DI-----FMAYDNLNLVLEFLPTDLEVVIKDKSILFTPADIKAWMLMTLRGVYHCHRNFI 125
           DI     +  ++ + LV E + TDL+ +I  +++  +   I+ ++   LR +   H   +
Sbjct: 77  DIVRPTSWHKFEAVYLVQELMETDLQKIINQQNL--SEDHIQYFVYQILRALKSLHSAQV 134

Query: 126 LHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHE-------ILTSNVVTRWYRAPELLFG 178
           +HRDLKP+NLL + +  +KV DFGLAR + +  +        +T  V TRWYRAPE++  
Sbjct: 135 IHRDLKPSNLLLNSNCDLKVCDFGLARCLASSDQSRENMVGFMTEYVATRWYRAPEIMLS 194

Query: 179 AKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWPEVSSFMTY 238
            + YT+A+DIWS G I AE+++  P  PG++   Q+ +    LG+PT  D+ ++ S    
Sbjct: 195 FQEYTTAMDIWSCGCILAEMIMGKPLFPGKDYHHQLWIILEVLGSPTLEDFEQIKSKRAK 254

Query: 239 NKLQIYPP----PSRDELRKRFIAASEYALDFMCGMLTMNPQKRWTAVQCLESDYFKELP 294
             +   P     P  + L K     +  A+D +  MLT NP KR +AV+ LE  Y     
Sbjct: 255 EYISQLPMKKGIPWANVLNKE---VNPLAIDLLSKMLTFNPDKRISAVEALEHPYLATYH 311

Query: 295 PPSD 298
            P D
Sbjct: 312 DPDD 315

>Kwal_27.11830
          Length = 575

 Score =  163 bits (413), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 102/289 (35%), Positives = 155/289 (53%), Gaps = 28/289 (9%)

Query: 34  AIKEIKTSE------FKDGLDMSAIREVKYLQEMQHPNVIELIDIFMAYDNLNLVLEFLP 87
           AIK+ KT           G+  SA RE+   +E+++ ++  L++IF+ + ++ +V EF  
Sbjct: 190 AIKKFKTEREGVEQLHYTGISQSACREMSLCRELRNKHLTHLVEIFLEHKSIYMVSEFAE 249

Query: 88  TDLEVVIKDKS----ILFTPADIKAWMLMTLRGVYHCHRNFILHRDLKPNNLLFSPDGQI 143
            DL  +I   S     L  P  +K+ +   L GV + H+N+ILHRDLKP N++ + DG +
Sbjct: 250 HDLLQIIHFHSHPEKRLIPPRMLKSIIWQILDGVSYLHQNWILHRDLKPANIMVTVDGCV 309

Query: 144 KVADFGLARAIPAPHEILTSN---VVTRWYRAPELLFGAKHYTSAIDIWSVGVIFAELML 200
           K+ D GLAR      + L +    VVT WYRAPELL GA+HYT AID+W+VG IFAEL+ 
Sbjct: 310 KIGDLGLARKFHNMVQTLYAGDKVVVTIWYRAPELLLGARHYTPAIDLWAVGCIFAELIG 369

Query: 201 RIPYLPGQN-----------DVDQMEVTFRALGTPTDRDWPEVSSFMTYNKLQIYPPPSR 249
             P   G+              +Q++     LG+PT++ WP +  +  Y ++  + P  R
Sbjct: 370 LRPIFKGEEAKMDSKKSVPFQANQLQRILEVLGSPTEKSWPNIFKYPEYEQITKF-PRYR 428

Query: 250 DELRKRFIAA---SEYALDFMCGMLTMNPQKRWTAVQCLESDYFKELPP 295
           D L   + +A   ++ ALD +  +L  +P  R  AV  LE  YF    P
Sbjct: 429 DNLPVWYHSAGGRNKEALDLLYQLLRYDPITRIDAVDALEHPYFTNEEP 477

>KLLA0F17006g complement(1561859..1563106) gi|3127831|emb|CAA61157.1
           Kluyveromyces lactis protein kinase, start by similarity
          Length = 415

 Score =  160 bits (405), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 96/293 (32%), Positives = 165/293 (56%), Gaps = 24/293 (8%)

Query: 13  VGEGTYAVVYLGCQHSTGRKIAIKEI-KTSEFKDGLDMSAIREVKYLQEMQHPNVIELID 71
           VG G++ VV+      TG  + IK++ +   FK+       RE++ ++ + HPN+I+L  
Sbjct: 93  VGNGSFGVVFRTKVKETGEDVVIKKVLQDRRFKN-------RELEIMKLISHPNLIDLKY 145

Query: 72  IFMAYDN----LNLVLEFLPTDLEVVIKDKSILFTPAD---IKAWMLMTLRGVYHCHRNF 124
            F+   +    LNL+++++P  L   +K+   L  P D   IK +M    + + + H+  
Sbjct: 146 YFLEQSDQELYLNLIVDYMPMSLYQRLKEFISLHQPMDRYEIKIYMFQLFKSLNYLHQVV 205

Query: 125 -ILHRDLKPNNLLFSPDGQI-KVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKHY 182
            + HRD+KP N+L  PD  + K+ D G A+ +  P+E   S + +R+YRAPEL+FGA +Y
Sbjct: 206 NVCHRDIKPQNILVDPDTLLLKICDLGSAKQL-KPNEPNVSYICSRYYRAPELIFGATNY 264

Query: 183 TSAIDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWPEVSSFMTYNKL- 241
           T+ IDIWS G + AEL+L  P  PG++ +DQ+    + LGTPT  +   ++   + +K  
Sbjct: 265 TTKIDIWSAGCVMAELLLGQPIFPGESKIDQLVEIIKVLGTPTREEICSMNENYSEHKFP 324

Query: 242 QIYPPPSRDELRKRFIAASEYALDFMCGMLTMNPQKRWTAVQCL-ESDYFKEL 293
           QI P P    L + F   ++  +D +  ++  +P  R++A+QC+  S YF ++
Sbjct: 325 QIRPIP----LNRIFKKETQETIDLLYHIMKYDPNIRYSALQCMFNSTYFTDI 373

>ADR253W [1994] [Homologous to ScYMR139W (RIM11) - SH; ScYDL079C
           (MRK1) - SH] complement(1141943..1143085) [1143 bp, 380
           aa]
          Length = 380

 Score =  158 bits (400), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 103/304 (33%), Positives = 164/304 (53%), Gaps = 25/304 (8%)

Query: 3   VNMEYTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEI-KTSEFKDGLDMSAIREVKYLQEM 61
           V + Y   + VG G++ VV+      TG K+AIK++ +   FK+       RE++ ++ +
Sbjct: 28  VEITYPATEVVGHGSFGVVFTTVIEQTGEKVAIKKVLQDRRFKN-------RELEIMKLL 80

Query: 62  QHPNVIELIDIFMAYD------NLNLVLEFLPTDLEVVIKD--KSILFTPAD-IKAWMLM 112
           QHPNV++L   F   +       LNL+LE++P  L   ++      L  P D IK +M  
Sbjct: 81  QHPNVVDLRYHFYESEPQTNEVYLNLILEYMPQSLYQRLRHFVTGRLLMPRDEIKVYMFQ 140

Query: 113 TLRGVYHCHR-NFILHRDLKPNNLLFSPDG-QIKVADFGLARAIPAPHEILTSNVVTRWY 170
             + + + HR   + HRD+KP NLL      Q+K+ DFG A+ +  P E   S + +R+Y
Sbjct: 141 LFKSLNYLHRVARVCHRDIKPQNLLVDAGTLQLKLCDFGSAKQL-RPTEPNVSYICSRYY 199

Query: 171 RAPELLFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWP 230
           RAPEL+FGA +YT+ IDIWS G + AEL+L  P  PG+  + Q+    + LGTPT ++  
Sbjct: 200 RAPELIFGATNYTTQIDIWSTGCVMAELLLGQPMFPGEFVIVQLAEIIKILGTPTRQEIC 259

Query: 231 EVSSFMTYNKL-QIYPPPSRDELRKRFIAASEYALDFMCGMLTMNPQKRWTAVQCLESDY 289
            ++   + +K  QI P P    L K F     + +  +  +L  +P +R+ A+  + S Y
Sbjct: 260 AMNENYSDHKFPQIKPIP----LSKVFKREDAHTVQLLSDVLQYDPTRRFNALMAMCSSY 315

Query: 290 FKEL 293
           F E+
Sbjct: 316 FDEI 319

>KLLA0D11814g complement(1007240..1009021) similar to sp|P39073
           Saccharomyces cerevisiae YPL042c SSN3 cyclin-dependent
           CTD kinase, start by similarity
          Length = 593

 Score =  162 bits (409), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 103/289 (35%), Positives = 153/289 (52%), Gaps = 28/289 (9%)

Query: 34  AIKEIKTS----EFKDGLDMSAIREVKYLQEMQHPNVIELIDIFMAYDNLNLVLEFLPTD 89
           AIK+ KT     E   G+  SA RE+   +E+ + ++ +L++IF+   ++ +V EF   D
Sbjct: 209 AIKKFKTEREGVEHYTGISQSACREMSLCRELDNNHLTKLVEIFLEKKSIYMVSEFAEHD 268

Query: 90  LEVVIKDKS----ILFTPADIKAWMLMTLRGVYHCHRNFILHRDLKPNNLLFSPDGQIKV 145
           L  +I   S     L  P  +K+ M   L GV + H+N+ILHRDLKP N++ + DG +K+
Sbjct: 269 LLQIIHFHSHPEKRLIPPRMLKSIMWQILDGVSYLHQNWILHRDLKPANIMVTVDGCVKI 328

Query: 146 ADFGLARAIPAPHEILTSN---VVTRWYRAPELLFGAKHYTSAIDIWSVGVIFAELMLRI 202
            D GLAR      + L +    +VT WYRAPEL+ GA+HYT AID+W+VG IFAEL+   
Sbjct: 329 GDLGLARKFNNMVQTLYTGDKVIVTIWYRAPELILGARHYTPAIDLWAVGCIFAELIGLR 388

Query: 203 PYLPGQN-----------DVDQMEVTFRALGTPTDRDWPEVSSFMTYNKLQIYP-PPSRD 250
           P   G+              +Q +     +G+P  + WP + S+  Y  LQ+   P  RD
Sbjct: 389 PIFKGEEAKMESKKSVLFQANQFQKILEVMGSPDHKIWPNIDSYPEY--LQLAKMPKYRD 446

Query: 251 ELRKRFIAAS---EYALDFMCGMLTMNPQKRWTAVQCLESDYFKELPPP 296
            L   +  A    + ALD +  +L  +P KR  A+  L+  YF    PP
Sbjct: 447 NLTAWYQTAGGKDKTALDILYRLLQYDPIKRIDAIDALDHVYFTNGDPP 495

>CAGL0J00539g 47095..48561 highly similar to sp|Q00772 Saccharomyces
           cerevisiae YHR030c SLT2, hypothetical start
          Length = 488

 Score =  159 bits (402), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 104/301 (34%), Positives = 152/301 (50%), Gaps = 14/301 (4%)

Query: 11  KKVGEGTYAVVYLG--CQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEMQ-HPNVI 67
           K++G G Y +V      + S    +AIK++     K  L   ++RE+K L+  + H N+ 
Sbjct: 25  KEIGHGAYGIVCSARFTEASEETTVAIKKVTNIFSKTLLCKRSLRELKLLRHFRGHKNIT 84

Query: 68  ELIDIFMAY------DNLNLVLEFLPTDLEVVIKDKSILFTPADIKAWMLMTLRGVYHCH 121
            L D+ + +      + L L  E +  D+  +IK    L T A  +++    L G+ + H
Sbjct: 85  CLYDMDIVFYPDGSINGLYLYEELMECDMHQIIKSGQAL-TDAHYQSFTYQILCGLKYIH 143

Query: 122 RNFILHRDLKPNNLLFSPDGQIKVADFGLARAIPAP----HEILTSNVVTRWYRAPELLF 177
              +LHRDLKP NLL + D Q+K+ DFGLAR         ++ LT  V TRWYRAPE++ 
Sbjct: 144 SADVLHRDLKPGNLLVNADCQLKICDFGLARGYSENPEENNQFLTEYVATRWYRAPEIML 203

Query: 178 GAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWPEVSSFMT 237
             + YT AIDIWS G I AE +   P   G++ VDQ+    + LGTP D     V S   
Sbjct: 204 SYQGYTKAIDIWSTGCILAEFLGGKPLFKGKDYVDQLNRILQVLGTPPDETLRRVGSKNV 263

Query: 238 YNKLQIYPPPSRDELRKRFIAASEYALDFMCGMLTMNPQKRWTAVQCLESDYFKELPPPS 297
            + +       +    + F  A+E ALD + GML  +PQKR T  + LE  Y      P+
Sbjct: 264 QDYIHQLGYIQKIPFSELFPNANEDALDLLEGMLAFDPQKRITVDKALEHPYLTIWHDPA 323

Query: 298 D 298
           D
Sbjct: 324 D 324

>Kwal_14.1416
          Length = 365

 Score =  156 bits (395), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 102/303 (33%), Positives = 152/303 (50%), Gaps = 20/303 (6%)

Query: 13  VGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEMQ-HPNVIELID 71
           VGEG Y  V       +G K+AIK+I+    K+      +RE+K L+    H N+I ++D
Sbjct: 19  VGEGAYGTVCSAVHKPSGTKVAIKKIQPFS-KEMFVTRTLRELKLLKLFHSHENIISVLD 77

Query: 72  IFM-----AYDNLNLVLEFLPTDLEVVIKDKSILFTPADIKAWMLMTLRGVYHCHRNFIL 126
           +        +  + LV E + TDL  VI       +   I+ +    LR +   H   ++
Sbjct: 78  VVRPTSMDKFQAVYLVQELMETDLHKVISSGGASLSDDHIQYFTYQILRALKAIHSAQVI 137

Query: 127 HRDLKPNNLLFSPDGQIKVADFGLARA-IPAPHE------ILTSNVVTRWYRAPELLFGA 179
           HRD+KP+NLL + +  +KV DFGLAR  I + H        +T  V TRWYRAPE++   
Sbjct: 138 HRDIKPSNLLLNSNCDLKVCDFGLARCLISSTHSRQNLVGFMTEYVATRWYRAPEIMLTF 197

Query: 180 KHYTSAIDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWPEVSSFMTYN 239
           + YT A+DIWS G I AE++   P  PG++   Q+ +   ALGTP+  D+  ++S     
Sbjct: 198 QQYTVAMDIWSCGCILAEMITGKPLFPGRDYHHQLWLILEALGTPSYEDFENINS--KRA 255

Query: 240 KLQIYPPPSRDELRKRFIAASE----YALDFMCGMLTMNPQKRWTAVQCLESDYFKELPP 295
           K  I   P R +L  + +   +     A+D +  MLT NP KR +A + L   Y      
Sbjct: 256 KEYIANLPLRQKLPWQVVLQKQDINPQAVDLLDKMLTFNPDKRISAAEALAHPYLSVYHD 315

Query: 296 PSD 298
           P D
Sbjct: 316 PED 318

>ACL191C [858] [Homologous to ScYGR040W (KSS1) - SH] (26475..27572)
           [1098 bp, 365 aa]
          Length = 365

 Score =  153 bits (386), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 94/296 (31%), Positives = 152/296 (51%), Gaps = 20/296 (6%)

Query: 13  VGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEMQ-HPNVIELID 71
           +GEG Y +V       TG K+AIK+I+    +       +RE+K L+    H N+I ++D
Sbjct: 19  IGEGAYGIVCSAIHKPTGTKVAIKKIQPFT-RPMFVTRTLRELKLLKFFHSHENIISVLD 77

Query: 72  I-----FMAYDNLNLVLEFLPTDLEVVIKDKSILFTPADIKAWMLMTLRGVYHCHRNFIL 126
           I     +  ++ + LV E + TDL+ +I   +   +   I+ +    LR +   H   ++
Sbjct: 78  IVRPTSYQDFEAVYLVQELMETDLQRIISQPNSFLSDDHIQYFTYQILRALKSLHSAQVI 137

Query: 127 HRDLKPNNLLFSPDGQIKVADFGLARAIPAPHE-------ILTSNVVTRWYRAPELLFGA 179
           HRDLKP+NLL +    +K+ DFGL+R + +           +T  V TRWYRAPE++   
Sbjct: 138 HRDLKPSNLLLNSSCDLKLCDFGLSRCLASSDRSRENMVGFMTEYVATRWYRAPEIMLSF 197

Query: 180 KHYTSAIDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWPEVSSFMTYN 239
           + YT+A+DIWS G I AE++   P  PG++   Q+ +    LGTP+  D+ ++ S     
Sbjct: 198 QEYTTAMDIWSCGCILAEMISGKPLFPGRDYHHQLWIILEILGTPSFEDFEQIKS--KRA 255

Query: 240 KLQIYPPPSRDELRKRFIAASE----YALDFMCGMLTMNPQKRWTAVQCLESDYFK 291
           K  I   P R ++      ++      A+D +  MLT NP KR +A   L+  Y +
Sbjct: 256 KAYIANLPMRPKIPWNVALSTNDINPLAMDLLDKMLTFNPDKRISAADALKHPYLE 311

>Scas_667.18
          Length = 437

 Score =  154 bits (388), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 107/317 (33%), Positives = 157/317 (49%), Gaps = 34/317 (10%)

Query: 11  KKVGEGTYAVVYLGCQH---STGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEMQ-HPNV 66
           K +G+G+Y VV     +   +    +AIK++     K+ L   AIRE+K++   Q H N+
Sbjct: 82  KVLGKGSYGVVCSAMDNKNPANAYPVAIKKVTNIFQKEILLKRAIRELKFMNFFQGHKNI 141

Query: 67  IELIDIFMA-----YDNLNLVLEFLPTDLEVVIKDKSILFTPADIKAWMLMTLRGVYHCH 121
           + LID+ +      YD L    E +  DL  VI   SI  T   I+ +M   L G+ + H
Sbjct: 142 VNLIDLEIINENSPYDGLYCYQELIDYDLAKVIHS-SIKLTEFHIQYFMYQILSGLKYIH 200

Query: 122 RNFILHRDLKPNNLLFSPDGQIKVADFGLARAI-------------PAPHEILTSNVVTR 168
              ++HRDLKP N+L + +G +K+ DFGLAR I             P  H+I T+ V TR
Sbjct: 201 SADVIHRDLKPGNILCTLNGNLKICDFGLARGINPKFYNDNGNLASPKLHDI-TNYVATR 259

Query: 169 WYRAPELLFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRD 228
           WYRAPEL+   K YT AID+WSVG I AE   R P   G + + Q+    + LG P+ R 
Sbjct: 260 WYRAPELILSHKMYTKAIDLWSVGCILAEFYGRRPIFMGHDTLHQVYEIVKILGPPSQRL 319

Query: 229 WPEVSSFMTYN-------KLQIYPPPSRDELRKRFIAASEYALDFMCGMLTMNPQKRWTA 281
             + +S   YN       KL    P     L   +  AS  ++  +  +L  NP++R+  
Sbjct: 320 LSQFASVKAYNIFNNNLAKLHWNSPIDWKTL---YPEASNSSIHLLQNLLKWNPRERFDV 376

Query: 282 VQCLESDYFKELPPPSD 298
            Q +   +  E+  P D
Sbjct: 377 EQAITHPFLNEVRTPMD 393

>YGR040W (KSS1) [2006] chr7 (575400..576506) Serine/threonine
           protein kinase involved in the filamentous and invasive
           growth pathway, member of the MAP kinase family [1107
           bp, 368 aa]
          Length = 368

 Score =  152 bits (383), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 101/305 (33%), Positives = 158/305 (51%), Gaps = 21/305 (6%)

Query: 13  VGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMS-AIREVKYLQEM-QHPNVIELI 70
           +GEG Y  V       +G K+AIK+I+   F   L ++  IRE+K L+   +H N+I ++
Sbjct: 19  IGEGAYGTVCSAIHKPSGIKVAIKKIQP--FSKKLFVTRTIREIKLLRYFHEHENIISIL 76

Query: 71  DIF--MAYDNLN---LVLEFLPTDLEVVIKDKSILFTPAD---IKAWMLMTLRGVYHCHR 122
           D    ++ D LN   LV E + TDL+ VI +++  F+      ++ +    LR +   H 
Sbjct: 77  DKVRPVSIDKLNAVYLVEELMETDLQKVINNQNSGFSTLSDDHVQYFTYQILRALKSIHS 136

Query: 123 NFILHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHE-------ILTSNVVTRWYRAPEL 175
             ++HRD+KP+NLL + +  +KV DFGLAR + +  +        +T  V TRWYRAPE+
Sbjct: 137 AQVIHRDIKPSNLLLNSNCDLKVCDFGLARCLASSSDSRETLVGFMTEYVATRWYRAPEI 196

Query: 176 LFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWPEVSSF 235
           +   + YT+A+DIWS G I AE++   P  PG++   Q+ +    LGTP+  D+ ++ S 
Sbjct: 197 MLTFQEYTTAMDIWSCGCILAEMVSGKPLFPGRDYHHQLWLILEVLGTPSFEDFNQIKSK 256

Query: 236 MTYNKLQIYP--PPSRDELRKRFIAASEYALDFMCGMLTMNPQKRWTAVQCLESDYFKEL 293
                +   P  PP   E        +   +D +  ML  NP KR +A + L   Y    
Sbjct: 257 RAKEYIANLPMRPPLPWETVWSKTDLNPDMIDLLDKMLQFNPDKRISAAEALRHPYLAMY 316

Query: 294 PPPSD 298
             PSD
Sbjct: 317 HDPSD 321

>Scas_683.6
          Length = 377

 Score =  151 bits (381), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 97/304 (31%), Positives = 156/304 (51%), Gaps = 20/304 (6%)

Query: 13  VGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMS-AIREVKYLQEMQ-HPNVIELI 70
           +GEG Y  V       +G K+AIK+I+   F   + ++  +RE+K L     H N+I ++
Sbjct: 19  IGEGAYGTVCSAIHKPSGIKVAIKKIQP--FSKAMFVTRTLREIKLLTYFNNHENIISIL 76

Query: 71  D----IFM-AYDNLNLVLEFLPTDLEVVIKDKSI--LFTPADIKAWMLMTLRGVYHCHRN 123
           D    I M  +  + LV E + TDL+ VI + +     T   I+ +    LR +   H  
Sbjct: 77  DKIKPISMDKFQAVYLVQELMETDLQRVISNNNTNKSLTDDHIQYFTYQILRALKSIHSA 136

Query: 124 FILHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHE-------ILTSNVVTRWYRAPELL 176
            ++HRDLKP+NLL + +  +K+ DFGL+R + + ++        +T  V TRWYRAPE++
Sbjct: 137 KVIHRDLKPSNLLLNSNCDLKICDFGLSRCLTSSNDSKKTLVGFMTEYVATRWYRAPEIM 196

Query: 177 FGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWPEVSSFM 236
              + YT+A+DIWSVG I AE++   P  PG++   Q+ +    LGTP+  D+ ++ S  
Sbjct: 197 LTFQEYTTAMDIWSVGCILAEMVTGRPLFPGRDYHHQLWLILEVLGTPSLEDFEQIKSKR 256

Query: 237 TYNKLQIYP--PPSRDELRKRFIAASEYALDFMCGMLTMNPQKRWTAVQCLESDYFKELP 294
               +   P  PP   ++       +   +D +  ML  NP KR +A + L+  Y     
Sbjct: 257 AREYIANLPLKPPMAWDIVLSNTNLNPDLIDLLTKMLMFNPNKRISAAEALQHPYLSTYH 316

Query: 295 PPSD 298
            P D
Sbjct: 317 DPQD 320

>Scas_713.38
          Length = 432

 Score =  151 bits (381), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 98/304 (32%), Positives = 160/304 (52%), Gaps = 16/304 (5%)

Query: 1   MKVNMEYTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQE 60
            ++   YT    VG G + +V       T + +AIK+I        L     RE+K L+ 
Sbjct: 17  FEITNRYTDLNPVGMGAFGLVCSATDTLTSQPVAIKKIMKPFSTAVLAKRTYRELKLLKH 76

Query: 61  MQHPNVIELIDIFMA-YDNLNLVLEFLPTDLEVVIKDKSILFTPADIKAWMLMTLRGVYH 119
           ++H N+I L DIF++  +++  V E   TDL  +++ + +      ++ ++   LRG+ +
Sbjct: 77  LRHENLICLQDIFLSPLEDIYFVTELQGTDLHRLLQTRPL--EKQFVQYFLYQILRGLKY 134

Query: 120 CHRNFILHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGA 179
            H   ++HRDLKP+N+L + +  +K+ DFGLAR I  P   +T  V TR+YRAPE++   
Sbjct: 135 VHSVGVIHRDLKPSNILINENCDLKICDFGLAR-IQDPQ--MTGYVSTRYYRAPEIMLTW 191

Query: 180 KHYTSAIDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWPE--VSSFMT 237
           + Y   +DIWS G IFAE++   P  PG++ V Q  +    LG+P     PE  +++  +
Sbjct: 192 QKYDVEVDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSP-----PEDVINTICS 246

Query: 238 YNKLQ-IYPPPSRDEL--RKRFIAASEYALDFMCGMLTMNPQKRWTAVQCLESDYFKELP 294
            N L+ +   P RD +   +RF      A+D +  ML  +P+KR TA + L   Y     
Sbjct: 247 ENTLKFVTSLPHRDPIPFSERFKTVEPDAVDLLGKMLVFDPKKRVTAAEALAHPYLAPYH 306

Query: 295 PPSD 298
            P+D
Sbjct: 307 DPTD 310

>Scas_688.14
          Length = 479

 Score =  151 bits (382), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 100/301 (33%), Positives = 149/301 (49%), Gaps = 14/301 (4%)

Query: 11  KKVGEGTYAVVYLG--CQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEMQ-HPNVI 67
           K++G G Y +V      +      +AIK++     K  L   ++RE+K L+  + H N+ 
Sbjct: 27  KEIGHGAYGIVCSARFAEAVEDTTVAIKKVTNVFSKSLLCKRSLRELKLLRHFRGHKNIT 86

Query: 68  ELIDIFM------AYDNLNLVLEFLPTDLEVVIKDKSILFTPADIKAWMLMTLRGVYHCH 121
            L D+ +       ++ L L  E +  D+  +IK    L T A  ++++   L G+ + H
Sbjct: 87  CLYDMDIVFYPDGTFNGLYLYEELMECDMHQIIKSSQPL-TDAHYQSFIYQILCGLKYIH 145

Query: 122 RNFILHRDLKPNNLLFSPDGQIKVADFGLARAIPAP----HEILTSNVVTRWYRAPELLF 177
              +LHRDLKP NLL + D Q+K+ DFGLAR         ++ LT  V TRWYRAPE++ 
Sbjct: 146 SADVLHRDLKPGNLLVNADCQLKICDFGLARGYSENPVENNQFLTEYVATRWYRAPEIML 205

Query: 178 GAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWPEVSSFMT 237
             + YT AIDIWS G I AE +   P   G++ VDQ+    + LGTP D     + S   
Sbjct: 206 SYQGYTKAIDIWSTGCILAEFLGGKPIFKGKDYVDQLTRILQVLGTPPDETLRRIGSKNV 265

Query: 238 YNKLQIYPPPSRDELRKRFIAASEYALDFMCGMLTMNPQKRWTAVQCLESDYFKELPPPS 297
            + +       +      +  A+  ALD +  ML  +PQKR T  + LE  Y      PS
Sbjct: 266 QDYIHQLGYIPKVPFVNLYPDANPQALDLLEKMLAFDPQKRITTDEALEHPYLSIWHDPS 325

Query: 298 D 298
           D
Sbjct: 326 D 326

>CAGL0D01694g complement(176981..178279) similar to sp|P41808
           Saccharomyces cerevisiae YPR054w SMK1
           sporulation-specific MAP kinase, hypothetical start
          Length = 432

 Score =  150 bits (379), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 99/311 (31%), Positives = 157/311 (50%), Gaps = 28/311 (9%)

Query: 13  VGEGTYAVVYLGCQHSTGRK------IAIKEIKTSEFKDGLDMSAIREVKYLQEMQ-HPN 65
           +G+G+Y VV    +H    +      +AIK+I    ++  L   AIRE+K++   + H +
Sbjct: 75  LGKGSYGVV-CSAKHKLDNEDQEQFTVAIKKITNIFYRKILLKRAIREIKFMNYFKGHKH 133

Query: 66  VIELIDIFMA----YDNLNLVLEFLPTDLEVVIKDKSILFTPADIKAWMLMTLRGVYHCH 121
           ++ LIDI +     YD L    E +  DL  VI   S+  +   I+ ++   L GV + H
Sbjct: 134 IVNLIDIEIVQDKPYDGLYCYQELIDYDLARVIHS-SVQLSEFHIQHFIYQILCGVKYIH 192

Query: 122 RNFILHRDLKPNNLLFSPDGQIKVADFGLARAI--------PAPHEILTSNVVTRWYRAP 173
              ++HRDLKP N+L + +G +K+ DFGLAR +          P+EI T+ V TRWYRAP
Sbjct: 193 SADVIHRDLKPGNILCTVNGCLKICDFGLARGVAKQFVNKNSKPNEI-TNYVATRWYRAP 251

Query: 174 ELLFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWPEVS 233
           EL+     YT ++D+WSVG I AE   R P   G++ + Q+    + LGTP+     +  
Sbjct: 252 ELILSNNEYTKSVDMWSVGCILAEFYGRRPIFMGKDSIHQVYEIKKILGTPSRSLLVKYG 311

Query: 234 SFMTYNKLQIYPPPSRDELRKR------FIAASEYALDFMCGMLTMNPQKRWTAVQCLES 287
           +   +N        + D L+        +  AS  ALD +  +L   P+ R   +Q LE 
Sbjct: 312 TLKAWNLFGHNSNHNLDNLKSGMPWSTVYPMASATALDLIDKLLQWEPESRLNVLQSLEH 371

Query: 288 DYFKELPPPSD 298
            + + +  P+D
Sbjct: 372 QFVQSVRKPND 382

>Kwal_56.23841
          Length = 432

 Score =  150 bits (378), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 98/304 (32%), Positives = 158/304 (51%), Gaps = 16/304 (5%)

Query: 1   MKVNMEYTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQE 60
            ++   YT    VG G + +V       T + +AIK+I        L     RE+K L+ 
Sbjct: 17  FEITNRYTDLNPVGMGAFGLVCSANDTYTNQSVAIKKIMKPFSTAVLAKRTYRELKLLKH 76

Query: 61  MQHPNVIELIDIFMA-YDNLNLVLEFLPTDLEVVIKDKSILFTPADIKAWMLMTLRGVYH 119
           ++H N+I L DIF++  +++  V E   TDL  +++ + +      ++ ++   LRG+ +
Sbjct: 77  LRHENLICLEDIFLSPLEDIYFVTELQGTDLHRLLQTRPL--EKQFVQYFLYQILRGLKY 134

Query: 120 CHRNFILHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGA 179
            H   ++HRDLKP+N+L + +  +K+ DFGLAR I  P   +T  V TR+YRAPE++   
Sbjct: 135 VHSAGVIHRDLKPSNILINENCDLKICDFGLAR-IQDPQ--MTGYVSTRYYRAPEIMLTW 191

Query: 180 KHYTSAIDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWPE--VSSFMT 237
           + Y   +DIWS G IFAE++   P  PG++ V Q  +    LG+P     PE  +++  +
Sbjct: 192 QKYNVEVDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSP-----PEDVINTICS 246

Query: 238 YNKLQ-IYPPPSRDEL--RKRFIAASEYALDFMCGMLTMNPQKRWTAVQCLESDYFKELP 294
            N L+ +   P RD +   +RF      A+D +  ML  +P KR TA   L   Y     
Sbjct: 247 VNTLKFVTSLPHRDPVPFSERFKNVEPDAVDLLEKMLVFDPNKRITAADALSHPYLAPYH 306

Query: 295 PPSD 298
            P+D
Sbjct: 307 DPTD 310

>AGL249C [4063] [Homologous to ScYPL042C (SSN3) - SH]
           (234347..236092) [1746 bp, 581 aa]
          Length = 581

 Score =  152 bits (384), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 100/290 (34%), Positives = 151/290 (52%), Gaps = 28/290 (9%)

Query: 34  AIKEIKTSE------FKDGLDMSAIREVKYLQEMQHPNVIELIDIFMAYDNLNLVLEFLP 87
           AIK+ KT           G+  SA RE+   +E+ + ++ +L++IF+   ++ +V EF  
Sbjct: 193 AIKKFKTEREGVEQLHYTGISQSACREMSLCRELDNKHLTKLVEIFLERKSIYMVSEFAE 252

Query: 88  TDLEVVIKDKS----ILFTPADIKAWMLMTLRGVYHCHRNFILHRDLKPNNLLFSPDGQI 143
            DL  +I   S     L  P  +K+ M   L GV + H+N+ILHRDLKP N++ + DG +
Sbjct: 253 HDLLQIIHFHSHPEKRLIAPRMLKSIMWQILDGVSYLHQNWILHRDLKPANIMVTVDGCV 312

Query: 144 KVADFGLARAIPAPHEILTSN---VVTRWYRAPELLFGAKHYTSAIDIWSVGVIFAELML 200
           K+ D GLAR      + L +    VVT WYRAPELL GA+HY+ AID+W+VG IF+EL+ 
Sbjct: 313 KIGDLGLARKFYNLVQTLYTGDKVVVTIWYRAPELLLGARHYSPAIDLWAVGCIFSELIG 372

Query: 201 RIPYLPGQN-----------DVDQMEVTFRALGTPTDRDWPEVSSFMTYNKLQIYPPPSR 249
             P   G+              +Q++     LGTPT   WP +  +  Y +L  +    R
Sbjct: 373 LRPIFKGEEAKMDSKKSVPFQGNQLQRILEVLGTPTHHTWPNIHKYPEYEQLSKF-SKYR 431

Query: 250 DELRKRFIAAS---EYALDFMCGMLTMNPQKRWTAVQCLESDYFKELPPP 296
           D L   + ++    + AL  +  +L  +P  R  A+  LE +YF    PP
Sbjct: 432 DNLSVWYHSSGGRDKAALSLLYSLLKYDPITRIDAIDALEHEYFTNNDPP 481

>Kwal_23.5576
          Length = 504

 Score =  151 bits (381), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 103/314 (32%), Positives = 156/314 (49%), Gaps = 20/314 (6%)

Query: 4   NMEYTKEKK------VGEGTYAVVYLG--CQHSTGRKIAIKEIKTSEFKDGLDMSAIREV 55
           N E+T +K+      +G G Y +V      + +    +AIK++     K  L   ++RE+
Sbjct: 14  NQEFTVDKRFQLIKEIGHGAYGIVCSARFIEAAEETNVAIKKVTNVFSKTLLCKRSLREL 73

Query: 56  KYLQEMQ-HPNVIELIDIFM------AYDNLNLVLEFLPTDLEVVIKDKSILFTPADIKA 108
           K L+  + H N+  L D+ +       ++ L L  E +  D+  +IK    L T A  ++
Sbjct: 74  KLLRHFRGHKNITCLYDMDIVFSPNNTFNGLYLYEELMECDIHQIIKSGQPL-TDAHYQS 132

Query: 109 WMLMTLRGVYHCHRNFILHRDLKPNNLLFSPDGQIKVADFGLARAIPAP----HEILTSN 164
           ++   L  + + H   +LHRDLKP NLL + D Q+KV DFGLAR         ++ LT  
Sbjct: 133 FIYQLLCALKYIHSADVLHRDLKPGNLLVNADCQLKVCDFGLARGYSENPVENNQFLTEY 192

Query: 165 VVTRWYRAPELLFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTP 224
           V TRWYRAPE++   + YT AIDIWS G I AEL+   P   G++ VDQ+    + LGTP
Sbjct: 193 VATRWYRAPEIMLSYQGYTKAIDIWSCGCILAELLGGKPIFKGKDYVDQLNRILQVLGTP 252

Query: 225 TDRDWPEVSSFMTYNKLQIYPPPSRDELRKRFIAASEYALDFMCGMLTMNPQKRWTAVQC 284
            +     + S    + +       +      +  A+  ALD +  MLT +PQKR T  + 
Sbjct: 253 PEETLERIGSKNVQDYIHQLGYIPKVPFVTLYPQANVQALDLLEKMLTFDPQKRITVEEA 312

Query: 285 LESDYFKELPPPSD 298
           LE  Y      P+D
Sbjct: 313 LEHPYLSIWHDPTD 326

>ADL315C [1426] [Homologous to ScYPR054W (SMK1) - SH]
           (146098..147402) [1305 bp, 434 aa]
          Length = 434

 Score =  149 bits (376), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 101/299 (33%), Positives = 153/299 (51%), Gaps = 22/299 (7%)

Query: 13  VGEGTYAVVYLGCQHSTGR---KIAIKEIKTSEFKDGLDMSAIREVKYLQEMQ-HPNVIE 68
           +G+G+Y  V     +       +IAIK+I     ++ L   AIRE+K++   + H N++ 
Sbjct: 79  LGKGSYGTVVSAIDNLNANYPIRIAIKKITNIFQREVLLKRAIRELKFMHYFKGHKNIVS 138

Query: 69  LIDIFMA----YDNLNLVLEFLPTDLEVVIKDKSILFTPADIKAWMLMTLRGVYHCHRNF 124
           LI++ +     YD L    E +  DL  VI   ++ F+   IK +    L GV + H   
Sbjct: 139 LINLEIVNEKPYDGLYCYQELIDYDLARVIHS-NVQFSEFHIKHFTYQILCGVKYIHSAD 197

Query: 125 ILHRDLKPNNLLFSPDGQIKVADFGLARAI-PAPHEILTSN-----VVTRWYRAPELLFG 178
           ++HRDLKP N+L S  GQ+K+ DFGLAR I P      TSN     V TRWYRAPEL+  
Sbjct: 198 VIHRDLKPGNILCSISGQLKICDFGLARGISPLFTNTKTSNHITNYVATRWYRAPELILS 257

Query: 179 AKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWPEVSSFMTY 238
            K Y  +ID+W++G I AE   R P   GQ+ + Q+    + LGTP+     +  S   Y
Sbjct: 258 HKRYNKSIDMWAIGCILAEFYGRKPIFMGQDSMHQISEIVKVLGTPSRDTIIKYGSSRAY 317

Query: 239 NKLQIYPPPSRDELR----KRFIAASEYALDFMCGMLTMNPQKRWTAVQCLESDYFKEL 293
           +   I+ PP     +    + +  A   ALD +  +L  +P +R T  + +E D+ K +
Sbjct: 318 D---IFCPPKPQYAKIPWAEIYPFAGPDALDLIERLLDWDPDRRLTVEEAIEHDFVKSV 373

>CAGL0K04169g 383738..384934 similar to sp|P14681 Saccharomyces
           cerevisiae YGR040w KSS1, start by similarity
          Length = 398

 Score =  147 bits (371), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 100/334 (29%), Positives = 155/334 (46%), Gaps = 46/334 (13%)

Query: 6   EYTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLD----------------- 48
           EY     VGEG+Y +V       TG K+AIK I+  +     D                 
Sbjct: 12  EYKLVDLVGEGSYGIVCSATHLPTGNKVAIKRIRFPDSPPSDDGQGVPRLEEDDEHDNIA 71

Query: 49  ----MSAIREVKYLQEMQ-HPNVIELIDIFMAYDNLN-----LVLEFLPTDLEVVIKDKS 98
               +  IRE+K L     H N+I + +      ++N     LV E + TDL  ++   +
Sbjct: 72  KVALIRTIREIKILSHFNNHENIITIFEKIKPMQSINFKEIYLVQELMETDLSRILASSN 131

Query: 99  ILFTPADIKAWMLMTLRGVYHCHRNFILHRDLKPNNLLFSPDGQIKVADFGLARAIPAPH 158
            L T   I+ ++   LR +   H   ++HRDLKP+N+L + +  +K+ DFGLAR      
Sbjct: 132 TL-TVDHIQYFLYQILRALKAIHSAKVIHRDLKPSNILLNSNCDLKICDFGLARTYDPDD 190

Query: 159 E----------ILTSNVVTRWYRAPELLFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQ 208
           +           LT  V TRWYRAPE++   + Y++AIDIWS G + AE++ R P  PG+
Sbjct: 191 DASTMNGNNVGFLTEYVATRWYRAPEIMLNFQDYSTAIDIWSCGCVLAEMLFRKPIFPGK 250

Query: 209 NDVDQMEVTFRALGTPTDRDWPEVSSFMTYNKLQIY----PPPSRDELRKRFIAASEYAL 264
           +   Q+ +    LGTP+    PE    + Y + + Y    P   + +  +     +E  L
Sbjct: 251 DYHHQLLLILDTLGTPS----PEDIEAINYGRAKEYILSLPHFPKKDWSQLLGTDNEMLL 306

Query: 265 DFMCGMLTMNPQKRWTAVQCLESDYFKELPPPSD 298
           D +  ++  NP++R TA Q LE  +      P D
Sbjct: 307 DILDKLMIFNPKRRITAEQALEHPFLATYHDPKD 340

>KLLA0F20053g 1867209..1868543 highly similar to sp|P32485
           Saccharomyces cerevisiae YLR113w HOG1 ser/thr protein
           kinase of MAP kinase (MAPK) family, start by similarity
          Length = 444

 Score =  148 bits (373), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 97/302 (32%), Positives = 157/302 (51%), Gaps = 12/302 (3%)

Query: 1   MKVNMEYTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQE 60
            ++   YT    VG G + +V       T + +AIK+I        L     RE+K L+ 
Sbjct: 16  FEITNRYTNLNPVGMGAFGLVCSATDTLTSQPVAIKKIMKPFSTSVLAKRTYRELKLLKH 75

Query: 61  MQHPNVIELIDIFMA-YDNLNLVLEFLPTDLEVVIKDKSILFTPADIKAWMLMTLRGVYH 119
           ++H N+I L DIF++  +++  V E   TDL  +++ + +      ++ ++   LRG+ +
Sbjct: 76  LRHENLICLEDIFLSPLEDIYFVTELQGTDLHRLLQTRPL--EKQFVQYFLYQILRGLKY 133

Query: 120 CHRNFILHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGA 179
            H   ++HRDLKP+N+L + +  +K+ DFGLAR I  P   +T  V TR+YRAPE++   
Sbjct: 134 VHSAGVIHRDLKPSNILINENCDLKICDFGLAR-IQDPQ--MTGYVSTRYYRAPEIMLTW 190

Query: 180 KHYTSAIDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWPEVSSFMTYN 239
           + Y   +DIWS G IFAE++   P  PG++ V Q  +    LG+P  +D   + +  + N
Sbjct: 191 QKYNVEVDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSPP-KDV--IDTICSEN 247

Query: 240 KLQ-IYPPPSRDEL--RKRFIAASEYALDFMCGMLTMNPQKRWTAVQCLESDYFKELPPP 296
            L+ +   P RD +    RF      A+D +  ML  +P+KR TA   L   Y      P
Sbjct: 248 TLKFVTSLPHRDPVPFSSRFQNLEPDAIDLLEKMLVFDPKKRITAADALAHPYLSPYHDP 307

Query: 297 SD 298
           +D
Sbjct: 308 TD 309

>Kwal_27.12559
          Length = 414

 Score =  147 bits (370), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 104/313 (33%), Positives = 161/313 (51%), Gaps = 34/313 (10%)

Query: 13  VGEGTYAVVYLGC---QHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEMQ-HPNVIE 68
           +G+G+Y VV       +    R++AIK++     ++ L   AIRE+K+L   + H N++ 
Sbjct: 72  LGKGSYGVVVSAIDKGEDGKPRRLAIKKVTNIFNREILLKRAIRELKFLNFFKGHKNIVS 131

Query: 69  LIDIFMA----YDNLNLVLEFLPTDLEVVIKDKSILFTPADIKAWMLMTLRGVYHCHRNF 124
           L+D+ +     YD L    E +  DL  VI   ++ F+   IK ++   L G+ + H   
Sbjct: 132 LVDLEIVSEKPYDGLYCYQELVDYDLARVIHS-TVQFSEFHIKHFLYQILCGLKYIHSAD 190

Query: 125 ILHRDLKPNNLLFSPDGQIKVADFGLARAIPAPH-------EI-LTSNVVTRWYRAPELL 176
           ++HRDLKP N+L S  G +K+ DFGLAR I AP        EI +TS V TRWYRAPEL+
Sbjct: 191 VIHRDLKPGNILCSIGGNLKICDFGLARGI-APQYFEQKSDEIHITSYVATRWYRAPELI 249

Query: 177 FGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWPEVSSFM 236
              + YT AIDIW+VG I AE   R P   G + + Q+    + LG+P       V+ + 
Sbjct: 250 LSHRRYTKAIDIWAVGCILAEFYGRKPIFMGHDSLHQVSEILKVLGSPCRET---VAKYC 306

Query: 237 TYNKLQIYPPPSRDELRK--------RFIAASEYALDFMCGMLTMNPQKRWTAVQCLESD 288
           +    +I+    R E++K        +  + ++  LD    +LT +P KR      L   
Sbjct: 307 SARSWEIF--SGRSEVKKMPWSSVYPKSCSDAQALLDM---LLTWDPDKRPGVEVALCHP 361

Query: 289 YFKELPPPSDPSS 301
           +F+++  P D  S
Sbjct: 362 FFEDVSNPYDEPS 374

>YHR030C (SLT2) [2317] chr8 complement(168882..170336)
           Serine/threonine protein kinase of MAP kinase family
           involved in the cell wall integrity (low-osmolarity)
           pathway and in G2 phase cell-cycle checkpoint control
           [1455 bp, 484 aa]
          Length = 484

 Score =  147 bits (372), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 97/301 (32%), Positives = 148/301 (49%), Gaps = 14/301 (4%)

Query: 11  KKVGEGTYAVVYLG--CQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEMQ-HPNVI 67
           K++G G Y +V      + +    +AIK++     K  L   ++RE+K L+  + H N+ 
Sbjct: 27  KEIGHGAYGIVCSARFAEAAEDTTVAIKKVTNVFSKTLLCKRSLRELKLLRHFRGHKNIT 86

Query: 68  ELIDIFMAY------DNLNLVLEFLPTDLEVVIKDKSILFTPADIKAWMLMTLRGVYHCH 121
            L D+ + +      + L L  E +  D+  +IK    L T A  +++    L G+ + H
Sbjct: 87  CLYDMDIVFYPDGSINGLYLYEELMECDMHQIIKSGQPL-TDAHYQSFTYQILCGLKYIH 145

Query: 122 RNFILHRDLKPNNLLFSPDGQIKVADFGLARAIPAP----HEILTSNVVTRWYRAPELLF 177
              +LHRDLKP NLL + D Q+K+ DFGLAR          + LT  V TRWYRAPE++ 
Sbjct: 146 SADVLHRDLKPGNLLVNADCQLKICDFGLARGYSENPVENSQFLTEYVATRWYRAPEIML 205

Query: 178 GAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWPEVSSFMT 237
             + YT AID+WS G I AE +   P   G++ V+Q+    + LGTP D     + S   
Sbjct: 206 SYQGYTKAIDVWSAGCILAEFLGGKPIFKGKDYVNQLNQILQVLGTPPDETLRRIGSKNV 265

Query: 238 YNKLQIYPPPSRDELRKRFIAASEYALDFMCGMLTMNPQKRWTAVQCLESDYFKELPPPS 297
            + +       +      +  A+  ALD +  ML  +PQKR T  + LE  Y      P+
Sbjct: 266 QDYIHQLGFIPKVPFVNLYPNANSQALDLLEQMLAFDPQKRITVDEALEHPYLSIWHDPA 325

Query: 298 D 298
           D
Sbjct: 326 D 326

>CAGL0M11748g 1167306..1168649 highly similar to sp|P32485
           Saccharomyces cerevisiae YLR113w HOG1, start by
           similarity
          Length = 447

 Score =  146 bits (369), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 95/302 (31%), Positives = 156/302 (51%), Gaps = 12/302 (3%)

Query: 1   MKVNMEYTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQE 60
            ++   Y+    VG G + +V       T +++AIK+I        L     RE+K L+ 
Sbjct: 17  FEITNRYSDLNPVGMGAFGLVCSATDTLTNQQVAIKKIMKPFATAVLAKRTYRELKLLKH 76

Query: 61  MQHPNVIELIDIFMA-YDNLNLVLEFLPTDLEVVIKDKSILFTPADIKAWMLMTLRGVYH 119
           ++H N+I L DIF++  +++  V E   TDL  +++ + +      ++ +    LRG+ +
Sbjct: 77  LRHENLICLQDIFLSPLEDIYFVTELQGTDLHRLLQTRPL--EKQFVQYFHYQILRGLKY 134

Query: 120 CHRNFILHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGA 179
            H   ++HRDLKP+N+L + +  +K+ DFGLAR I  P   +T  V TR+YRAPE++   
Sbjct: 135 VHSAGVVHRDLKPSNILINENCDLKICDFGLAR-IQDPQ--MTGYVSTRYYRAPEIMLTW 191

Query: 180 KHYTSAIDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWPEVSSFMTYN 239
           + Y   +DIWS G IFAE++   P  PG++ V Q  +    LG+P       + +  + N
Sbjct: 192 QKYDVEVDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSPPSD---VIDTICSEN 248

Query: 240 KLQ-IYPPPSRDEL--RKRFIAASEYALDFMCGMLTMNPQKRWTAVQCLESDYFKELPPP 296
            L+ +   P RD +   +RF      A+D +  ML  +P+KR TA   L   Y      P
Sbjct: 249 TLKFVTSLPHRDPIPFSERFKTVEPDAVDLLEKMLVFDPKKRITAADALAHPYLAPYHDP 308

Query: 297 SD 298
           +D
Sbjct: 309 TD 310

>KLLA0B11902g 1041657..1043144 gi|7385125|gb|AAF61706.1|AF226711_1
           Kluyveromyces lactis MAP kinase, start by similarity
          Length = 495

 Score =  147 bits (370), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 95/301 (31%), Positives = 152/301 (50%), Gaps = 14/301 (4%)

Query: 11  KKVGEGTYAVVYLG--CQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEMQ-HPNVI 67
           K++G G+Y +V      + +    +AIK++     K  L   ++RE+K L+  + H N+ 
Sbjct: 29  KEIGHGSYGIVCSARFTEAADETTVAIKKVTNVFSKTLLCKRSLRELKLLRHFRGHKNIT 88

Query: 68  ELIDIFMAY------DNLNLVLEFLPTDLEVVIKDKSILFTPADIKAWMLMTLRGVYHCH 121
            L D+ + +      + L L  E +  D+  ++K    L T A  ++++   L G+ + H
Sbjct: 89  CLYDMDIVFQPDGMFNGLYLYEELMECDMHQIVKSGQPL-TDAHYQSFIYQILCGLKYIH 147

Query: 122 RNFILHRDLKPNNLLFSPDGQIKVADFGLARAIPAP----HEILTSNVVTRWYRAPELLF 177
              +LHRDLKP NLL + D Q+K+ DFGLAR         ++ LT  V TRWYRAPE++ 
Sbjct: 148 SADVLHRDLKPGNLLVNADCQLKICDFGLARGYSENPVENNQFLTEYVATRWYRAPEIML 207

Query: 178 GAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWPEVSSFMT 237
             + YT AID+WS G I AEL+   P   G++ VDQ+    + LGTP +     + S   
Sbjct: 208 SYQGYTKAIDVWSCGCILAELLGGKPIFKGKDYVDQLNRILQVLGTPPEETLKRIGSKNV 267

Query: 238 YNKLQIYPPPSRDELRKRFIAASEYALDFMCGMLTMNPQKRWTAVQCLESDYFKELPPPS 297
            + +       +      +  A+  AL+ + GML+ +PQ R T    L+  Y      P+
Sbjct: 268 QDYIHQLGYIPKIPFSTLYPNANPDALNLLEGMLSFDPQLRITVDDALQHPYLSIWHDPA 327

Query: 298 D 298
           D
Sbjct: 328 D 328

>KLLA0B11946g complement(1048033..1049352) similar to sp|P41808
           Saccharomyces cerevisiae YPR054w SMK1
           sporulation-specific MAP kinase, start by similarity
          Length = 439

 Score =  142 bits (359), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 94/300 (31%), Positives = 151/300 (50%), Gaps = 17/300 (5%)

Query: 13  VGEGTYAVVYLGCQHSTGR---KIAIKEIKTSEFKDGLDMSAIREVKYLQEMQ-HPNVIE 68
           +G+G+Y  V             ++AIK++ +   ++ L   AIRE+K++   + H N++ 
Sbjct: 79  LGKGSYGTVVSAVDKGNPTHEVQLAIKKVTSIFTREILLKRAIRELKFMSYFKGHRNIVS 138

Query: 69  LIDIFMA----YDNLNLVLEFLPTDLEVVIKDKSILFTPADIKAWMLMTLRGVYHCHRNF 124
           LID+ +     Y  L    E +  DL  VI   ++LF+   IK ++   L G+ + H   
Sbjct: 139 LIDLEIVNEEPYSGLYCYQELVDYDLARVIHS-NVLFSEFHIKHFLYQILCGMKYIHSAD 197

Query: 125 ILHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEI-------LTSNVVTRWYRAPELLF 177
           ++HRDLKP N+L S  G+IK+ DFGLAR I     +       +T+ V TRWYRAPEL+ 
Sbjct: 198 VIHRDLKPGNILCSITGEIKICDFGLARGISPSFTVAGGISNHITNYVATRWYRAPELIL 257

Query: 178 GAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWPEVSSFMT 237
             K Y+ ++D+W+VG I AE   R P   G + + Q+    + LGTP         S   
Sbjct: 258 SHKRYSKSVDMWAVGCILAEFYGRKPVFMGNDSLHQVMEIQKILGTPKQIVIRTYGSSRC 317

Query: 238 YNKLQIYPPP-SRDELRKRFIAASEYALDFMCGMLTMNPQKRWTAVQCLESDYFKELPPP 296
           Y+      P   +    + F  AS  A+D M  ++  NP+ R T  + L+  + +++  P
Sbjct: 318 YDIFSTSKPQYKKTPWCEIFPYASSEAVDLMERLIDWNPEARLTVEEALDHPFLQQVRNP 377

>AGR048C [4358] [Homologous to ScYLR113W (HOG1) - SH]
           (807470..808831) [1362 bp, 453 aa]
          Length = 453

 Score =  143 bits (360), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 95/302 (31%), Positives = 155/302 (51%), Gaps = 12/302 (3%)

Query: 1   MKVNMEYTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQE 60
            ++   Y     VG G + +V       T + +AIK+I        L     RE+K L+ 
Sbjct: 23  FEITNRYADLNPVGMGAFGLVCSAVDTYTQQPVAIKKIMKPFSTAVLAKRTYRELKLLKH 82

Query: 61  MQHPNVIELIDIFMA-YDNLNLVLEFLPTDLEVVIKDKSILFTPADIKAWMLMTLRGVYH 119
           ++H N+I L DIF++  +++  V E   TDL  +++ + +      ++ ++   LRG+ +
Sbjct: 83  LRHENLICLEDIFLSPLEDIYFVTELQGTDLHRLLQTRPL--EKQFLQYFLYQILRGLKY 140

Query: 120 CHRNFILHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGA 179
            H   ++HRDLKP+N+L + +  +K+ DFGLAR I  P   +T  V TR+YRAPE++   
Sbjct: 141 VHSAGVIHRDLKPSNILINENCDLKICDFGLAR-IQDPQ--MTGYVSTRYYRAPEIMLTW 197

Query: 180 KHYTSAIDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWPEVSSFMTYN 239
           + Y   +DIWS G IFAE++   P  PG++ V Q  +    LG+P       + +  + N
Sbjct: 198 QKYNVEVDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSPPKD---VIDTICSEN 254

Query: 240 KLQ-IYPPPSRDEL--RKRFIAASEYALDFMCGMLTMNPQKRWTAVQCLESDYFKELPPP 296
            L+ +   P RD +   +RF      A+D +  ML  +P+KR TA   L   Y      P
Sbjct: 255 TLKFVTSLPHRDPVPFTERFKNLKPDAVDLLEKMLVFDPKKRITAGDALTHPYLAPYHDP 314

Query: 297 SD 298
           +D
Sbjct: 315 TD 316

>AER232C [2734] [Homologous to ScYHR030C - SH; ScYKL161C (SLT2) -
           SH] (1066272..1067981) [1710 bp, 569 aa]
          Length = 569

 Score =  144 bits (362), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 95/301 (31%), Positives = 151/301 (50%), Gaps = 14/301 (4%)

Query: 11  KKVGEGTYAVVYLG--CQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEMQ-HPNVI 67
           K++G G Y +V      +      +AIK++     K  L   ++RE+K L+  + H N+ 
Sbjct: 27  KEIGYGAYGIVCSARFMESVEDTTVAIKKVTNVFSKALLCKRSLRELKLLRHFRGHKNIT 86

Query: 68  ELIDIFM------AYDNLNLVLEFLPTDLEVVIKDKSILFTPADIKAWMLMTLRGVYHCH 121
            L D+ +      +++ L+L  E +  D+  +IK    L T A  ++++   L G+ + H
Sbjct: 87  CLYDMDIVLLPDGSFNGLDLYEELMEWDMHQIIKSGQPL-TDAHYQSFVYQILCGLKYIH 145

Query: 122 RNFILHRDLKPNNLLFSPDGQIKVADFGLARAIPAP----HEILTSNVVTRWYRAPELLF 177
              +LHRDLKP NLL + D Q+K+ DFGLAR          + LT  V TRWYRAPE++ 
Sbjct: 146 SADVLHRDLKPGNLLVNADCQLKICDFGLARGYSENPIENDQFLTEYVATRWYRAPEIML 205

Query: 178 GAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWPEVSSFMT 237
             + YT AID+WS G + AEL+   P   G++ VDQ+    + LGTP +     + S   
Sbjct: 206 SYQGYTRAIDVWSCGCVLAELLGGRPIFKGKDYVDQLNRILQVLGTPPEETLKRIGSKNV 265

Query: 238 YNKLQIYPPPSRDELRKRFIAASEYALDFMCGMLTMNPQKRWTAVQCLESDYFKELPPPS 297
            + +       +    + +  A+  A D +  ML ++P+ R T  + LE  Y      PS
Sbjct: 266 QDYIHQLGYIPKVPFERLYPNANPDAADLLERMLALDPKTRITVDEALEHPYLSIWHDPS 325

Query: 298 D 298
           D
Sbjct: 326 D 326

>Scas_680.20
          Length = 482

 Score =  142 bits (358), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 97/295 (32%), Positives = 154/295 (52%), Gaps = 26/295 (8%)

Query: 14  GEGTYAVVYLGCQHSTGRKIAIKEI-KTSEFKDGLDMSAIREVKYLQEMQHPNVIELIDI 72
           G G++ +V        G  +A+K+I +  +FK+       RE+  L+ + HPN+I L   
Sbjct: 174 GSGSFGLVLKAKTLHNGEIVALKKIIQNKKFKN-------RELHMLRLLDHPNIISLKYF 226

Query: 73  FMA-YDN----LNLVLEFLPTDLEVVIKDKSILFTPA------DIKAWMLMTLRGVYHCH 121
           F+   DN    LNL+ EF+P  L   I+  +   +        + K +M    + + + H
Sbjct: 227 FVEPIDNDESYLNLIFEFVPLSLYQRIRQVATTTSSVQPSHKLEFKCYMWQIFKALDYLH 286

Query: 122 RNF-ILHRDLKPNNLLFSP-DGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGA 179
               I HRD+KP N+L  P D  +K+ DFG A+ +  PH+   S + +R+YRAPEL+ GA
Sbjct: 287 NEVNICHRDIKPQNILIDPMDWSLKICDFGSAKRL-NPHDKNVSFICSRFYRAPELILGA 345

Query: 180 KHYTSAIDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWPEVSSFMTYN 239
             YT++ID+WS G +FAEL+L  P+  G++D DQ+    R LGTPT +D   +S    Y 
Sbjct: 346 IQYTNSIDLWSTGCVFAELLLLKPFFAGKSDTDQIVEIIRILGTPTLKDI--ISMNENYK 403

Query: 240 KLQIYPPPSRDELRKRFIAASE-YALDFMCGMLTMNPQKRWTAVQCLESDYFKEL 293
             + +P        + F    E  A+D +  +L  +P +R  + +CL   YF +L
Sbjct: 404 DYR-FPRIHGISWSRLFSDKVEKSAIDLLDKILRYDPTERIDSSKCLIHPYFDDL 457

>YDL079C (MRK1) [789] chr4 complement(312951..314044,314337..314748)
           Member of the GSK-3 subfamily of protein kinases [1506
           bp, 501 aa]
          Length = 501

 Score =  135 bits (340), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 90/301 (29%), Positives = 152/301 (50%), Gaps = 22/301 (7%)

Query: 3   VNMEYTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEI-KTSEFKDGLDMSAIREVKYLQEM 61
           +++ Y   + VG G++ VV       T +K+AIK++ +   +K+       RE++ ++ +
Sbjct: 160 IDISYPTTEVVGHGSFGVVVTTVIIETNQKVAIKKVLQDRRYKN-------RELETMKML 212

Query: 62  QHPNVIELIDIFMAYDN-----LNLVLEFLPTDLEVVIK---DKSILFTPADIKAWMLMT 113
            HPN + L   F   D      LNLVL+++P  L   ++   +  +     +IK +    
Sbjct: 213 CHPNTVGLQYYFYEKDEEDEVYLNLVLDYMPQSLYQRLRHFVNLKMQMPRVEIKFYAYQL 272

Query: 114 LRGVYHCHR-NFILHRDLKPNNLLFSPDG-QIKVADFGLARAIPAPHEILTSNVVTRWYR 171
            + + + H    I HRD+KP NLL  P     K+ DFG A+ +  P +   S + +R+YR
Sbjct: 273 FKALNYLHNVPRICHRDIKPQNLLVDPTTFSFKICDFGSAKCL-KPDQPNVSYICSRYYR 331

Query: 172 APELLFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWPE 231
           APEL+FGA +Y++ +D+WS   + AEL+L  P   G++ +DQ+    + +G PT     E
Sbjct: 332 APELMFGATNYSNQVDVWSSACVIAELLLGKPLFSGESGIDQLVEIIKIMGIPTK---DE 388

Query: 232 VSSFMTYNKLQIYPPPSRDELRKRFIAASEYALDFMCGMLTMNPQKRWTAVQCLESDYFK 291
           +S      +  ++P      L + F A     LD +   L  +P +R   +QCL S YF 
Sbjct: 389 ISGMNPNYEDHVFPNIKPITLAEIFKAEDPDTLDLLTKTLKYHPCERLVPLQCLLSSYFD 448

Query: 292 E 292
           E
Sbjct: 449 E 449

>Scas_22.1
          Length = 248

 Score =  129 bits (324), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 83/228 (36%), Positives = 126/228 (55%), Gaps = 26/228 (11%)

Query: 79  LNLVLEFLPTDL----EVVIKDKSILFTPA-DIKAWMLMTLRGVYHCHRNF-ILHRDLKP 132
           LNLVLE++P+ L       +  +S +  PA ++K +M    + + + H    + HRD+KP
Sbjct: 26  LNLVLEYMPSSLYQRLRHFVTHRSNM--PAIEVKLYMYQLFKSLNYLHTCARVCHRDIKP 83

Query: 133 NNLLFSPDG-QIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKHYTSAIDIWSV 191
            NLL  P    +K+ DFG A+ +  P E   S + +R+YRAPEL+FGA +YT+ ID+WS 
Sbjct: 84  QNLLVDPTTFSLKLCDFGSAKQL-KPTEPNVSYICSRYYRAPELIFGATNYTTQIDVWSS 142

Query: 192 GVIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWPEVS-SFMTYNKLQIYPPPSRD 250
           G + AEL+L  P  PG++ +DQ+    + LGTP  R+   ++ ++M +   QI P P   
Sbjct: 143 GCVMAELILGQPMFPGESGIDQLVEIIKILGTPNKREICAMNPNYMDHKFPQIVPIP--- 199

Query: 251 ELRKRFIAASEYALDFMCGMLTMNPQKRWTAVQCLESDYFKELPPPSD 298
            L K F    E  +           Q ++TA+QCL + YF EL  PS 
Sbjct: 200 -LNKVFKREQEETV-----------QSKFTALQCLCASYFDELRQPSS 235

>Scas_678.13
          Length = 462

 Score =  116 bits (291), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 82/295 (27%), Positives = 141/295 (47%), Gaps = 20/295 (6%)

Query: 12  KVGEGTYAVVYLGCQHSTGRK---IAIKEIKTSEFKDGLDMSAIREVKYLQEMQ-HPNVI 67
           ++  G+Y +V L   +S   +   IAIK+I            A+RE+K LQ    H N+I
Sbjct: 28  EISRGSYGIV-LSASYSHSSENIVIAIKKISNIFGSTQSSKRALRELKLLQAFNGHKNII 86

Query: 68  ELIDIFMAY------DNLNLVLEFLPTDLEVVIKDKSILFTPADIKAWMLMTLRGVYHCH 121
            L D+ + +      + + +  E +  D+E +IK +  L T    + ++   L G+ + H
Sbjct: 87  SLYDMDIVFYPTGILNGIYIYEELMECDMEQIIKSRQPL-TEYHYQFFIYQILCGLRYIH 145

Query: 122 RNFILHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSN------VVTRWYRAPEL 175
              I+ R+++P+NLL + D ++K+  F LA+   A + +  +N      + TRWY APEL
Sbjct: 146 SADIIMRNVRPSNLLINSDCKLKICGFSLAQK--ASNGVANNNQFSPEYLTTRWYHAPEL 203

Query: 176 LFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWPEVSSF 235
           L     YT++ID+WS G +  EL+ + P     + V+Q+   F+ LGT +      + S 
Sbjct: 204 LLNHHIYTTSIDVWSTGCVLGELITKEPIFHENDFVNQLNKIFQILGTHSKEALDNIGSK 263

Query: 236 MTYNKLQIYPPPSRDELRKRFIAASEYALDFMCGMLTMNPQKRWTAVQCLESDYF 290
              N +   P   +  +   F  A+    D +  ML  + ++R T    L   YF
Sbjct: 264 TIKNHVSQLPYIPKPPMENIFPGATTECQDLLNKMLKFDSEQRITVDMALRHPYF 318

>AEL230W [2276] [Homologous to ScYDR477W (SNF1) - SH]
           complement(198401..200227) [1827 bp, 608 aa]
          Length = 608

 Score =  117 bits (293), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 87/294 (29%), Positives = 149/294 (50%), Gaps = 41/294 (13%)

Query: 6   EYTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEI-KTSEFKDGLDMSAIREVKYLQEMQHP 64
           +Y   K +GEG++  V L    STG+K+A+K I K    K  +     RE+ YL+ ++HP
Sbjct: 38  KYQVIKTLGEGSFGKVKLAHHVSTGQKVALKIINKKVLAKSDMQGRIEREISYLRLLRHP 97

Query: 65  NVIELIDIFMAYDNLNLVLEFLPTDL--EVVIKDKSILFTPADIKAWMLMTLRGVYHCHR 122
           ++I+L D+  + D + +V+E+   +L   +V +DK    +  + + +    +  V +CHR
Sbjct: 98  HIIKLYDVIKSKDEIIMVIEYAGNELFDYIVQRDK---MSENEARRFFQQIISAVEYCHR 154

Query: 123 NFILHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKHY 182
           + I+HRDLKP NLL      +K+ADFGL+  I      L ++  +  Y APE++ G  + 
Sbjct: 155 HKIVHRDLKPENLLLDEHLNVKIADFGLSN-IMTDGNFLKTSCGSPNYAAPEVISGKLYA 213

Query: 183 TSAIDIWSVGVI-FAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWPEVSSFMTYNKL 241
              +D+WS GVI +  L  R+P+     D + + V F+ +                    
Sbjct: 214 GPEVDVWSSGVILYVMLCRRLPF-----DDESIPVLFKNISNG----------------- 251

Query: 242 QIYPPPSRDELRKRFIAASEYALDFMCGMLTMNPQKRWTAVQCLESDYFK-ELP 294
            +Y  P       +F+  S+ A + +  ML +NP  R T  + +E ++FK +LP
Sbjct: 252 -VYSIP-------KFL--SQGAANLIKRMLIVNPLNRITIHEIMEDEWFKVDLP 295

>Scas_711.15
          Length = 727

 Score =  115 bits (288), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 87/302 (28%), Positives = 148/302 (49%), Gaps = 42/302 (13%)

Query: 29  TGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEM-QHPNVIELIDIFMAYDN--LNLVLEF 85
           + R +AIK + T  +    D + +REVK++  +  + ++I++ +IF    N  L++V+E 
Sbjct: 90  SQRLVAIKTMLTKLYT-LHDYTRVREVKFILALPTNKHLIQIFEIFADTSNYQLHIVMEC 148

Query: 86  LPTDL-EVVIKDKSILFTPADIKAWMLMTLRGVYHCHRNFILHRDLKPNNLLFSPDGQ-- 142
           +  +L ++++  K  +F+   +K+ +   L G+ H H +   HRD+KP N+L SP+ +  
Sbjct: 149 MEQNLYQMMLHRKKRVFSIPSLKSILAQILAGIKHIHDHNFFHRDIKPENILVSPNKRYF 208

Query: 143 ---------------IKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKHYTSAID 187
                          +K+ADFGLAR +   +   T+ V TRWYR+PE+L    +Y++ +D
Sbjct: 209 DKERLELGFYPDNYVVKLADFGLARHVENKN-TYTAYVSTRWYRSPEILLRNGYYSTPLD 267

Query: 188 IWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRD---------------WPEV 232
           IW+ G +  E  +  P  PG N++DQ+      LGTP +                 W  V
Sbjct: 268 IWAFGCVAVEATIFKPLFPGSNELDQIWRILEVLGTPYNNKNDSTVPNNFKPYGGTWNHV 327

Query: 233 SSFMTYNKLQIYPPPSRDELRKRFIAASEY--ALDFMCGMLTMNPQKRWTAVQCLESDYF 290
           +   +  KL +  P        RFI   E    LD +   L  NP +R +A      +YF
Sbjct: 328 AELAS--KLNLEFPFVEGISLDRFIPLPELYDLLDVIKKCLRWNPLERASANDLCLMEYF 385

Query: 291 KE 292
           K+
Sbjct: 386 KD 387

>YDR477W (SNF1) [1293] chr4 (1412361..1414262) Serine/threonine
           protein kinase essential for derepression of
           glucose-repressed genes, acts in concert with Snf4p,
           involved in aging [1902 bp, 633 aa]
          Length = 633

 Score =  114 bits (286), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 82/289 (28%), Positives = 144/289 (49%), Gaps = 41/289 (14%)

Query: 11  KKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEF-KDGLDMSAIREVKYLQEMQHPNVIEL 69
           K +GEG++  V L    +TG+K+A+K I      K  +     RE+ YL+ ++HP++I+L
Sbjct: 59  KTLGEGSFGKVKLAYHTTTGQKVALKIINKKVLAKSDMQGRIEREISYLRLLRHPHIIKL 118

Query: 70  IDIFMAYDNLNLVLEFLPTDL--EVVIKDKSILFTPADIKAWMLMTLRGVYHCHRNFILH 127
            D+  + D + +V+E+   +L   +V +DK    +  + + +    +  V +CHR+ I+H
Sbjct: 119 YDVIKSKDEIIMVIEYAGNELFDYIVQRDK---MSEQEARRFFQQIISAVEYCHRHKIVH 175

Query: 128 RDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKHYTSAID 187
           RDLKP NLL      +K+ADFGL+  I      L ++  +  Y APE++ G  +    +D
Sbjct: 176 RDLKPENLLLDEHLNVKIADFGLSN-IMTDGNFLKTSCGSPNYAAPEVISGKLYAGPEVD 234

Query: 188 IWSVGVI-FAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWPEVSSFMTYNKLQIYPP 246
           +WS GVI +  L  R+P+     D + + V F+ +                     +Y  
Sbjct: 235 VWSCGVILYVMLCRRLPF-----DDESIPVLFKNISN------------------GVYTL 271

Query: 247 PSRDELRKRFIAASEYALDFMCGMLTMNPQKRWTAVQCLESDYFK-ELP 294
           P       +F++    A   +  ML +NP  R +  + ++ D+FK +LP
Sbjct: 272 P-------KFLSPG--AAGLIKRMLIVNPLNRISIHEIMQDDWFKVDLP 311

>CAGL0G04455g 426386..428641 similar to sp|P32581 Saccharomyces
           cerevisiae YJL106w IME2 ser/thr protein kinase,
           hypothetical start
          Length = 751

 Score =  114 bits (285), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 68/220 (30%), Positives = 119/220 (54%), Gaps = 24/220 (10%)

Query: 28  STGRKIAIKEIKT--SEFKDGLDMSAIREVKYLQEMQ-HPNVIELIDIFMAYD--NLNLV 82
           S  RK  +  IKT  +      D + +REVK++  M  + ++I++ +IF+  +   L++ 
Sbjct: 100 SNSRKQGLVAIKTMLTRLPTLHDYTRVREVKFILSMTANKHLIQVYEIFVDSEKYQLHIA 159

Query: 83  LEFLPTDL-EVVIKDKSILFTPADIKAWMLMTLRGVYHCHRNFILHRDLKPNNLLFSPDG 141
           +E++  +L +++ + K  +F+   +K+ +   L G+ H H     HRDLKP N+L +P  
Sbjct: 160 MEYMEQNLYQMMRRRKKRVFSIPSLKSILAQVLAGLRHIHDQNFFHRDLKPENILITPST 219

Query: 142 Q-----------------IKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKHYTS 184
           +                 +K+ADFGLAR +   +   T+ V TRWYR+PE+L  + +Y+ 
Sbjct: 220 RYFDSSWLEKGNYPDNYVVKLADFGLARHVENKNP-YTAYVSTRWYRSPEILLRSGYYSK 278

Query: 185 AIDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTP 224
            +DIW+ G +  E+ +  P  PG N++DQ+      LGTP
Sbjct: 279 PLDIWAFGCVAMEVTVFKPLFPGSNEIDQIWKILEVLGTP 318

>Scas_660.28
          Length = 623

 Score =  114 bits (284), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 80/285 (28%), Positives = 142/285 (49%), Gaps = 40/285 (14%)

Query: 11  KKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEF-KDGLDMSAIREVKYLQEMQHPNVIEL 69
           K +GEG++  V L    +TG+K+A+K I      K  +     RE+ YL+ ++HP++I+L
Sbjct: 50  KTLGEGSFGKVKLAYHMTTGQKVALKIINKKVLAKSDMQGRIEREISYLRLLRHPHIIKL 109

Query: 70  IDIFMAYDNLNLVLEFLPTDL--EVVIKDKSILFTPADIKAWMLMTLRGVYHCHRNFILH 127
            D+  + D + +V+E+   +L   +V +DK    +  + + +    +  V +CHR+ I+H
Sbjct: 110 YDVIKSKDEIIMVMEYAGNELFDYIVQRDK---MSEDEARRFFQQIISAVEYCHRHKIVH 166

Query: 128 RDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKHYTSAID 187
           RDLKP NLL      +K+ADFGL+  I      L ++  +  Y APE++ G  +    +D
Sbjct: 167 RDLKPENLLLDEHLNVKIADFGLSN-IMTDGNFLKTSCGSPNYAAPEVISGKLYAGPEVD 225

Query: 188 IWSVGVI-FAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWPEVSSFMTYNKLQIYPP 246
           +WS GVI +  L  R+P+     D + + V F+ +                     +Y  
Sbjct: 226 VWSCGVILYVMLCRRLPF-----DDESIPVLFKNINNG------------------VYTI 262

Query: 247 PSRDELRKRFIAASEYALDFMCGMLTMNPQKRWTAVQCLESDYFK 291
           P       +F+  S+ A   +  ML +NP  R +  + ++ ++FK
Sbjct: 263 P-------KFL--SQGASTLIKKMLIVNPLNRISIQEIMQDEWFK 298

>YJL106W (IME2) [2809] chr10 (221307..223244) Serine/threonine
           protein kinase and positive regulator of early, middle,
           and late meiotic genes, may act as a meiosis-specific
           regulator of the anaphase promoting complex [1938 bp,
           645 aa]
          Length = 645

 Score =  114 bits (284), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 73/246 (29%), Positives = 129/246 (52%), Gaps = 29/246 (11%)

Query: 24  GCQHSTGRKIAIKEIKT--SEFKDGLDMSAIREVKYLQEM-QHPNVIELIDIFMAYDN-- 78
           G Q+   +   +  IKT  ++     D + +RE+K++  +  + ++I++ ++F+  +N  
Sbjct: 82  GHQNYITKTQGVVAIKTMMTKLHTLQDYTRVREIKFILAIPANDHLIQIFEVFIDSENYQ 141

Query: 79  LNLVLEFLPTDLEVVIKDKSI-LFTPADIKAWMLMTLRGVYHCHRNFILHRDLKPNNLLF 137
           L++V+E +  +L  ++K +   +F+   +K+ +   L G+ H H +   HRDLKP N+L 
Sbjct: 142 LHIVMECMEQNLYQMMKHRRRRVFSIPSLKSILSQILAGLKHIHEHNFFHRDLKPENILI 201

Query: 138 SPDGQ-----------------IKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAK 180
           +P  Q                 IK+ADFGLAR +   +   T+ V TRWYR+PE+L  + 
Sbjct: 202 TPSTQYFEKEYMNQIGYQDNYVIKLADFGLARHVENKNP-YTAYVSTRWYRSPEILLRSG 260

Query: 181 HYTSAIDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWPEVSSFMTYNK 240
           +Y+  +DIW+ G +  E+ +     PG N++DQ+      LGTP  R     S F+  N 
Sbjct: 261 YYSKPLDIWAFGCVAVEVTVFRALFPGANEIDQIWKILEVLGTPIKR-----SDFVNTNH 315

Query: 241 LQIYPP 246
           +   PP
Sbjct: 316 ITAPPP 321

>Kwal_55.22001
          Length = 363

 Score =  111 bits (278), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 85/307 (27%), Positives = 141/307 (45%), Gaps = 39/307 (12%)

Query: 11  KKVGEGTYAVVYLGCQHSTGRK----IAIKEI-KTSEFKDGLDMSAIREVKYLQEMQHPN 65
           KK+G G +  V          K     AIK++   +E+K        RE++ L+   HPN
Sbjct: 30  KKIGHGAFGTVVQAFLTPDNNKWYGPFAIKKVPAQTEYKS-------RELEILRIADHPN 82

Query: 66  VIELIDIFM---AYDN---LNLVLEFLPTDLEVVIK---DKSILFTPADIKAWMLMTLRG 116
           V++L   F      DN    +L +E LP  L++ I       +       K +     RG
Sbjct: 83  VVKLEYFFTHTSPQDNKLYQHLAMECLPETLQLEIHRYASNKLELPLKHTKLYTYQIARG 142

Query: 117 VYHCHRNFILHRDLKPNNLLFSPD-GQIKVADFGLARAIPAPHEILTSNVVTRWYRAPEL 175
           + + H   I HRD+KP+N+L  P+ G +K+ DFG A+ +   ++   S + +R+YRAPEL
Sbjct: 143 MLYLHALGICHRDIKPSNVLVDPNTGVLKICDFGSAKKLEQ-NQPSISYICSRFYRAPEL 201

Query: 176 LFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDR-------- 227
           + G   YT+ IDIW +G +  E+++      GQ  + Q+    + LG P  +        
Sbjct: 202 IVGCTQYTTQIDIWGLGCVMGEMLIGKAVFQGQEPLLQLREISKLLGPPDKKFLFFSNPS 261

Query: 228 -DWPEVSSFMTYNKLQIYPPPSRDELRKRFIAASEYALDFMCGMLTMNPQKRWTAVQCLE 286
            D P  S  +    +Q       +   K F  A    +D +  +LT  P++R +  + L 
Sbjct: 262 YDGPLFSKPLFTGSVQ-------ERFEKHFGQAGPEGIDLLMKILTYEPERRLSPRRILA 314

Query: 287 SDYFKEL 293
             +F++L
Sbjct: 315 HPFFEDL 321

>Kwal_47.18233
          Length = 598

 Score =  113 bits (283), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 81/285 (28%), Positives = 142/285 (49%), Gaps = 40/285 (14%)

Query: 11  KKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEF-KDGLDMSAIREVKYLQEMQHPNVIEL 69
           K +GEG++  V L    +TG+K+A+K I      K  +     RE+ YL+ ++HP++I+L
Sbjct: 35  KTLGEGSFGKVKLAYHVTTGQKVALKIINKKVLAKSDMQGRIEREISYLRLLRHPHIIKL 94

Query: 70  IDIFMAYDNLNLVLEFLPTDL--EVVIKDKSILFTPADIKAWMLMTLRGVYHCHRNFILH 127
            D+  + D + +V+E+   +L   +V +DK    +  + + +    +  V +CHR+ I+H
Sbjct: 95  YDVVKSKDEIVMVIEYAGNELFDYIVQRDK---MSENEARRFFQQIISAVEYCHRHKIVH 151

Query: 128 RDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKHYTSAID 187
           RDLKP NLL      +K+ADFGL+  I      L ++  +  Y APE++ G  +    +D
Sbjct: 152 RDLKPENLLLDEHLNVKIADFGLSN-IMTDGNFLRTSCGSPNYAAPEVISGKLYAGPEVD 210

Query: 188 IWSVGVI-FAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWPEVSSFMTYNKLQIYPP 246
           +WS GVI +  L  R+P+     D + + V F+ +                     IY  
Sbjct: 211 VWSSGVILYVMLCRRLPF-----DDESIPVLFKNISNG------------------IYTL 247

Query: 247 PSRDELRKRFIAASEYALDFMCGMLTMNPQKRWTAVQCLESDYFK 291
           P       +F++    A + +  ML +NP  R T  + ++ ++FK
Sbjct: 248 P-------KFLSPG--AANLIKRMLIVNPLNRITIHEIMQDEWFK 283

>KLLA0A03806g complement(338807..340615) gi|2181934|emb|CAA61235.1
           Kluyveromyces lactis putative kinase, start by
           similarity
          Length = 602

 Score =  113 bits (283), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 84/289 (29%), Positives = 144/289 (49%), Gaps = 41/289 (14%)

Query: 11  KKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEF-KDGLDMSAIREVKYLQEMQHPNVIEL 69
           K +GEG++  V L    STG+K+A+K I      K  +     RE+ YL+ ++HP++I+L
Sbjct: 39  KTLGEGSFGKVKLAYHISTGQKVALKIINKKVLAKSDMQGRIEREISYLRLLRHPHIIKL 98

Query: 70  IDIFMAYDNLNLVLEFLPTDL--EVVIKDKSILFTPADIKAWMLMTLRGVYHCHRNFILH 127
            D+  + D + +V+E+   +L   +V +DK       + + +    +  V +CHR+ I+H
Sbjct: 99  YDVIKSKDEIIMVIEYAGNELFDYIVQRDK---MPEQEARRFFQQIISAVDYCHRHKIVH 155

Query: 128 RDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKHYTSAID 187
           RDLKP NLL      +K+ADFGL+  I      L ++  +  Y APE++ G  +    +D
Sbjct: 156 RDLKPENLLLDEHLNVKIADFGLSN-IMTDGNFLKTSCGSPNYAAPEVISGKLYAGPEVD 214

Query: 188 IWSVGVI-FAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWPEVSSFMTYNKLQIYPP 246
           +WS GVI +  L  R+P+     D + + V F+ +                     +Y  
Sbjct: 215 VWSSGVILYVMLCRRLPF-----DDESIPVLFKNISNG------------------VYTI 251

Query: 247 PSRDELRKRFIAASEYALDFMCGMLTMNPQKRWTAVQCLESDYFK-ELP 294
           P+       F+  S+ A   +  ML +NP  R T  + ++ ++FK +LP
Sbjct: 252 PN-------FL--SQGAASLIKKMLIVNPVNRITVHEIMQDEWFKVDLP 291

>CAGL0M08910g complement(887703..889541) highly similar to sp|Q00372
           Saccharomyces cerevisiae YDR477w carbon catabolite
           derepressing ser/thr protein kinase, hypothetical start
          Length = 612

 Score =  112 bits (281), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 80/285 (28%), Positives = 143/285 (50%), Gaps = 40/285 (14%)

Query: 11  KKVGEGTYAVVYLGCQHSTGRKIAIKEI-KTSEFKDGLDMSAIREVKYLQEMQHPNVIEL 69
           K +GEG++  V L    +TG+K+A+K I K    K  +     RE+ YL+ ++HP++I+L
Sbjct: 43  KTLGEGSFGKVKLAYHVTTGQKVALKIINKKVLAKSDMQGRIEREISYLRLLRHPHIIKL 102

Query: 70  IDIFMAYDNLNLVLEFLPTDL--EVVIKDKSILFTPADIKAWMLMTLRGVYHCHRNFILH 127
            D+  + D + +V+E+   +L   +V ++K    +  + + +    +  V +CHR+ I+H
Sbjct: 103 YDVIKSKDEIIMVIEYAGNELFDYIVQRNK---MSEQEARRFFQQIISAVEYCHRHKIVH 159

Query: 128 RDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKHYTSAID 187
           RDLKP NLL      +K+ADFGL+  I      L ++  +  Y APE++ G  +    +D
Sbjct: 160 RDLKPENLLLDEHLNVKIADFGLSN-IMTDGNFLKTSCGSPNYAAPEVISGKLYAGPEVD 218

Query: 188 IWSVGVI-FAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWPEVSSFMTYNKLQIYPP 246
           +WS GVI +  L  R+P+     D + + V F+ +                     +Y  
Sbjct: 219 VWSCGVILYVMLCRRLPF-----DDESIPVLFKNISNG------------------VYTL 255

Query: 247 PSRDELRKRFIAASEYALDFMCGMLTMNPQKRWTAVQCLESDYFK 291
           P       +F++    A D +  ML +NP  R +  + ++ ++FK
Sbjct: 256 P-------KFLSPG--ASDLIKRMLIVNPLNRISIHEIMQDEWFK 291

>CAGL0E01683g complement(166584..167711) highly similar to sp|P21965
           Saccharomyces cerevisiae YNL307c MCK1 or sp|Q12222
           Saccharomyces cerevisiae YOL128c, start by similarity
          Length = 375

 Score =  110 bits (275), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 84/303 (27%), Positives = 148/303 (48%), Gaps = 27/303 (8%)

Query: 9   KEKKVGEGTYAVV---YLGCQHSTGRK-IAIKEI-KTSEFKDGLDMSAIREVKYLQEMQH 63
           + +K+G G +  V   YL     T     AIK++   +E+K        RE++ L+   H
Sbjct: 37  EHRKIGRGAFGTVVQAYLTQDEQTWYGPFAIKKVPAQTEYKS-------RELQILRLTDH 89

Query: 64  PNVIELIDIFM---AYDN---LNLVLEFLPTDLEVVIK---DKSILFTPADIKAWMLMTL 114
           PN+++L   F      DN    +L +E LP  L++ I      ++      +K +     
Sbjct: 90  PNIVKLEYFFTHTSPKDNKVYQHLAMECLPETLQIEINRYTSNNLQLAIKHVKLYSYQIA 149

Query: 115 RGVYHCHRNFILHRDLKPNNLLFSPD-GQIKVADFGLARAIPAPHEILTSNVVTRWYRAP 173
           RG+ + H   I HRD+KP+N+L  P  G +K+ DFG A+ +  P++   S + +R+YRAP
Sbjct: 150 RGMLYLHALGICHRDIKPSNILVDPKTGVLKICDFGSAKRL-EPNQPSISYICSRFYRAP 208

Query: 174 ELLFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWPEVS 233
           EL+ G+  YT+ +DIW +G +  E+++      GQ+ + Q+    + LG P D+ +   S
Sbjct: 209 ELILGSTQYTTQVDIWGLGCVIGEMLIGRAIFQGQDPLLQLREIAKLLG-PPDKKFIFFS 267

Query: 234 SFMTYNKLQIYP---PPSRDELRKRFIAASEYALDFMCGMLTMNPQKRWTAVQCLESDYF 290
           +      L   P     S +  +K F  A    +D +  +L   P+ R++  + +   +F
Sbjct: 268 NPRYTGPLYSTPLFNGTSLERFQKYFGHAGPDGIDLLMKVLKYEPELRFSPRRIMAHPFF 327

Query: 291 KEL 293
            +L
Sbjct: 328 DDL 330

>Kwal_26.7276
          Length = 646

 Score =  111 bits (277), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 78/283 (27%), Positives = 140/283 (49%), Gaps = 43/283 (15%)

Query: 48  DMSAIREVKYLQEM-QHPNVIELIDIFMAYDN--LNLVLEFLPTDL-EVVIKDKSILFTP 103
           D + +REVK++  M  H N++++ ++F+   N  L++V+E +  +L +++   +  +F+ 
Sbjct: 123 DYTRVREVKFILSMPAHRNLVQIWELFIDDVNYQLHIVMECMEQNLYQLMRARRKRVFSL 182

Query: 104 ADIKAWMLMTLRGVYHCHRNFILHRDLKPNNLLFSPDGQ-----------------IKVA 146
             +K+ +   + G+ H H +   HRDLKP N+L SP                    +K+A
Sbjct: 183 PSLKSILTQLITGIRHIHSHNFFHRDLKPENILISPSNHYFSKDWILNGNYSDNYVVKIA 242

Query: 147 DFGLARAI--PAPHEILTSNVVTRWYRAPELLFGAKHYTSAIDIWSVGVIFAELMLRIPY 204
           D+GLAR +   +P+   T+ V TRWYR+PE+L     Y+  +DIW+ G +  E+    P 
Sbjct: 243 DYGLARHVTNKSPY---TAYVSTRWYRSPEILLRKGSYSRPLDIWAFGCVVVEVATFRPL 299

Query: 205 LPGQNDVDQMEVTFRALGTPTDRDWPEVSSFM----TYNKLQIYPPPSRDELRKRFIAAS 260
            PG +++DQ+      LGTP       +S +     ++ K ++    SR  L+  ++  +
Sbjct: 300 FPGSDEMDQIWKILEVLGTPHTMSESAISGYQPHGGSWEKAEVL--ASRLNLKFPYVEGT 357

Query: 261 EYA-------LDFMCGM----LTMNPQKRWTAVQCLESDYFKE 292
                     L  +C +    LT +P+KR T  +     YF E
Sbjct: 358 SIESIVANPHLQELCEVVKECLTWDPKKRATVDEICAMPYFAE 400

>KLLA0E07414g complement(672690..673787) highly similar to sp|P21965
           Saccharomyces cerevisiae YNL307c MCK1 ser/thr/tyr
           protein kinase, start by similarity
          Length = 365

 Score =  107 bits (268), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 88/313 (28%), Positives = 150/313 (47%), Gaps = 31/313 (9%)

Query: 1   MKVNMEYTKEKKVGEGTYAVVYLGCQHSTGRK----IAIKEI-KTSEFKDGLDMSAIREV 55
           +K  M   + K++G+G +  V         +K     AIK++   +E+K        RE+
Sbjct: 21  VKREMLVKEYKRIGQGAFGTVVQAYLTPDNQKWLGPFAIKKVPAQTEYKS-------REL 73

Query: 56  KYLQEMQHPNVIELIDIFMAYDN-------LNLVLEFLPTDL--EVVIKDKSILFTP-AD 105
           + L+   HPNV++L + F  + +        +L +E LP  L  E++   K+ L  P   
Sbjct: 74  EILRIADHPNVVKL-EYFYTHISPTDHKLYQHLAMECLPEMLQNEILRYKKNNLELPLKH 132

Query: 106 IKAWMLMTLRGVYHCHRNFILHRDLKPNNLLFSPD-GQIKVADFGLARAIPAPHEILTSN 164
           +K +     RG+ + H   I HRD+KP+N+L  P  G +K+ DFG A+ + + ++   S 
Sbjct: 133 VKLYAYQIARGMLYLHALGICHRDIKPSNVLVDPQTGILKICDFGSAKKLES-NQPSISY 191

Query: 165 VVTRWYRAPELLFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTP 224
           + +R+YRAPEL+ G   YT+ IDIW +G +  E++L      G   + Q+    + LG P
Sbjct: 192 ICSRYYRAPELIVGCTQYTTKIDIWGLGCVLGEMLLGKAVFQGHQPLLQLHEITKLLGPP 251

Query: 225 TDR----DWPEVSSFMTYNKLQIYPPPSRDELRKRFIAASEYALDFMCGMLTMNPQKRWT 280
             R      P  +  +    L    P +R E  K F  A    +D +  +L   P++R +
Sbjct: 252 DKRFIFFSNPSYNGPLFSKPLFEGAPKARFE--KYFGYAGPDGVDLLMSVLVYEPERRAS 309

Query: 281 AVQCLESDYFKEL 293
             + L   +F +L
Sbjct: 310 PRRILAHPFFDDL 322

>Scas_673.20*
          Length = 758

 Score =  107 bits (266), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 67/205 (32%), Positives = 112/205 (54%), Gaps = 9/205 (4%)

Query: 4   NMEYTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEMQH 63
           N  Y K K++GEG   +VY   +  T   +AIK+I   + +  L M    E+  L+E QH
Sbjct: 478 NERYRKLKRIGEGASGIVYTAYEIGTDISVAIKQIDL-KIQPRLQM-IWTEMLVLKEYQH 535

Query: 64  PNVIELIDIFMAYDNLNLVLEFLPTDLEVVIKDKSILFTPADIKAWMLM--TLRGVYHCH 121
           PN+I  I+ ++ +D L +V+E++       + D    FTP + +   +   TL G+   H
Sbjct: 536 PNIINFINSYLLHDTLWIVMEYMDGG---SLADIVSFFTPTEEQMATICRETLFGLNFLH 592

Query: 122 RNFILHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKH 181
              I+HRD+K +N+L S +G IK+ DFG    +   +   T+ V T ++ APE++  +K 
Sbjct: 593 SRGIVHRDIKSDNILLSMNGDIKITDFGFCGQLTESNTKRTTMVGTPYWMAPEVI-ASKE 651

Query: 182 YTSAIDIWSVGVIFAELML-RIPYL 205
           Y   +D+WS+G++  E++    PYL
Sbjct: 652 YGPKVDVWSLGIMIIEMIEGEPPYL 676

>ADL168C [1573] [Homologous to ScYNL307C (MCK1) - SH; ScYOL128C -
           SH] (398519..399607) [1089 bp, 362 aa]
          Length = 362

 Score =  103 bits (258), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 85/302 (28%), Positives = 138/302 (45%), Gaps = 29/302 (9%)

Query: 11  KKVGEGTYAVVYLGCQHSTGRK----IAIKEI-KTSEFKDGLDMSAIREVKYLQEMQHPN 65
           K++G G +  V          K     AIK++   +E+K        RE+  L+   HPN
Sbjct: 29  KRIGHGAFGTVVQAYLTPDNEKWYGPFAIKKVPAQTEYKS-------RELAILRIADHPN 81

Query: 66  VIELIDIFMAYD------NLNLVLEFLPTDL--EVVIKDKSILFTP-ADIKAWMLMTLRG 116
           V++L   F            +L +E LP  L  E++   ++ L  P   IK +     RG
Sbjct: 82  VVKLEYFFTHVSPSDGKVYQHLAMECLPETLQHEILRYTQNKLELPLKHIKMYTYQIARG 141

Query: 117 VYHCHRNFILHRDLKPNNLLFSP-DGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPEL 175
           + + H   I HRD+KP+N+L  P  G +K+ DFG A+ +   ++   S + +R+YRAPEL
Sbjct: 142 MLYLHALGICHRDIKPSNILVDPKSGVLKICDFGSAKKLEQ-NQPSISYICSRFYRAPEL 200

Query: 176 LFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDR----DWPE 231
           + G   YT+ IDIW +G +  E+++      GQ  + Q+    + LG P  +      P 
Sbjct: 201 IVGCTQYTTQIDIWGLGCVIGEMLIGKAVFQGQEPLLQLHEIAKLLGPPDKKFIFFSNPS 260

Query: 232 VSSFMTYNKLQIYPPPSRDELRKRFIAASEYALDFMCGMLTMNPQKRWTAVQCLESDYFK 291
               +    L    P  R E  K F  A    +D +  +L  +P++R +  + L   +  
Sbjct: 261 YGGPLFSKPLFNGTPQQRFE--KYFGHAGPEGIDLLMKVLCYSPERRLSPRRVLCHAFLD 318

Query: 292 EL 293
           EL
Sbjct: 319 EL 320

>Scas_635.1
          Length = 378

 Score =  103 bits (257), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 82/309 (26%), Positives = 141/309 (45%), Gaps = 43/309 (13%)

Query: 11  KKVGEGTYAVVYLGCQHSTGRK------IAIKEI-KTSEFKDGLDMSAIREVKYLQEMQH 63
           +K+G G +  V     + T  K       AIK++   +E+K        RE++ L+   H
Sbjct: 43  RKIGRGAFGTVVQA--YITPNKEDWYGPFAIKKVPAQTEYKS-------RELEILRITNH 93

Query: 64  PNVIELIDIFMAYD------NLNLVLEFLPTDLEVVIK---DKSILFTPADIKAWMLMTL 114
           PN+++L   F            +L +E LP  L++ I       +      +K +     
Sbjct: 94  PNIVKLEYFFTHVSPQDHKVYQHLAMECLPETLQIEISRYAHNKMELALKHVKLYSYQIA 153

Query: 115 RGVYHCHRNFILHRDLKPNNLLFSPD-GQIKVADFGLARAIPAPHEILTSNVVTRWYRAP 173
           RG+ + H   I HRD+KP+N+L  P+ G +K+ DFG A+ +   ++   S + +R+YRAP
Sbjct: 154 RGMLYLHALGICHRDIKPSNILVDPNTGVLKICDFGSAKRLEI-NQPSISYICSRFYRAP 212

Query: 174 ELLFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDR------ 227
           EL+ G   YT+ +DIW +G +  E++L      GQ  + Q+    + LG P  +      
Sbjct: 213 ELILGCTQYTTQVDIWGLGCVIGEMLLGKAIFQGQEPLLQLREIAKLLGPPDKKFIFFSN 272

Query: 228 ---DWPEVSSFMTYNKLQIYPPPSRDELRKRFIAASEYALDFMCGMLTMNPQKRWTAVQC 284
              D P       Y+K  ++   S+    K F  A    +D +  +L   P+ R +  + 
Sbjct: 273 PGYDGP------LYSK-PLFSGTSQSRFEKYFGHAGVEGIDLLMKVLVYEPEIRLSPRRI 325

Query: 285 LESDYFKEL 293
           L   +F +L
Sbjct: 326 LAHPFFDDL 334

>AFR076W [3268] [Homologous to ScYJL106W (IME2) - SH]
           complement(564252..566714) [2463 bp, 820 aa]
          Length = 820

 Score =  104 bits (260), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 74/277 (26%), Positives = 135/277 (48%), Gaps = 35/277 (12%)

Query: 48  DMSAIREVKY-LQEMQHPNVIELIDIFM--AYDNLNLVLEFLPTDLEVVIK-DKSILFTP 103
           D + +RE+K+ LQ   H +++++ ++F+  +   L++V+E +  ++  ++K  K  +F+ 
Sbjct: 107 DYTRVREIKFILQIPAHAHLVQIYELFIDDSLYQLHIVMECMEQNIYQLMKCRKRRVFSL 166

Query: 104 ADIKAWMLMTLRGVYHCHRNFILHRDLKPNNLLFSPDGQ-----------------IKVA 146
             +++ +   L G+ H H +   HRD+KP N+L SP  +                 +K+A
Sbjct: 167 PTLRSILSQILSGIRHIHAHNFYHRDIKPENILISPANRYYSKEWISAGHYPDNYVVKIA 226

Query: 147 DFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKHYTSAIDIWSVGVIFAELMLRIPYLP 206
           D+GLAR +       T+ V TRWYR+PE+L     Y+  +DIW+ G +  E+    P  P
Sbjct: 227 DYGLARHV-TNKSPYTAYVSTRWYRSPEILLRQGSYSRPLDIWAFGCVAVEVATFKPLFP 285

Query: 207 GQNDVDQMEVTFRALGTPTDRDWPEVSSFMTYNK--LQIYPPPSRDELRKRFIAASEYA- 263
           G +++DQ+      LGTP      ++S ++ +    LQ     SR  L+  ++   + + 
Sbjct: 286 GADEMDQIWKILELLGTPHPCHESKISGYVPHGGAWLQAEHLASRLNLKFPYVEGKDISW 345

Query: 264 ------LDFMC----GMLTMNPQKRWTAVQCLESDYF 290
                 L+ +C      L  NP  R T     +  YF
Sbjct: 346 VMCNPQLESLCDVVRACLVWNPDDRATVEDLSQMPYF 382

>KLLA0F02838g 264329..266596 some similarities with sp|P32581
           Saccharomyces cerevisiae YJL106w IME2 ser/thr protein
           kinase, hypothetical start
          Length = 755

 Score =  103 bits (258), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 78/280 (27%), Positives = 134/280 (47%), Gaps = 41/280 (14%)

Query: 48  DMSAIREVKY-LQEMQHPNVIELIDIFM--AYDNLNLVLEFLPTDLEVVIKD-KSILFTP 103
           D + +RE+K+ LQ   H N++ + ++F+  +  +L++V+E +  ++  ++K  K  +F+ 
Sbjct: 107 DYTRVREIKFILQIPAHKNLVTIYEMFIDDSLYHLHIVMECMEQNIYQLMKHRKRRVFSL 166

Query: 104 ADIKAWMLMTLRGVYHCHRNFILHRDLKPNNLLFSPDGQ-----------------IKVA 146
             +++ +   L G+ H H +   HRD+KP N+L SP  +                 +K+A
Sbjct: 167 PTLRSILFQILAGIKHIHDHDFFHRDIKPENILISPSHRYFSKKWLEDDNYSDNYVVKLA 226

Query: 147 DFGLARAIP--APHEILTSNVVTRWYRAPELLFGAKHYTSAIDIWSVGVIFAELMLRIPY 204
           D+GLAR +   +P+   T+ V TRWYR+PE+L    +Y+  +DIW+ G +  EL    P 
Sbjct: 227 DYGLARHVNNRSPY---TTYVSTRWYRSPEILLRKGYYSKPLDIWAYGCVVVELATFSPL 283

Query: 205 LPGQNDVDQMEVTFRALGTPTDR------------DWPEVSSFMTYNKLQIYPPPSRDEL 252
            PG ++ DQ+      LG+P               D   +   + Y    +     RD L
Sbjct: 284 FPGSDETDQIWRILDLLGSPDHSINGKEHFGGSWLDSKPLYQALNYEFPYVEGKTIRDVL 343

Query: 253 RKRFIAASEYALDFMCGMLTMNPQKRWTAVQCLESDYFKE 292
               +   E   D +   L  NP +R TA +     YFKE
Sbjct: 344 PNPQL---EDLYDVVTSCLKWNPSERATANEICALPYFKE 380

>CAGL0K05709g complement(555903..559214) similar to sp|Q12263
           Saccharomyces cerevisiae YDR507c GIN4, start by
           similarity
          Length = 1103

 Score =  102 bits (254), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 83/303 (27%), Positives = 148/303 (48%), Gaps = 44/303 (14%)

Query: 13  VGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFK-------DGLDMSAI-----REVKYLQE 60
           +G G+   V L    +T ++ A+K I  + F+       +G   +A+     +E+  ++ 
Sbjct: 26  LGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNIEQEIIIMKL 85

Query: 61  MQHPNVIELIDIFMAYDNLNLVLEFLPT-DLEVVIKDKSILFTPADIKAWMLMTLRGVYH 119
           + HPNV+ L D++    +L LVLE+    +L  ++ ++  L     ++A+  + + G+ +
Sbjct: 86  LNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAFRQIII-GISY 144

Query: 120 CHRNFILHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGA 179
           CH   ++HRDLKP NLL      IK+ADFG+A A+ +  ++L ++  +  Y APE++ G 
Sbjct: 145 CHSLGVVHRDLKPENLLLDNKLNIKIADFGMA-ALESEDKLLETSCGSPHYAAPEIISGL 203

Query: 180 KHYTSAIDIWSVGVI-FAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWPEVSSFMTY 238
            +   + D+WS GVI FA L  R+P+       D+ +   R L              +  
Sbjct: 204 PYEGFSSDVWSCGVILFALLTGRLPF-------DEEDGNIRNL-------------LLKV 243

Query: 239 NKLQIYPPPSRDELRKRFIAASEYALDFMCGMLTMNPQKRWTAVQCLESDYFKELPPPSD 298
            K + +  P  DE+ K        A D +  +LT++P KR T  + L+    ++ P   D
Sbjct: 244 QKGE-FEMPDDDEITKE-------AQDLLARLLTVDPSKRITIREILKHPLLQKYPSIKD 295

Query: 299 PSS 301
             S
Sbjct: 296 SRS 298

>YDR507C (GIN4) [1321] chr4 complement(1462346..1465774)
           Serine/threonine-protein kinase required for septin
           organization at the bud neck, has similarity to Ycl024p
           [3429 bp, 1142 aa]
          Length = 1142

 Score =  101 bits (251), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 88/306 (28%), Positives = 143/306 (46%), Gaps = 47/306 (15%)

Query: 13  VGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFK---------------DGLDMSAIREVKY 57
           +G G+   V L    STG++ A+K I  + F                D L     RE+  
Sbjct: 25  LGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALPYGIEREIII 84

Query: 58  LQEMQHPNVIELIDIFMAYDNLNLVLEFLPT-DLEVVIKDKSILFTPADIKAWMLMTLRG 116
           ++ + HPNV+ L D++    +L LVLE+    +L  ++ ++  L     I+ +  + + G
Sbjct: 85  MKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIRFFRQIII-G 143

Query: 117 VYHCHRNFILHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELL 176
           V +CH   I+HRDLKP NLL      IK+ADFG+A A+    ++L ++  +  Y APE++
Sbjct: 144 VSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA-ALETEGKLLETSCGSPHYAAPEIV 202

Query: 177 FGAKHYTSAIDIWSVGVI-FAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWPEVSSF 235
            G  +   A D+WS GVI FA L  R+P+       D+ +   R L              
Sbjct: 203 SGIPYQGFASDVWSCGVILFALLTGRLPF-------DEEDGNIRTL-------------L 242

Query: 236 MTYNKLQIYPPPSRDELRKRFIAASEYALDFMCGMLTMNPQKRWTAVQCLESDYFKELPP 295
           +   K + +  PS DE+       S  A D +  +LT++P++R      L+    ++ P 
Sbjct: 243 LKVQKGE-FEMPSDDEI-------SREAQDLIRKILTVDPERRIKTRDILKHPLLQKYPS 294

Query: 296 PSDPSS 301
             D  S
Sbjct: 295 IRDSKS 300

>YCL024W (KCC4) [520] chr3 (79161..82274) Serine/threonine protein
           kinase involved in septin organization and cell cycle
           control [3114 bp, 1037 aa]
          Length = 1037

 Score = 99.4 bits (246), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 68/203 (33%), Positives = 107/203 (52%), Gaps = 13/203 (6%)

Query: 13  VGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAI---------REVKYLQEMQH 63
           +G G+   V L     TG + A+K I  S F +  + S           RE+  ++ + H
Sbjct: 27  LGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYNIEREIVIMKLLSH 86

Query: 64  PNVIELIDIFMAYDNLNLVLEFLPT-DLEVVIKDKSILFTPADIKAWMLMTLRGVYHCHR 122
           PNV+ L D++   +NL L+LE+    +L  ++ D   L     I  +  + + G+ +CH 
Sbjct: 87  PNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQIII-GISYCHA 145

Query: 123 NFILHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKHY 182
             I+HRDLKP NLL      IK+ADFG+A A+    ++L ++  +  Y APE++ G  + 
Sbjct: 146 LGIVHRDLKPENLLLDSFYNIKIADFGMA-ALQTDADLLETSCGSPHYAAPEIVSGLPYE 204

Query: 183 TSAIDIWSVGVI-FAELMLRIPY 204
             A D+WS GVI FA L  R+P+
Sbjct: 205 GFASDVWSCGVILFALLTGRLPF 227

>Kwal_23.6325
          Length = 1542

 Score = 98.6 bits (244), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 80/300 (26%), Positives = 138/300 (46%), Gaps = 46/300 (15%)

Query: 3    VNMEYTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDM-SAIRE-VKYLQE 60
            V++ + K + VG G +  V+      TG  +A+KEIK  + K    +  AI+E +  L+ 
Sbjct: 1245 VSIRWQKRQFVGGGAFGTVFSAVNLDTGEILAVKEIKIQDRKSMKQVFPAIKEEMSVLEM 1304

Query: 61   MQHPNVIELIDIFMAYDNLNLVLEFLPTDLEVVIKDKSILFTPADIKAWMLMTLRGVYHC 120
            + HPNV++   + +  D +NL +E+        + +   +      + + L  L G+ + 
Sbjct: 1305 LNHPNVVQYYGVEVHRDKVNLFMEYCEGGSLAQLLEHGRIEDEMVTQIYALQMLEGLAYL 1364

Query: 121  HRNFILHRDLKPNNLLFSPDGQIKVADFGLARAIPA------------PHEILTSNVVTR 168
            H++ ++HRD+KP N+L   +G IK  DFG AR++ A              + + S + T 
Sbjct: 1365 HQSSVVHRDIKPENILLDFNGVIKYVDFGAARSLAANGTKAPNVGAEGKADGVNSMMGTP 1424

Query: 169  WYRAPELLFGAKHYT-SAIDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDR 227
             Y +PE + GAK     + DIWS+G +  E+                 VT R      D 
Sbjct: 1425 MYMSPESITGAKKGKFGSGDIWSLGCVILEM-----------------VTGRRPWFNLDN 1467

Query: 228  DWPEVSSFMTYNKLQIYPP--PSRDELRKRFIAASEYALDFMCGMLTMNPQKRWTAVQCL 285
            +W      + Y+    + P  P+++EL       S   +DF+   L  +P KR TA++ L
Sbjct: 1468 EWA-----IMYHVAAGHVPQLPTKEEL-------SPQGIDFLLRCLKQDPNKRSTAMELL 1515

>CAGL0G02035g 179911..180930 highly similar to sp|P19454
           Saccharomyces cerevisiae YOR061w CKA2 casein kinase II
           alpha chain, start by similarity
          Length = 339

 Score = 95.1 bits (235), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 84/299 (28%), Positives = 142/299 (47%), Gaps = 37/299 (12%)

Query: 12  KVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEMQH-PNVIELI 70
           K+G G Y+ V+ G   +  +   IK +K  + K        RE+K L  +   PNVI L+
Sbjct: 55  KIGRGKYSEVFSGKCITNDQPCVIKVLKPVKMK-----KIYRELKILTNLTGGPNVIGLL 109

Query: 71  DIFM--AYDNLNLVLEFLPTDLEVVIKDKSIL---FTPADIKAWMLMTLRGVYHCHRNFI 125
           DI    A     L+ E      EV   D   L   FT  D++ +    L  + +CH   I
Sbjct: 110 DIVQDQASKIPALIFE------EVKNADFRTLYPSFTLQDLQYYFTQLLIALDYCHSMGI 163

Query: 126 LHRDLKPNNLLFSP-DGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKHYTS 184
           +HRD+KP N++  P   ++++ D+GLA     P       V +R+++ PELL     Y  
Sbjct: 164 MHRDVKPQNVMIDPAQKKLRLIDWGLAE-FYHPGVDYNVRVASRYHKGPELLVNLNQYDY 222

Query: 185 AIDIWSVGVIFAELMLRI-PYLPGQNDVDQMEVTFRALGTPTDRDWPEVSSFMTYNKLQI 243
           ++D+WSVG + A ++ +  P+  G ++ DQ+      LGT       E+ +++    L++
Sbjct: 223 SLDLWSVGCMLAAIIFKKEPFFKGSSNADQLVKIADVLGT------KELMAYLAKYGLKL 276

Query: 244 ---YPPPSRDELRK---RFIAASE-----YALDFMCGMLTMNPQKRWTAVQCLESDYFK 291
              Y    RD  RK    F+ +S        +D +  +L  + Q+R TA + ++ ++FK
Sbjct: 277 PSEYDHIMRDFTRKPWEHFVTSSTPLAVPVLVDLVDHLLRYDHQERLTAREAMDHEFFK 335

>CAGL0J11638g complement(1128620..1130860) highly similar to
           sp|P32562 Saccharomyces cerevisiae YMR001c CDC5 involved
           in regulation of DNA replication, hypothetical start
          Length = 746

 Score = 97.1 bits (240), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 68/247 (27%), Positives = 125/247 (50%), Gaps = 12/247 (4%)

Query: 6   EYTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEI-KTSEFKDGLDMSAIREVKYLQEMQHP 64
           +Y + + +GEG +A  +   +  +G+  A K + K S   +      + E++  + M H 
Sbjct: 80  DYHRGQFLGEGGFARCF-QIKDDSGKIFAAKTVAKISIKSEKTRKKLLSEIQIHKSMSHT 138

Query: 65  NVIELIDIFMAYDNLNLVLEFLPTD--LEVVIKDKSILFTPADIKAWMLMTLRGVYHCHR 122
           N+++ ID F    N+ ++LE  P    +E++ K K+I  T  +++ +M     G+ + H 
Sbjct: 139 NIVQFIDCFEDNVNVYILLEICPNGSLMELIKKRKTI--TEPEVRFFMTQICGGIQYMHS 196

Query: 123 NFILHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKH- 181
           N ++HRDLK  N+ F     +K+ DFGLA  +    E   +   T  Y APE+L G KH 
Sbjct: 197 NRVIHRDLKLGNIFFDEHYNLKIGDFGLAAVLANDRERKFTICGTPNYIAPEVLMG-KHS 255

Query: 182 -YTSAIDIWSVGVIFAELMLRIPYLPGQNDVDQM--EVTFRALGTPTDRDWPEVSSFMTY 238
            ++  +DIWS+GV+   L++  P    + DV+ +   +  R    P D+   + + ++  
Sbjct: 256 GHSYEVDIWSIGVMLYALLIGKPPFQAK-DVNTIYERIKQRNFAYPKDKKISQDAKYLID 314

Query: 239 NKLQIYP 245
           + L + P
Sbjct: 315 DILSLNP 321

>KLLA0E03487g complement(323764..325707) similar to sgd|S0002874
           Saccharomyces cerevisiae YDR466w, start by similarity
          Length = 647

 Score = 96.7 bits (239), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 64/216 (29%), Positives = 105/216 (48%), Gaps = 7/216 (3%)

Query: 6   EYTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKT----SEFKDGLDMSAIREVKYLQEM 61
           +++ ++++G G+Y+ VY     STG+  AIK        SE K          +  L   
Sbjct: 9   DFSFKERLGHGSYSTVYKAVDRSTGQLFAIKVCSKKHIISENKVKYVTIEKNTLNLLAHG 68

Query: 62  QHPNVIELIDIFMAYDNLNLVLEFLPTDLEVVIKDKSILFTPADIKAWMLMTLRGVYHCH 121
            HP +I+L   F   +NL  VL+F P    + +      F  A  K +M   +  + + H
Sbjct: 69  NHPGIIKLYYTFHDSENLYFVLDFAPGGELLQLLQTQGRFNEAWTKHFMCQLIDALEYIH 128

Query: 122 RNFILHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSN--VVTRWYRAPELLFGA 179
              ++HRDLKP NLL S +G++ + DFG+A  + A   + +++  V T  Y +PELL   
Sbjct: 129 GCKVVHRDLKPENLLLSSEGKLMITDFGVASNLAATDNLSSTSSFVGTAEYVSPELLLQN 188

Query: 180 KHYTSAIDIWSVGVIFAELMLRIPYLPGQNDVDQME 215
           K    + DIW+VG +  +     P   G+N++   E
Sbjct: 189 KSNFCS-DIWAVGCMLYQFTQGTPPFRGENELAAFE 223

>ABR014W [605] [Homologous to ScYHL007C (STE20) - SH]
           complement(417710..420625) [2916 bp, 971 aa]
          Length = 971

 Score = 96.7 bits (239), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 69/229 (30%), Positives = 112/229 (48%), Gaps = 19/229 (8%)

Query: 12  KVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEMQHPNVIELID 71
           K+G+G    VY   +  T   +AIK++     K       I E+  ++  +H N++  ID
Sbjct: 688 KIGQGASGGVYTAYEIGTNASVAIKQMNLE--KQPKKELIINEILVMKGSRHNNIVNFID 745

Query: 72  IFMAYDNLNLVLEFLPTDLEVVIKDKSILFTPADIKAWMLMTLRGVYHCHRNFILHRDLK 131
            ++   +L +++E++       +    IL T   I A    TLRG++  H   ++HRD+K
Sbjct: 746 SYLLKGDLWVIMEYMEGGSLTDVVTHCIL-TEGQIAAVSRETLRGLHFLHSKGVIHRDIK 804

Query: 132 PNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKHYTSAIDIWSV 191
            +N+L S DG IK+ DFG    I   +   T+ V T ++ APE++   K Y   +DIWS+
Sbjct: 805 SDNILLSMDGNIKLTDFGFCAQINETNLKRTTMVGTPYWMAPEVV-SRKEYGPKVDIWSL 863

Query: 192 GVIFAELM-LRIPYLPGQNDVDQMEVTFRAL------GTPTDRDWPEVS 233
           G++  E++    PYL         E   RAL      GTP  +D   +S
Sbjct: 864 GIMIIEMIEGEPPYL--------NETPLRALYLIATNGTPKLKDADSLS 904

>AFR696C [3889] [Homologous to ScYDR507C (GIN4) - SH; ScYCL024W
           (KCC4) - SH] (1721689..1725117) [3429 bp, 1142 aa]
          Length = 1142

 Score = 96.7 bits (239), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 80/303 (26%), Positives = 139/303 (45%), Gaps = 44/303 (14%)

Query: 13  VGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFK------------DGLDMSAIREVKYLQE 60
           +G G+   V L     TG+  A+K I  S F             D L     RE+  ++ 
Sbjct: 25  LGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGIEREIIIMKL 84

Query: 61  MQHPNVIELIDIFMAYDNLNLVLEFLPT-DLEVVIKDKSILFTPADIKAWMLMTLRGVYH 119
           + HPNV+ L D++    +L +VLE++   +L  ++  +  L     ++ +  + + G+ +
Sbjct: 85  LNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFRQIII-GISY 143

Query: 120 CHRNFILHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGA 179
           CH   I+HRDLKP NLL      IK+ADFG+A A+ +  ++L ++  +  Y APE++ G 
Sbjct: 144 CHALGIVHRDLKPENLLLDHKFNIKLADFGMA-ALESKDKLLETSCGSPHYAAPEIVSGL 202

Query: 180 KHYTSAIDIWSVGVI-FAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWPEVSSFMTY 238
            ++    D+WS GVI +A L  R+P+                     D +   + + +  
Sbjct: 203 PYHGFESDVWSCGVILYALLTGRLPF---------------------DEEDGNIRNLLLK 241

Query: 239 NKLQIYPPPSRDELRKRFIAASEYALDFMCGMLTMNPQKRWTAVQCLESDYFKELPPPSD 298
            +   Y  P  DE+       S  A D +  +LT+ P++R    + L+    ++ P   D
Sbjct: 242 VQSGKYEIPGEDEI-------SPEARDLIVQILTVEPEQRIKTREILKHPLLQKYPSIKD 294

Query: 299 PSS 301
             S
Sbjct: 295 SKS 297

>ADR204W [1945] [Homologous to ScYOR061W (CKA2) - SH]
           complement(1062595..1063614) [1020 bp, 339 aa]
          Length = 339

 Score = 94.0 bits (232), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 83/311 (26%), Positives = 143/311 (45%), Gaps = 34/311 (10%)

Query: 2   KVNMEYTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEM 61
           K+N  Y    K+G G Y+ V+ G          IK +K  + K        RE+K L  +
Sbjct: 46  KIN-NYEIINKIGRGKYSEVFRGKSIVNDHPCVIKVLKPVKMK-----KIYRELKILTNL 99

Query: 62  QH-PNVIELIDIFMAYDNLNLVLEFLPTDLEVVIKDKSILFTPADIKAWMLMTLRGVYHC 120
              PN+I L+DI     +    L F      V  +     FT +D + +    L  + +C
Sbjct: 100 TGGPNIIGLLDIVQDPGSKIPALIFEEVK-NVEFRTLYPAFTLSDTQHYFKQLLIALDYC 158

Query: 121 HRNFILHRDLKPNNLLFSP-DGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGA 179
           H   I+HRD+KP N++  P + ++++ D+GLA     P       V +R+++ PELL   
Sbjct: 159 HSMGIMHRDVKPQNVMIDPTERKLRLIDWGLAE-FYHPGVDYNVRVASRYHKGPELLVNL 217

Query: 180 KHYTSAIDIWSVGVIFAELMLRI-PYLPGQNDVDQMEVTFRALGTPTDRDWPEVSSFMTY 238
             Y  ++D+WSVG + A ++ +  P+  G  + DQ+    R LGT       ++ +++ +
Sbjct: 218 NQYDYSLDLWSVGCMLAAIVFKKEPFFKGSTNPDQLVKIARVLGT------KQLLAYLEH 271

Query: 239 NKLQIYPPPSRDELRKRF--------------IAASEYALDFMCGMLTMNPQKRWTAVQC 284
             L +  P   D + K F              +A  E  +D +  +L  + Q+R TA + 
Sbjct: 272 YGLTL--PHEYDNIMKDFERKPWSYFISDDNTLAVPE-VVDLIDHLLRYDHQERLTAKEA 328

Query: 285 LESDYFKELPP 295
           ++ D+FK+  P
Sbjct: 329 MDHDFFKKEYP 339

>ACR249C [1296] [Homologous to ScYJL141C (YAK1) - SH]
           (797020..798951) [1932 bp, 643 aa]
          Length = 643

 Score = 95.9 bits (237), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 96/327 (29%), Positives = 154/327 (47%), Gaps = 61/327 (18%)

Query: 13  VGEGTYAVVYLGCQHSTGRKI-AIKEIKT-SEFKDGLDMSA-IREV--KYLQEMQHPNVI 67
           +G+GT+  V + CQ+   ++I A+K +K+ +E+ +   M A I E+  K +  +   + +
Sbjct: 279 LGQGTFGQV-VKCQNMQTKEIVAVKVVKSKTEYLNQSIMEAKILELLNKRIDPLNQHHFL 337

Query: 68  ELIDIFMAYDNLNLVLEFLPTDL-EVVIKDKSILFTPADIKAWMLMTLRGVYHCHRNFIL 126
            L D F+  ++L LV E L  +L E++ ++K    +   IK +    L  +     + ++
Sbjct: 338 RLHDSFVHKNHLCLVFELLSNNLYELLKQNKFHGLSMNLIKNFCKQLLDSLCVLKESKLI 397

Query: 127 HRDLKPNN-LLFSPDG-QIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKHYTS 184
           H DLKP N LL SPD  ++KV DFG A         + + + +R+YRAPE+L G   Y++
Sbjct: 398 HCDLKPENVLLVSPDRPELKVIDFGSA---CEEARTVYTYIQSRFYRAPEVLMGIP-YST 453

Query: 185 AIDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWPEVSSFMTYNKLQIY 244
           +ID+WS G I AEL L IP  PG ++ +QM      LG P    W       TYN  +  
Sbjct: 454 SIDMWSFGCIVAELFLGIPVFPGASEFNQMTRIVEMLGVPP--PWMCEMGKNTYNFFRKL 511

Query: 245 PPPSR-----------------DELRKRF------------------IAASEYALD---- 265
            P  +                 +E+ K++                  I AS   L+    
Sbjct: 512 HPQEKAWALKTVDEYNVEFNASEEVGKQYFKWTKLDDVIRNYRISKKIGASSQLLEREMQ 571

Query: 266 -------FMCGMLTMNPQKRWTAVQCL 285
                  F+ G+L +NP +RWT  Q L
Sbjct: 572 DRQCLTHFLFGVLNLNPLERWTPQQAL 598

>Scas_493.2
          Length = 1117

 Score = 95.9 bits (237), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 84/306 (27%), Positives = 140/306 (45%), Gaps = 47/306 (15%)

Query: 13  VGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFK---------------DGLDMSAIREVKY 57
           +G G+   V L    +T ++ AIK I  S F                D L     RE+  
Sbjct: 28  LGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDSLPYGIEREIII 87

Query: 58  LQEMQHPNVIELIDIFMAYDNLNLVLEFLPT-DLEVVIKDKSILFTPADIKAWMLMTLRG 116
           ++ ++H NV+ L D++    NL ++LE+    +L  ++ +K  L     ++ +  + + G
Sbjct: 88  MKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVRFFRQIII-G 146

Query: 117 VYHCHRNFILHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELL 176
           + +CH   I+HRDLKP NLL      IK+ADFG+A A+    ++L ++  +  Y APE++
Sbjct: 147 ISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMA-ALETEDKLLETSCGSPHYAAPEIV 205

Query: 177 FGAKHYTSAIDIWSVGVI-FAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWPEVSSF 235
            G  ++    D+WS GVI FA L  R+P+       D+ +   R L              
Sbjct: 206 SGIPYHGFESDVWSCGVILFALLTGRLPF-------DEEDGNIRNL-------------L 245

Query: 236 MTYNKLQIYPPPSRDELRKRFIAASEYALDFMCGMLTMNPQKRWTAVQCLESDYFKELPP 295
           +     Q +  P  DE+       S  A D +  +LT++P KR    + L+    ++ P 
Sbjct: 246 LKVQSGQ-FEMPDDDEM-------SRDAQDLISRILTVDPTKRIKTREILKHPLLQKYPS 297

Query: 296 PSDPSS 301
             D  S
Sbjct: 298 IKDSKS 303

>KLLA0F11143g complement(1026129..1028570) similar to sp|P22216
           Saccharomyces cerevisiae YPL153c SPK1 ser/thr/tyr
           protein kinase, start by similarity
          Length = 813

 Score = 95.1 bits (235), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 80/291 (27%), Positives = 134/291 (46%), Gaps = 43/291 (14%)

Query: 13  VGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEMQHPNVIELIDI 72
           VG+G +A V    + STG+  A+K I   +  D  D    RE+  LQ++ HP +++L D 
Sbjct: 198 VGQGAFATVKKAVERSTGKTFAVKIIHKRKVMDKFD-GVKRELDVLQKLNHPRIVKLKDF 256

Query: 73  FMAYDNLNLVLEFLP-TDLEVVIKDKSILFTPADIKAWMLMTLRGVYHCHRNFILHRDLK 131
           F   DN  +++EF+   DL   +     +   A  +      L  V + H   I HRDLK
Sbjct: 257 FEDNDNYYMLMEFVSGGDLMDFVAAHGTVGEDAG-REITRQVLEAVKYMHDQGISHRDLK 315

Query: 132 PNNLLFSPDG--QIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKH-------- 181
           P+N++   D    IK+ DFGLA+ +   +  L +   T  Y APE++ G           
Sbjct: 316 PDNIMIEQDDPVLIKITDFGLAK-VQNQNTFLNTFCGTLAYVAPEVIDGKNAEDKTNRDL 374

Query: 182 YTSAIDIWSVG-VIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWPEVSSFMTYNK 240
           Y+S +D+WS+G +++  L   +P+  GQ+   Q E+                  F    +
Sbjct: 375 YSSLVDMWSIGCLVYVILTGHLPF-SGQS---QNEL------------------FKQIKR 412

Query: 241 LQIYPPPSRDELRKRFIAASEYALDFMCGMLTMNPQKRWTAVQCLESDYFK 291
              +  P +D         SE A +F+  +L ++P++R  A + L+  + K
Sbjct: 413 GSYHEGPLKD------YRISEEARNFIDCLLNVDPKERMNAGKALQHPWMK 457

>Kwal_26.7355
          Length = 1446

 Score = 95.5 bits (236), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 78/296 (26%), Positives = 146/296 (49%), Gaps = 52/296 (17%)

Query: 7    YTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEF--KDGLDMS---AIR-EVKYLQE 60
            + K + +G+G++  V+LG   +TG  IA+K+++   +  +D   +S   A+R EV  L++
Sbjct: 1146 WIKGEMIGKGSFGSVFLGLNVTTGEMIAVKQVEVPRYGSQDETTLSVLEALRSEVATLKD 1205

Query: 61   MQHPNVIELIDIFMAYDNLNLVLEFLPTDLEVVIKDK--SIL-----FTPADIKAWMLMT 113
            + H N+++    ++ ++N N V       LE V      S++     F    I+   +  
Sbjct: 1206 LDHTNIVQ----YLGFENKNYVYSLF---LEYVAGGSVGSLIRLYGKFDENLIRFLAVQV 1258

Query: 114  LRGVYHCHRNFILHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTR----W 169
            LRG+ + H   ILHRD+K +NLL   DG  K++DFG+++     + I +++ +T     +
Sbjct: 1259 LRGLSYLHSKKILHRDMKADNLLLDVDGICKISDFGISK---KSNNIYSNSDMTMRGTVF 1315

Query: 170  YRAPELLFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDW 229
            + APE++   + Y++ +DIWS+G +  E+        G+     +EV             
Sbjct: 1316 WMAPEMVDTKQGYSAKVDIWSLGCVVLEM------FAGKRPWSNLEV------------- 1356

Query: 230  PEVSSFMTYNKLQIYPPPSRDELRKRFIAASEYALDFMCGMLTMNPQKRWTAVQCL 285
              V++     K +  PP   D   ++ I+A     +F+     +NP+KR TA + L
Sbjct: 1357 --VAAMFKIGKFKSAPPIPEDT--QKIISAE--GKEFLDACFEINPEKRPTADELL 1406

>Kwal_26.7861
          Length = 955

 Score = 95.1 bits (235), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 82/298 (27%), Positives = 133/298 (44%), Gaps = 53/298 (17%)

Query: 12  KVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEMQHPNVIELID 71
           K+G+G    VY   +  T   +AIK++     K       I E+  ++  +H N++  ID
Sbjct: 672 KIGQGASGGVYTAYEVGTNASVAIKQMNLE--KQPKKELIINEILVMKASKHANIVNFID 729

Query: 72  IFMAYDNLNLVLEFLPTDLEVVIKDKSILFTPADIKAWMLMTLRGVYHCHRNFILHRDLK 131
            ++   +L +V+E++       +    IL T   I A    TL+G+   H   ++HRD+K
Sbjct: 730 SYLLRGDLWVVMEYMEGGSLTDVVTHCIL-TEGQIGAVSRETLKGLQFLHSKGVIHRDIK 788

Query: 132 PNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKHYTSAIDIWSV 191
            +N+L S  G+IK+ DFG    I   +   T+ V T ++ APE++   K Y   +DIWS+
Sbjct: 789 SDNVLLSMSGEIKLTDFGFCAQINEINLKRTTMVGTPYWMAPEVV-SRKEYGPKVDIWSL 847

Query: 192 GVIFAELML-RIPYLPGQNDVDQMEVTFRAL------GTPTDRDWPEVSSFMTYNKLQIY 244
           G++  E++    PYL         E   RAL      GTP  +D   +S           
Sbjct: 848 GIMIIEMIEGEPPYL--------NETPLRALYLIATNGTPELKDADSLS----------- 888

Query: 245 PPPSRDELRKRFIAASEYALDFMCGMLTMNPQKRWTAVQCLE-------SDYFKELPP 295
                D+L+            F+   L +NP +R TA Q L        +D+ + L P
Sbjct: 889 -----DDLKS-----------FLGWCLHVNPDERATASQLLSDPFISTYADHVRSLAP 930

>CAGL0K02673g complement(240509..243256) similar to sp|Q03497
           Saccharomyces cerevisiae YHL007c STE20
           Serine/threonine-protein kinase, hypothetical start
          Length = 915

 Score = 94.7 bits (234), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 79/291 (27%), Positives = 132/291 (45%), Gaps = 50/291 (17%)

Query: 12  KVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEMQHPNVIELID 71
           K+G+G    VY+     +   +AIK++     K       + E+  ++E +H N++  ID
Sbjct: 625 KIGQGASGGVYIAHDTESEDSVAIKQMNLE--KQPKKELILNEILVMRESKHSNIVNFID 682

Query: 72  IFMAYDNLNLVLEFLPTD--LEVVIKDKSILFTPADIKAWMLMTLRGVYHCHRNFILHRD 129
            ++A  +L +V+E++      +VV      L +   I A    TL+G+   H   +LHRD
Sbjct: 683 SYLAKGDLWIVMEYMEGGSLTDVVTH---CLLSEGQIGAVCRETLKGLQFLHSKGVLHRD 739

Query: 130 LKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKHYTSAIDIW 189
           +K +N+L S  G IK+ DFG    I   +   T+ V T ++ APE++   K Y   +DIW
Sbjct: 740 IKSDNILLSLKGNIKLTDFGFCAQINENNLKRTTMVGTPYWMAPEVV-SRKEYGPKVDIW 798

Query: 190 SVGVIFAELML-RIPYLPGQNDVDQMEVTFRAL------GTPTDRDWPEVSSFMTYNKLQ 242
           S+G++  E++    PYL         E   RAL      GTP  ++ PE           
Sbjct: 799 SLGIMIIEMIEGEPPYL--------NETPLRALYLIATNGTPKLKE-PE----------- 838

Query: 243 IYPPPSRDELRKRFIAASEYALDFMCGMLTMNPQKRWTAVQCLESDYFKEL 293
                          A S+    F+   L ++P +R TA + L+  +  E+
Sbjct: 839 ---------------ALSDTLTKFLDWCLKVDPSERATATELLDDPFITEI 874

>Kwal_47.18098
          Length = 374

 Score = 92.8 bits (229), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 85/339 (25%), Positives = 148/339 (43%), Gaps = 62/339 (18%)

Query: 4   NMEYTKEKKVGEGTYAVVYLGCQHSTGRKIAI------------KEIKT----------- 40
           N  Y  E KVG G Y+ V+ G Q ST  KI I            +EI             
Sbjct: 37  NGTYEIEMKVGRGKYSEVFQGVQLSTESKIVIKMLKPVKKKKIKREISILTNLSNETNPP 96

Query: 41  -------SEFKDGLDMSAI----REVKYLQEMQHPNVIELIDIFMAYDNLNLVLEFLPTD 89
                    + +    S I    +EV  L    H N+I+L+D+   + +    L F   D
Sbjct: 97  TAQPFDRDAYYENKKESVIEFTRQEVYELAHDGHKNIIQLLDVVKDHVSKTPALVFEHVD 156

Query: 90  LEVVIKDKSILFTPADIKAWMLMTLRGVYHCHRNFILHRDLKPNNLLFS-PDGQIKVADF 148
             +  +     F   DI+ +M   L+ + +CH   I+HRD+KP+N++      ++++ D+
Sbjct: 157 -NIDFRTLYPTFQDLDIRYYMFELLKALDYCHSMGIMHRDVKPHNVMIDHKRKKLRLIDW 215

Query: 149 GLARAIPAPHEILTSNVVTRWYRAPELLFGAKHYTSAIDIWSVGVIFAELML-RIPYLPG 207
           GLA     P+      V +R+++ PELL   + Y  ++D+WS G + A ++  + P+  G
Sbjct: 216 GLA-EFYHPNMEYNVRVASRFFKGPELLVDYRMYDYSLDLWSFGTMLASMIFQKEPFFHG 274

Query: 208 QNDVDQMEVTFRALGTPTDRDWPEVSSFMTY-NKLQIYPPPSRDELRK-------RFI-- 257
            ++ DQ+    R LG+           F  Y  K QI  P    ++ +       RF+  
Sbjct: 275 TSNTDQLVKIVRVLGS---------DDFENYLRKYQITLPQEFHDIDQYIRRPWHRFVND 325

Query: 258 -----AASEYALDFMCGMLTMNPQKRWTAVQCLESDYFK 291
                + +E  L+ +  +L  + Q+R TA + ++  +F+
Sbjct: 326 ANSHLSGNEEILNLIDNLLRYDHQERLTAREAMQHPWFE 364

>CAGL0I05896g 560169..562505 some similarities with sp|P14680
           Saccharomyces cerevisiae YJL141c YAK1 ser/thr protein
           kinase, hypothetical start
          Length = 778

 Score = 94.4 bits (233), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 70/220 (31%), Positives = 118/220 (53%), Gaps = 13/220 (5%)

Query: 13  VGEGTYAVVYLGCQH-STGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEMQHPN----VI 67
           +G+GT+  V + CQ+  T   IA+K +K+        +S  + ++ L E   PN     +
Sbjct: 367 LGQGTFGQV-VKCQNLQTKEIIAVKVVKSRSEYLNQSISEAKILELLNEKIDPNNKHHFL 425

Query: 68  ELIDIFMAYDNLNLVLEFLPTDL-EVVIKDKSILFTPADIKAWMLMTLRGVYHCHRNFIL 126
            + D F+  ++L LV E L  +L E++ ++K    +   I+ + +  L  +     + ++
Sbjct: 426 RMHDSFVHKNHLCLVFELLSNNLYELLKQNKFHGLSIQLIRTFTIQILDSLCVLKDSKLI 485

Query: 127 HRDLKPNN-LLFSPDG-QIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKHYTS 184
           H DLKP N LL SPD   +KV DFG   +       + + + +R+YRAPE++ G   Y++
Sbjct: 486 HCDLKPENILLCSPDKPDLKVIDFG---SSCEETRTVYTYIQSRFYRAPEIILGIP-YST 541

Query: 185 AIDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTP 224
           +ID+WS+G I AEL L IP  PG ++ +Q+      LG P
Sbjct: 542 SIDMWSLGCIVAELFLGIPIFPGSSEFNQLTRIITTLGYP 581

 Score = 28.9 bits (63), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 15/63 (23%), Positives = 29/63 (46%), Gaps = 5/63 (7%)

Query: 232 VSSFMTYNKLQIYPPPSRDELRKRFIAASEYALDFMCGMLTMNPQKRWTAVQCLESDYFK 291
           + ++  +  +Q  P     E++ R     E  + F+ G+L +NP +RWT  Q     +  
Sbjct: 668 IRNYRIHKNIQKSPELIEQEMKNR-----ECLIHFLKGILNLNPLERWTPQQAAMHPFIT 722

Query: 292 ELP 294
           + P
Sbjct: 723 QQP 725

>KLLA0C01650g 128119..131457 similar to sp|Q12263 Saccharomyces
           cerevisiae YDR507c GIN4 ser/thr protein kinase, start by
           similarity
          Length = 1112

 Score = 94.4 bits (233), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 76/303 (25%), Positives = 142/303 (46%), Gaps = 44/303 (14%)

Query: 13  VGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFK------------DGLDMSAIREVKYLQE 60
           +G G+   V +    + G++ A+K I  S F             D L     RE+  ++ 
Sbjct: 23  LGVGSTGKVVMAYNETKGQQAAVKIISKSIFNAQGSTMIGGNDPDVLPYGIEREIIIMKL 82

Query: 61  MQHPNVIELIDIFMAYDNLNLVLEFLPT-DLEVVIKDKSILFTPADIKAWMLMTLRGVYH 119
           + HPNV+ L D++    +L +VLE++   +L  ++ ++  L     ++ +  + + G+ +
Sbjct: 83  LNHPNVLRLYDVWETSKDLYMVLEYVEKGELFNLLVERGPLPENEAVRFFRQIII-GISY 141

Query: 120 CHRNFILHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGA 179
           CH   I+HRDLKP NLL      +K+ADFG+A A+ +  ++L ++  +  Y APE++ G 
Sbjct: 142 CHALGIVHRDLKPENLLLDHKFNVKLADFGMA-ALESKDKLLETSCGSPHYAAPEIVSGL 200

Query: 180 KHYTSAIDIWSVGVI-FAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWPEVSSFMTY 238
            ++    D+WS GVI +A L  R+P+                     D +   + + +  
Sbjct: 201 PYHGFESDVWSCGVILYALLTGRLPF---------------------DEEDGNIRNLLLK 239

Query: 239 NKLQIYPPPSRDELRKRFIAASEYALDFMCGMLTMNPQKRWTAVQCLESDYFKELPPPSD 298
            +   +  P  DE+       S  A D +  +LT++P++R    + L+    ++ P   D
Sbjct: 240 VQSGKFEMPGDDEI-------SSEAQDLIARILTVDPEQRIKTREILKHPLLRKYPSIKD 292

Query: 299 PSS 301
             S
Sbjct: 293 SKS 295

>CAGL0C05005g complement(467626..470856) similar to sp|P27636
           Saccharomyces cerevisiae YAR019c CDC15, hypothetical
           start
          Length = 1076

 Score = 94.0 bits (232), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 72/288 (25%), Positives = 134/288 (46%), Gaps = 37/288 (12%)

Query: 5   MEYTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEMQHP 64
           ++Y   + +G G+Y VVY      T +++AIKE+   +  + +D+  + E+  L+ + H 
Sbjct: 20  VQYQLRQIIGRGSYGVVYKATNKKTAQEVAIKEVNYQDDDELVDI--MSEIDLLKNLNHI 77

Query: 65  NVIELIDIFMAYDNLNLVLEFLPTDLEVVIKDKSILFTPADIKAWMLMTLRGVYHCHRNF 124
           N+++         NL ++LE+        +  ++   +  + K ++  TL G+ + H   
Sbjct: 78  NIVKYHGFIQKQHNLYIILEYCAKGSLKNLISRNRPMSEHEAKPYVRQTLNGLNYLHEQG 137

Query: 125 ILHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKHYTS 184
           ++HRD+K  N+L   +  +K+ADFG++  +      L  ++   W  APE++ G +  ++
Sbjct: 138 VIHRDIKAANILLDSENVVKLADFGVSTKVNNTAMTLAGSL--NWM-APEII-GNRGAST 193

Query: 185 AIDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWPEVSSFMTYNKLQIY 244
             DIWS+G    EL+   P  P  N +D M + + A+   +                  Y
Sbjct: 194 LSDIWSLGATVVELLTGNP--PFHNLID-MNI-YYAIENDS------------------Y 231

Query: 245 PPPSRDELRKRFIAASEYALDFMCGMLTMNPQKRWTAVQCLESDYFKE 292
            PPS         + S  A DF+      N  KR TAVQ L+ ++ + 
Sbjct: 232 FPPS---------SLSSGAKDFLQQCFAKNMYKRPTAVQLLQHNWLEN 270

>Scas_668.22
          Length = 893

 Score = 94.0 bits (232), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 61/200 (30%), Positives = 102/200 (51%), Gaps = 5/200 (2%)

Query: 7   YTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEMQHPNV 66
           YT   K+G+G    VY+  +  +   +AIK++     K       I E+  ++  +HPN+
Sbjct: 611 YTNLVKIGQGASGGVYIANEIGSNESVAIKQMNLE--KQPKKELIINEILVMKGSRHPNI 668

Query: 67  IELIDIFMAYDNLNLVLEFLPTDLEVVIKDKSILFTPADIKAWMLMTLRGVYHCHRNFIL 126
           +  ID ++   +L +++E++       +    IL T   I A    TL G+   H   +L
Sbjct: 669 VNFIDSYLLDGDLWVIMEYMEGGSLTDVVTHCIL-TEGQIGAVCRETLSGLQFLHSKGVL 727

Query: 127 HRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKHYTSAI 186
           HRD+K +N+L S  G IK+ DFG    I   +   T+ V T ++ APE++   K Y   +
Sbjct: 728 HRDIKSDNILLSISGDIKLTDFGFCAQINEINLKRTTMVGTPYWMAPEVV-SRKEYGPKV 786

Query: 187 DIWSVGVIFAELML-RIPYL 205
           DIWS+G++  E++    PYL
Sbjct: 787 DIWSLGIMIIEMIEGEPPYL 806

>YFR014C (CMK1) [1695] chr6 complement(172529..173869)
           Calcium/calmodulin-dependent serine/threonine protein
           kinase (CaM kinase) type I [1341 bp, 446 aa]
          Length = 446

 Score = 92.8 bits (229), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 81/283 (28%), Positives = 124/283 (43%), Gaps = 35/283 (12%)

Query: 11  KKVGEGTYAVVYLGCQHSTGRKIAIK-EIKTSEFKDGLDMSAI-REVKYLQEMQHPNVIE 68
           K +G GT+ VV       TG  +A+K  IK +   + + + A+  E+  LQ + HPN++ 
Sbjct: 41  KTLGAGTFGVVRQAKNTETGEDVAVKILIKKALKGNKVQLEALYDELDILQRLHHPNIVA 100

Query: 69  LIDIFMAYDNLNLVLEFLPTD--LEVVIKDKSILFTPADIKAWMLMTLRGVYHCHRNFIL 126
             D F + D   ++ +        + ++K     FT  D    ++  L  V + H   I+
Sbjct: 101 FKDWFESKDKFYIITQLAKGGELFDRILKKGK--FTEEDAVRILVEILSAVKYMHSQNIV 158

Query: 127 HRDLKPNNLLF---SPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKHYT 183
           HRDLKP NLL+   S +  + VADFG+A+ + +  E+L     +  Y APE+L    H  
Sbjct: 159 HRDLKPENLLYIDKSDESPLVVADFGIAKRLKSDEELLYKPAGSLGYVAPEVLTQDGH-G 217

Query: 184 SAIDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWPEVSSFMTYNKLQI 243
              DIWS+GVI   L+                  FRA           V  F+       
Sbjct: 218 KPCDIWSIGVITYTLLCGYS-------------AFRA---------ERVQDFLDECTTGE 255

Query: 244 YPPPSRDELRKRFIAASEYALDFMCGMLTMNPQKRWTAVQCLE 286
           YP       R  + + S  A  F+   L ++P KR TA + LE
Sbjct: 256 YPVKFH---RPYWDSVSNKAKQFILKALNLDPSKRPTAAELLE 295

>YHL007C (STE20) [2279] chr8 complement(95113..97932)
           Serine/threonine protein kinase of the pheromone
           response pathway, also participates in the filamentous
           growth and STE vegetative growth pathways [2820 bp, 939
           aa]
          Length = 939

 Score = 93.6 bits (231), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 81/289 (28%), Positives = 133/289 (46%), Gaps = 46/289 (15%)

Query: 12  KVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEMQHPNVIELID 71
           K+G+G    VY   +  T   +AIK++     K       I E+  ++  +HPN++  ID
Sbjct: 625 KIGQGASGGVYTAYEIGTNVSVAIKQMNLE--KQPKKELIINEILVMKGSKHPNIVNFID 682

Query: 72  IFMAYDNLNLVLEFLPTDLEVVIKDKSILFTPADIKAWMLMTLRGVYHCHRNFILHRDLK 131
            ++   +L +++E++       +    IL T   I A    TL G+   H   +LHRD+K
Sbjct: 683 SYVLKGDLWVIMEYMEGGSLTDVVTHCIL-TEGQIGAVCRETLSGLEFLHSKGVLHRDIK 741

Query: 132 PNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKHYTSAIDIWSV 191
            +N+L S +G IK+ DFG    I   +   T+ V T ++ APE++   K Y   +DIWS+
Sbjct: 742 SDNILLSMEGDIKLTDFGFCAQINELNLKRTTMVGTPYWMAPEVV-SRKEYGPKVDIWSL 800

Query: 192 GVIFAELML-RIPYLPGQNDVDQMEVTFRAL------GTPTDRDWPEVSSFMTYNKLQIY 244
           G++  E++    PYL         E   RAL      GTP  ++   +SS +        
Sbjct: 801 GIMIIEMIEGEPPYL--------NETPLRALYLIATNGTPKLKEPENLSSSL-------- 844

Query: 245 PPPSRDELRKRFIAASEYALDFMCGMLTMNPQKRWTAVQCLESDYFKEL 293
                    K+F       LD+ C  L + P+ R +A + L  +Y  E+
Sbjct: 845 ---------KKF-------LDW-C--LCVEPEDRASATELLHDEYITEI 874

>Scas_648.17
          Length = 340

 Score = 91.7 bits (226), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 83/309 (26%), Positives = 140/309 (45%), Gaps = 57/309 (18%)

Query: 12  KVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEMQH-PNVIELI 70
           K+G G Y+ V+ G   +      IK +K  + K        RE+K L  +   PNVIEL+
Sbjct: 55  KIGRGKYSEVFSGECVNNETPCVIKVLKPVKMK-----KIYRELKILTNLTGGPNVIELL 109

Query: 71  DI------------FMAYDNLNLVLEFLPTDLEVVIKDKSILFTPADIKAWMLMTLRGVY 118
           DI            F    N++   +  PT            FT  DI+ +    L  + 
Sbjct: 110 DIVQDPGSKIPALIFEEVKNMDF-RQLYPT------------FTLPDIQFYFTQLLIALN 156

Query: 119 HCHRNFILHRDLKPNNLLFSP-DGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLF 177
           +CH   I+HRD+KP N++  P + ++++ D+GLA     P       V +R+++ PELL 
Sbjct: 157 YCHSMGIMHRDVKPQNVMIDPKERKLRLIDWGLAE-FYHPGVDYNVRVASRYHKGPELLV 215

Query: 178 GAKHYTSAIDIWSVGVIFAELML-RIPYLPGQNDVDQMEVTFRALGTPTDRDWPEVSSFM 236
               Y  ++D+WSVG + A ++  R P+  G ++ DQ+      LGT       E+ +++
Sbjct: 216 NLNQYDYSLDLWSVGCMLAAIVFKREPFFKGSSNPDQLVRIAAVLGT------KELLAYL 269

Query: 237 TYNKLQIYPPPSRDELRKRF--------------IAASEYALDFMCGMLTMNPQKRWTAV 282
             NK  +  P   D + + F              +A  E  +D +  +L  + Q+R TA 
Sbjct: 270 --NKYGLKLPSEYDTIMRDFPRRPWDHFVSDATKLAVPE-MVDLIDHLLRYDHQERLTAQ 326

Query: 283 QCLESDYFK 291
           + ++  +FK
Sbjct: 327 EAMDHVFFK 335

>YJL095W (BCK1) [2820] chr10 (247171..251607) Serine/threonine protein
            kinase of the MEKK family involved in the cell wall
            integrity (low-osmolarity) and nutrient sensing pathways
            [4437 bp, 1478 aa]
          Length = 1478

 Score = 93.6 bits (231), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 74/287 (25%), Positives = 137/287 (47%), Gaps = 46/287 (16%)

Query: 13   VGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLD-----MSAIR-EVKYLQEMQHPNV 66
            +G+G++  VYL    +TG  +A+K+++  ++    +     + A+R EV  L+++ H N+
Sbjct: 1181 IGKGSFGAVYLCLNVTTGEMMAVKQVEVPKYSSQNEAILSTVEALRSEVSTLKDLDHLNI 1240

Query: 67   IELIDIFMAYDNLN----LVLEFLPTDLEVVIKDKSILFTPADIKAWMLMTLRGVYHCHR 122
            ++    ++ ++N N    L LE++       +      F    IK      L+G+ + H 
Sbjct: 1241 VQ----YLGFENKNNIYSLFLEYVAGGSVGSLIRMYGRFDEPLIKHLTTQVLKGLAYLHS 1296

Query: 123  NFILHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTR----WYRAPELLFG 178
              ILHRD+K +NLL   DG  K++DFG++R      +I +++ +T     ++ APE++  
Sbjct: 1297 KGILHRDMKADNLLLDQDGICKISDFGISR---KSKDIYSNSDMTMRGTVFWMAPEMVDT 1353

Query: 179  AKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWPEVSSFMTY 238
             + Y++ +DIWS+G I  E+        G+     +EV               V++    
Sbjct: 1354 KQGYSAKVDIWSLGCIVLEMFA------GKRPWSNLEV---------------VAAMFKI 1392

Query: 239  NKLQIYPPPSRDELRKRFIAASEYALDFMCGMLTMNPQKRWTAVQCL 285
             K +  PP   D L       S+   +F+     +NP+KR TA + L
Sbjct: 1393 GKSKSAPPIPEDTL----PLISQIGRNFLDACFEINPEKRPTANELL 1435

>KLLA0B13607g 1191592..1194561 weakly similar to sp|Q03497
           Saccharomyces cerevisiae YHL007c STE20 ser/thr protein
           kinase of the pheromone pathway, hypothetical start
          Length = 989

 Score = 92.8 bits (229), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 77/289 (26%), Positives = 127/289 (43%), Gaps = 46/289 (15%)

Query: 12  KVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEMQHPNVIELID 71
           K+G+G    VY   +  T   +AIK++     K       + E+  ++  +H N++  ID
Sbjct: 703 KIGQGASGGVYTAYELGTNASVAIKQMNLE--KQPKKELIVNEILVMKGSKHNNIVNFID 760

Query: 72  IFMAYDNLNLVLEFLPTDLEVVIKDKSILFTPADIKAWMLMTLRGVYHCHRNFILHRDLK 131
            ++   +L +V+E++       +    IL T   I A    TL+G+   H   ++HRD+K
Sbjct: 761 SYLFRGDLWVVMEYMEGGSLTDVVTHCIL-TEGQIGAVSRETLKGLQFLHSKGVIHRDIK 819

Query: 132 PNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKHYTSAIDIWSV 191
            +N+L S +G IK+ DFG    I   +   T+ V T ++ APE++   K Y   +DIWS+
Sbjct: 820 SDNILLSMNGDIKLTDFGFCAQINEVNLKRTTMVGTPYWMAPEVV-SRKEYGPKVDIWSL 878

Query: 192 GVIFAELML-RIPYLPGQNDVDQMEVTFRAL------GTPTDRDWPEVSSFMTYNKLQIY 244
           G++  E++    PYL         E   RAL      GTP  +D   +S  M        
Sbjct: 879 GIMIIEMIEGEPPYL--------NETPLRALYLIATNGTPKLKDPGNLSHKMAM------ 924

Query: 245 PPPSRDELRKRFIAASEYALDFMCGMLTMNPQKRWTAVQCLESDYFKEL 293
                                F+   L ++P+ R TA   LE  +  E+
Sbjct: 925 ---------------------FLNWCLMVDPEDRGTAADLLEDPFITEI 952

>Kwal_0.96
          Length = 427

 Score = 91.7 bits (226), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 83/289 (28%), Positives = 130/289 (44%), Gaps = 37/289 (12%)

Query: 6   EYTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSA---IREVKYLQEMQ 62
           +Y   K +G G++ VV    Q S+G  +AIK +     K G D+       E+  LQ++ 
Sbjct: 45  DYIFGKTLGAGSFGVVRQARQVSSGENVAIKILLKKALK-GKDVELQMLYDELSILQKLD 103

Query: 63  HPNVIELIDIFMAYDNLNLVLEFLPTDLEVVIKD-KSILFTPADIKAWMLMTLRGVYHCH 121
           HPN+++  D F + D   +V + L T  E+  +  K   FT  D    +   L+ V + H
Sbjct: 104 HPNIVKFKDWFESKDKFYIVTQ-LATGGELFDRILKQGKFTEEDAVRIVYQILKAVEYLH 162

Query: 122 RNFILHRDLKPNNLLF---SPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFG 178
              I+HRDLKP NLL+   + D Q+ + DFG+A+ +    E++     +  Y APE++  
Sbjct: 163 SRNIVHRDLKPENLLYLTEAADSQLVLGDFGIAKELKNDDELIHKAAGSMGYVAPEVVTT 222

Query: 179 AKHYTSAIDIWSVGVIFAELMLRI-PYLPGQNDVDQMEVTFRALGTPTDRDWPEVSSFMT 237
           + H     DIWS+GV+   L+    P++    +    E T     TP     P  S+   
Sbjct: 223 SGH-GKPCDIWSLGVVTYTLLCGYSPFVAESVEGFLEECTIGR--TPVTFHKPYWSNI-- 277

Query: 238 YNKLQIYPPPSRDELRKRFIAASEYALDFMCGMLTMNPQKRWTAVQCLE 286
                                 S  A DF+   LT+NP  R TA + L+
Sbjct: 278 ----------------------SNEAKDFILRALTVNPHDRPTATELLQ 304

>KLLA0F16467g 1519800..1520822 highly similar to sp|P19454
           Saccharomyces cerevisiae YOR061w CKA2 casein kinase II
           alpha chain, start by similarity
          Length = 340

 Score = 90.5 bits (223), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 80/302 (26%), Positives = 140/302 (46%), Gaps = 39/302 (12%)

Query: 11  KKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEMQH-PNVIEL 69
           KK+G G Y+ V+ G          IK +K  + K        RE+K L  +   PN+I L
Sbjct: 55  KKIGRGKYSEVFKGKSVLNDIPCVIKVLKPVKMK-----KIYRELKVLTNLTGGPNIIGL 109

Query: 70  IDIFMAYDNLNLVLEFLPTDLEVVIKDKSIL---FTPADIKAWMLMTLRGVYHCHRNFIL 126
           +DI     +    L F     EV   D   L   FT +D + +    L  + +CH   I+
Sbjct: 110 LDIVQDPGSKIPALIFE----EVKNVDFRTLYPSFTLSDTQFYFTQLLTALDYCHSMGIM 165

Query: 127 HRDLKPNNLLFSPDG-QIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKHYTSA 185
           HRD+KP N++  P+  ++++ D+GLA     P       V +R+++ PELL     Y  +
Sbjct: 166 HRDVKPQNVMIDPNERKLRLIDWGLAE-FYHPGVDYNIRVASRYHKGPELLVSLNQYDYS 224

Query: 186 IDIWSVGVIFAELMLRI-PYLPGQNDVDQMEVTFRALGTPTDRDWPEVSSFMTYNKLQIY 244
           +D+W+VG + A ++ +  P+  G  + DQ+    + LGT       E+  ++ +  L + 
Sbjct: 225 LDLWAVGCMIAAIVFKKEPFFKGSTNADQLVKIAKVLGT------QELFYYLKHYGLDL- 277

Query: 245 PPPSRDELRKRF--------------IAASEYALDFMCGMLTMNPQKRWTAVQCLESDYF 290
            P   +++ K +              +A  E  +D +  +L  + Q+R TA + +E  +F
Sbjct: 278 -PAEYNDIMKNYERKPWSYFANDKTPLAVDE-IIDLIDHLLRYDHQERLTAKEAMEHKFF 335

Query: 291 KE 292
           K+
Sbjct: 336 KK 337

>AFR092W [3284] [Homologous to ScYJL095W (BCK1) - SH]
            complement(595092..599363) [4272 bp, 1423 aa]
          Length = 1423

 Score = 92.0 bits (227), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 58/208 (27%), Positives = 108/208 (51%), Gaps = 25/208 (12%)

Query: 7    YTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSA------IREVKYLQE 60
            + K + +G+G++  VYLG   +TG  +A+K+++  +F    + +       I EV  L++
Sbjct: 1124 WIKGEMIGKGSFGAVYLGLNVTTGEMMAVKQVEVPKFGSQDETTVNNAEALISEVSTLKD 1183

Query: 61   MQHPNVIELIDIFMAYDNLNLVLEFLPTDLEVVIKDK--SIL-----FTPADIKAWMLMT 113
            + H N+++    ++ ++N N +       LE V      S++     F    I+      
Sbjct: 1184 LDHLNIVQ----YLGFENKNCIYSLF---LEYVAGGSVGSLIRLYGHFDEQLIRFLTTQV 1236

Query: 114  LRGVYHCHRNFILHRDLKPNNLLFSPDGQIKVADFGLARA---IPAPHEILTSNVVTRWY 170
            L G+ + H   ILHRD+K +NLL   DG  K++DFG++R    I +  E+     V  ++
Sbjct: 1237 LEGLAYLHLRGILHRDMKADNLLLDNDGVCKISDFGISRKSNNIYSNSEMTMRGTV--FW 1294

Query: 171  RAPELLFGAKHYTSAIDIWSVGVIFAEL 198
             APE++   + Y++ +DIWS+G +  E+
Sbjct: 1295 MAPEMVDTTQGYSAKVDIWSLGCVVLEM 1322

>Scas_700.54
          Length = 698

 Score = 91.3 bits (225), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 75/290 (25%), Positives = 131/290 (45%), Gaps = 42/290 (14%)

Query: 13  VGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEMQHPNVIELIDI 72
           VG+G +A V    + STG+  A+K I   +    ++    RE++ LQ++ HP ++ L   
Sbjct: 229 VGQGAFATVKKAVERSTGKTFAVKIISKRKVMGNME-GVSRELEVLQQLDHPRIVRLKGF 287

Query: 73  FMAYDNLNLVLEFLPT-DLEVVIKDKSILFTPADIKAWMLMTLRGVYHCHRNFILHRDLK 131
           +   D+  +V+EF+   DL   +     +   A  K      L  V + H   I HRDLK
Sbjct: 288 YEDKDSYYMVMEFVSGGDLMDFVAAHGAVGEEAG-KEISRQILEAVKYIHSKGISHRDLK 346

Query: 132 PNNLLFSPDG--QIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGA-------KHY 182
           P+N+L   D    +K+ DFGLA+ +      + +   T  Y APE++ G          Y
Sbjct: 347 PDNILIEQDDPVLVKITDFGLAK-VQGNGSFMKTFCGTLAYVAPEVIGGKGETNEERNEY 405

Query: 183 TSAIDIWSVG-VIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWPEVSSFMTYNKL 241
           +S +D+WS+G +++  L   +P+                 G+  ++ + ++S      + 
Sbjct: 406 SSLVDMWSMGCLVYVILTGHLPF----------------SGSTQEQLYKQIS------RG 443

Query: 242 QIYPPPSRDELRKRFIAASEYALDFMCGMLTMNPQKRWTAVQCLESDYFK 291
             +  P +D         S+ A  F+  +L +NP  R TA + LE  + K
Sbjct: 444 SYHEGPLKD------FRISDEARSFIDSLLQVNPGNRLTAARALEHPWIK 487

>Kwal_33.13831
          Length = 700

 Score = 91.3 bits (225), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 67/225 (29%), Positives = 103/225 (45%), Gaps = 40/225 (17%)

Query: 13  VGEGTYAVVYLGC--------------QHSTGRKI--AIKEIK--------------TSE 42
           +G+G Y +V + C               +S G K+  A+KE+K              TSE
Sbjct: 390 IGQGAYGIVKVCCIDTANVGDERSIDETYSNGSKMYYAVKELKPKSDEAKDKFGTRLTSE 449

Query: 43  FKDGLDMSAIREVKYLQEMQHPNVIELIDIFMAYDNLNLVLEFLPT-DL-EVVIKDKSIL 100
           F  G  +S   E +   +  HPN+++++D+   +D    VLEF P+ DL  ++ +     
Sbjct: 450 FIIGHSLS---ERETASQKPHPNILKMLDLMQTHDGFIEVLEFCPSGDLYSLLSRTSKNG 506

Query: 101 FTPADIKAWMLMTLRGVYHCHRNFILHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHE- 159
             P +   +M   L GV + H + I H DLKP N+LF P G +K+ DFG +       E 
Sbjct: 507 LHPLEADCFMKQLLHGVKYMHDHGIAHCDLKPENILFGPQGVLKICDFGTSCVFQTAWEK 566

Query: 160 ---ILTSNVVTRWYRAPELLFGAKHYT-SAIDIWSVGVIFAELML 200
                T  V +  Y APE     + Y    +D WS GVI+  ++L
Sbjct: 567 QVHFQTGAVGSEPYVAPEEFIAEREYDPRLVDSWSCGVIYCTMVL 611

>AFR377C [3569] [Homologous to ScYDR466W - SH] (1116595..1118775)
           [2181 bp, 726 aa]
          Length = 726

 Score = 91.3 bits (225), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 61/215 (28%), Positives = 102/215 (47%), Gaps = 11/215 (5%)

Query: 11  KKVGEGTYAVVYL----GCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEMQHPNV 66
           +++G G+Y+ VY       QH    KI  K     E K          +  L +  HP +
Sbjct: 14  EELGHGSYSTVYRVVERSSQHQYAIKICSKRHIIGENKVKYVTIEKNTLNLLGQANHPGI 73

Query: 67  IELIDIFMAYDNLNLVLEFLPTDLEVVIKDKSILFTPADIKAWMLMTLRGVYHCHRNFIL 126
           I+L   F   +NL  V++  P    + +  +  +F+ A  + +M   +  V + H   ++
Sbjct: 74  IKLYYTFHDQENLYFVMDLAPGGELLQLLRRQRVFSEAWARHYMCQLVDTVEYIHSMGVI 133

Query: 127 HRDLKPNNLLFSPDGQIKVADFGLARAIPAP------HEILTSNVVTRWYRAPELLFGAK 180
           HRDLKP N+L   +G++ +ADFG A  +          +  TS V T  Y +PELL   K
Sbjct: 134 HRDLKPENVLLDKEGRLMIADFGAAYTVGQSDAGSDGDKPATSFVGTAEYVSPELLLENK 193

Query: 181 HYTSAIDIWSVGVIFAELMLRIPYLPGQNDVDQME 215
            Y S+ D+W++G +  + +   P   GQN+++  E
Sbjct: 194 SYYSS-DVWALGCMLYQFLQGTPPFRGQNEMETFE 227

>YAR019C (CDC15) [74] chr1 complement(172211..175135) MAP kinase
           kinase kinase essential for late nuclear division [2925
           bp, 974 aa]
          Length = 974

 Score = 90.9 bits (224), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 76/284 (26%), Positives = 128/284 (45%), Gaps = 38/284 (13%)

Query: 4   NMEYTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEMQH 63
           +++Y  ++ +G G+Y VVY      T + +AIKE+     ++  D+ A  E+  L+ + H
Sbjct: 22  SVQYHLKQVIGRGSYGVVYKAINKHTDQVVAIKEVVYENDEELNDIMA--EISLLKNLNH 79

Query: 64  PNVIELIDIFMAYDNLNLVLEFLPT-DLEVVIKDKSILFTPADIKAWMLMTLRGVYHCHR 122
            N+++          L ++LE+     L  +I   S   +  + K ++  TL G+ + H 
Sbjct: 80  NNIVKYHGFIRKSYELYILLEYCANGSLRRLISRSSTGLSENESKTYVTQTLLGLKYLHG 139

Query: 123 NFILHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKHY 182
             ++HRD+K  N+L S D  +K+ADFG++  + +    L     T  + APE+L G +  
Sbjct: 140 EGVIHRDIKAANILLSADNTVKLADFGVSTIVNSSALTLAG---TLNWMAPEIL-GNRGA 195

Query: 183 TSAIDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWPEVSSFMTYNKLQ 242
           ++  DIWS+G    E++ + P  P  N  D     + A+   T                 
Sbjct: 196 STLSDIWSLGATVVEMLTKNP--PYHNLTDAN--IYYAVENDT----------------- 234

Query: 243 IYPPPSRDELRKRFIAASEYALDFMCGMLTMNPQKRWTAVQCLE 286
            YPP S  E  K          DF+      N  KR TA Q L+
Sbjct: 235 YYPPSSFSEPLK----------DFLSKCFVKNMYKRPTADQLLK 268

>Scas_698.37
          Length = 347

 Score = 89.4 bits (220), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 78/303 (25%), Positives = 145/303 (47%), Gaps = 33/303 (10%)

Query: 6   EYTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEMQH-P 64
           +Y    K+G G Y+ V+ G          IK +K  + +        RE+K L  +   P
Sbjct: 57  DYEIINKIGRGKYSEVFRGKHILNDVSCVIKVLKPVKLR-----KIHRELKILWNLTGGP 111

Query: 65  NVIELIDIFMAYDNLNLVLEFLPTDLEVV-IKDKSILFTPADIKAWMLMTLRGVYHCHRN 123
           N++EL+D+   +D    V  F+  D++ V  ++    F  +D++ +    L  + + H  
Sbjct: 112 NIVELLDV--VHDEKTRVPAFIFEDVKNVDFRELYPTFKLSDVQYYFKQLLIALNYAHSM 169

Query: 124 FILHRDLKPNNLLFSP-DGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKHY 182
            I+HRD+KP N++  P   ++++ D+GLA     P       V +R+++ PELL     Y
Sbjct: 170 GIMHRDVKPQNVMIDPVQRKLRLIDWGLAE-FYHPGVDYNVRVASRYHKGPELLTDLNQY 228

Query: 183 TSAIDIWSVGVIFAELMLRI-PYLPGQNDVDQMEVTFRALGTPTDRDWPEVSSFMTYNKL 241
             ++D+WSVG + A ++ +  P+  G ++ DQ+    + LGT       ++ +++    L
Sbjct: 229 DYSLDMWSVGCMIAAIIFKKEPFFKGGSNPDQLVKIAKVLGT------KQLINYLARYGL 282

Query: 242 QIYPPPSRDEL-----RK---RFIA-----ASEYALDFMCGMLTMNPQKRWTAVQCLESD 288
            +  P   D L     RK    FI+     A+  A+D +  +L  + Q+R TA + +   
Sbjct: 283 HL--PSEHDNLIRTWARKPWSHFISIETPLATPEAVDLVDNLLRYDHQERLTAEEAMNHQ 340

Query: 289 YFK 291
           +F+
Sbjct: 341 FFQ 343

>KLLA0F14190g 1311121..1315137 gi|3021329|emb|CAA06336.1 Kluyveromyces
            lactis MAP kinase kinase kinase, start by similarity
          Length = 1338

 Score = 90.9 bits (224), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 57/198 (28%), Positives = 101/198 (51%), Gaps = 15/198 (7%)

Query: 13   VGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIR-------EVKYLQEMQHPN 65
            +G+G++  VYL    +TG  +A+K++   EF    D SAI        EV  L+++ H N
Sbjct: 1044 IGKGSFGAVYLALNVTTGEMLAVKQVTVPEF-SSQDESAISMVEALKSEVSTLKDLNHVN 1102

Query: 66   VIELIDIFMAYDNLNLVLEFLPTDLEVVIKDKSILFTPADIKAWMLMTLRGVYHCHRNFI 125
            +++ +         +L LE++       +      F    I+      L G+ + H   I
Sbjct: 1103 IVQYLGFEEKNGIYSLFLEYVAGGSVGSLIRMYGRFDDQLIRHLTKQVLEGLAYLHSKGI 1162

Query: 126  LHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTR----WYRAPELLFGAKH 181
            LHRD+K +NLL   DG  K++DFG++R     + I +++ +T     ++ APE++  A  
Sbjct: 1163 LHRDMKADNLLLDNDGVCKISDFGISR---KSNNIYSNSDMTMRGTVFWMAPEMVDTAHG 1219

Query: 182  YTSAIDIWSVGVIFAELM 199
            Y++ +DIWS+G +  E+ 
Sbjct: 1220 YSAKVDIWSLGCVVLEMF 1237

>Scas_618.8
          Length = 427

 Score = 89.7 bits (221), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 81/293 (27%), Positives = 135/293 (46%), Gaps = 45/293 (15%)

Query: 6   EYTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIR------EVKYLQ 59
           +Y   K +G G++ VV    + S   ++AIK +     K  L+ + ++      E+  L+
Sbjct: 26  DYEFGKTLGAGSFGVVREATKKSNNEEVAIKIL----LKKALEGNQVQLQMLYDELTILK 81

Query: 60  EMQHPNVIELIDIFMAYDNLNLVLEFLPTDLEV---VIKDKSILFTPADIKAWMLMTLRG 116
           ++ HPN++E  + F   D + +V + L T  E+   +IK     F+  D    ++  L  
Sbjct: 82  KLHHPNIVEFKNWFETDDKIYIVTQ-LATGGELFDRIIKKGR--FSEDDAVKILIQILSA 138

Query: 117 VYHCHRNFILHRDLKPNNLLF---SPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAP 173
           V + H   I+HRDLKP NLL+     D ++ +ADFG+A+ +    +++     +  Y AP
Sbjct: 139 VEYIHSRDIVHRDLKPENLLYLTEKEDSELVIADFGIAKELKKGEQLIFKAAGSLGYVAP 198

Query: 174 ELLFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWPEVS 233
           E+L    H     DIWS+GVI   L+               E     L   T  D+P   
Sbjct: 199 EVLTVDGH-GKPCDIWSIGVITYTLLSGYAAFVA-------ETVEGFLDECTSGDYP--- 247

Query: 234 SFMTYNKLQIYPPPSRDELRKRFIAASEYALDFMCGMLTMNPQKRWTAVQCLE 286
             + ++K      P  D +       S+ A +F+   L +NPQKR TA + L+
Sbjct: 248 --VKFHK------PYWDNI-------SDDAKNFILKALDLNPQKRPTATELLD 285

>Scas_651.3
          Length = 793

 Score = 90.1 bits (222), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 74/235 (31%), Positives = 123/235 (52%), Gaps = 39/235 (16%)

Query: 13  VGEGTYAVVYLGCQHSTGRKI-AIKEIKT-SEFKDGLDMSAIREVKYLQ--------EMQ 62
           +G+GT+  V + CQ+ T ++I A+K IK+ SE+ +     +I E K L+        E +
Sbjct: 386 LGQGTFGQV-VKCQNLTTKEILAVKVIKSRSEYLN----QSITEAKILELINNKIDPENK 440

Query: 63  HPNVIELIDIFMAYDNLNLVLEFLPTDLEVVIKDKSI---------LFTPADIKAWMLMT 113
           H + + + D F+  ++L LV E L  +L  ++K             +FT   +++  ++ 
Sbjct: 441 H-HFLRMYDSFIHKNHLCLVFELLSNNLYELLKQNQFHGLSIQLIRIFTKQMLESLCVLK 499

Query: 114 LRGVYHCHRNFILHRDLKPNN-LLFSPDG-QIKVADFGLARAIPAPHEILTSNVVTRWYR 171
              + HC        DLKP N LL SPD   +K+ DFG   +      + T  + +R+YR
Sbjct: 500 DSKLIHC--------DLKPENILLCSPDKPALKIIDFG--SSCEETRTVYTY-IQSRFYR 548

Query: 172 APELLFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTD 226
           APE++ G   Y+++ID+WS+G I AEL L IP  PG ++ +Q+      LG P +
Sbjct: 549 APEIILGIP-YSTSIDMWSLGCIVAELFLGIPIFPGSSEYNQLTRIVDTLGYPPN 602

>Scas_613.5
          Length = 517

 Score = 89.4 bits (220), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 66/225 (29%), Positives = 100/225 (44%), Gaps = 31/225 (13%)

Query: 6   EYTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIRE-VKYLQEMQHP 64
           +Y   K +G G YA V  G    TG+ +A+K     +  D       RE    L  + HP
Sbjct: 203 KYVLGKDLGSGHYATVKEGINKVTGQTVAVKIFHPQQNDDEKKSKQFREETNILMRIHHP 262

Query: 65  NVIELIDIFMAYDNLNLVLEFLPTD-------LEVVIKDKSILFTPADIKAWMLMTLRGV 117
           N++ L+D F+   + + + ++L  D        E ++K         + KA     L G+
Sbjct: 263 NIVNLLDFFIEPVSKSQIQKYLVLDKIDDGELFERIVK--KTCLRQDETKAIFNQILMGL 320

Query: 118 YHCHRNFILHRDLKPNNLLFS-------------------PDGQIKVADFGLARAIPAPH 158
            H H+  I+HRD+KP N+L +                    D Q+K+ADFGLA+      
Sbjct: 321 KHLHQQNIIHRDIKPENILLNITRRTNPEQKQLGPWDEDEIDIQVKIADFGLAK-FTGEM 379

Query: 159 EILTSNVVTRWYRAPELLFGAKHYTSAIDIWSVGVIFAELMLRIP 203
           +   +   T  Y APE+L   K YTS +D+WS GVI    +   P
Sbjct: 380 QFTNTLCGTPSYVAPEVL-TKKGYTSKVDMWSAGVILYVCLCGFP 423

>Kwal_55.21709
          Length = 340

 Score = 88.2 bits (217), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 82/297 (27%), Positives = 136/297 (45%), Gaps = 31/297 (10%)

Query: 12  KVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEMQH-PNVIELI 70
           K+G G Y+ V+ G          IK +K  +          RE+K L  +   PNVI L+
Sbjct: 55  KIGRGKYSEVFRGKCVVNDEYCVIKVLKPVKL-----KKIYRELKILTNLTGGPNVIALL 109

Query: 71  DIFMAYDNLNLVLEFLPTDLEVVIKDKSILFTPADIKAWMLMTLRGVYHCHRNFILHRDL 130
           DI     +    L F      V  +   + FT  DI+ +    L  + +CH   I+HRD+
Sbjct: 110 DIVQDSGSKIPALIFEEVK-NVDFRTLYLKFTLPDIQYYFSQLLIALDYCHSMGIMHRDV 168

Query: 131 KPNNLLFSP-DGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKHYTSAIDIW 189
           KP N++  P + ++++ D+GLA     P       V +R+++ PELL     Y  ++D+W
Sbjct: 169 KPQNVMIDPVERKLRLIDWGLAE-FYHPGVDYNVRVASRYHKGPELLVNLNQYDYSLDLW 227

Query: 190 SVGVIFAELMLRI-PYLPGQNDVDQMEVTFRALGTPTDRDWPEVSSFMTYNKLQIYPPPS 248
           SVG + A ++ +  P+  G  + DQ+    R LGT       E+ +++  NK  +  P  
Sbjct: 228 SVGCMLAAIVFKKEPFFKGSTNPDQLVKIARVLGT------TELLAYL--NKYGLKLPRE 279

Query: 249 RDELRKRF--IAASEYA-----------LDFMCGMLTMNPQKRWTAVQCLESDYFKE 292
            D + K F     SE+            +D +  +L  + Q+R TA + L   +FK+
Sbjct: 280 YDNIMKDFPRKTWSEFTTPDTPLVVPEVVDLIENLLRYDHQERLTAKETLAHAFFKK 336

>KLLA0F13552g complement(1252906..1256709)
           gi|33386566|emb|CAD87727.1 Kluyveromyces lactis protein
           kinase, start by similarity
          Length = 1267

 Score = 89.4 bits (220), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 66/202 (32%), Positives = 108/202 (53%), Gaps = 11/202 (5%)

Query: 11  KKVGEGTYAVVYLGCQHSTGRKIAIKEI-----KTSEFKDGLDMSAIREVKYLQEMQHPN 65
           K +G+G+   V L     TG+  AIK +     K+++ K  L     RE+  ++ + HPN
Sbjct: 77  KTLGKGSSGRVRLAKNMETGKLSAIKIVPKKFVKSNQIKQ-LPYGIEREIIIMKLISHPN 135

Query: 66  VIELIDIFMAYDNLNLVLEFLPT-DLEVVIKDKSILFTPADIKAWMLMTLRGVYHCHRNF 124
           V+ L +++     L LVLE++   +L   +  K  L     I  +    ++ V +CH   
Sbjct: 136 VMGLYEVWENKSELYLVLEYVEGGELFDYLVSKGKLPESEAIH-YFKQIVQAVAYCHGFN 194

Query: 125 ILHRDLKPNNLLFSPDGQ-IKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKHYT 183
           I HRDLKP NLL     + IK+ADFG+A A+    ++L ++  +  Y +PE++ G K++ 
Sbjct: 195 ICHRDLKPENLLLDKKKRSIKIADFGMA-ALETSDKLLETSCGSPHYASPEIVLGRKYHG 253

Query: 184 SAIDIWSVGVI-FAELMLRIPY 204
           S  D+WS G+I FA L   +P+
Sbjct: 254 SPSDVWSCGIILFALLTGHLPF 275

>YGL179C (TOS3) [1812] chr7 complement(163413..165095)
           Serine/threonine protein kinase with similarity to Elm1p
           and Kin82p [1683 bp, 560 aa]
          Length = 560

 Score = 89.0 bits (219), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 70/222 (31%), Positives = 110/222 (49%), Gaps = 31/222 (13%)

Query: 13  VGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMS-------AIREVKYLQEMQHPN 65
           +G G Y  V L     TG  +AIK +   E + G  +          +E++ ++   H N
Sbjct: 56  LGNGQYGKVKLARDLGTGALVAIKILNRFEKRSGYSLQLKVENPRVNQEIEVMKRCHHEN 115

Query: 66  VIELIDIFMAYDNLN--LVLEFLP---------TDLEVVIKDKSILFTPADIKAWMLMTL 114
           V+EL +I    ++    LVLE+             +E+     SIL T    +  +L  +
Sbjct: 116 VVELYEILNDPESTKVYLVLEYCSRGPVKWCPENKMEIKAVGPSIL-TFQQSRKVVLDVV 174

Query: 115 RGVYHCHRNFILHRDLKPNNLLFSPDGQIKVADFGLARA-------IPAPHEIL--TSNV 165
            G+ + H   I HRD+KP+NLL S +G +K++DFG+A +       I + HE L  +  +
Sbjct: 175 SGLEYLHSQGITHRDIKPSNLLISSNGTVKISDFGVAMSTATGSTNIQSSHEQLLKSRAL 234

Query: 166 VTRWYRAPELLFGAKHY--TSAIDIWSVGV-IFAELMLRIPY 204
            T  + APEL    K Y  +SAIDIWS+GV I+  L  ++P+
Sbjct: 235 GTPAFFAPELCSTEKEYSCSSAIDIWSLGVTIYCLLFGKLPF 276

>KLLA0C04191g 384198..386591 weakly similar to sp|P27636
           Saccharomyces cerevisiae YAR019c CDC15 protein kinase of
           the MAP kinase kinase kinase family, hypothetical start
          Length = 797

 Score = 89.0 bits (219), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 77/292 (26%), Positives = 133/292 (45%), Gaps = 42/292 (14%)

Query: 7   YTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSA-IREVKYLQEMQHPN 65
           Y  ++ +G G Y VVY   +  T +  AIK+I   EF+D  +++  + E+  L+ ++H N
Sbjct: 10  YALKQVIGRGAYGVVYRAVKRGTNKPCAIKQI---EFEDESELNEHMLEIDLLKNLRHQN 66

Query: 66  VIELIDIFMAYDNLNLVLEFLP-TDLEVVIKDKSILFTPADIKAWMLMTLRGVYHCHRNF 124
           ++E          L ++LE+     L  ++K   +L    D   ++  TL G+ + H   
Sbjct: 67  IVEYRGFIQKAHELYIILEYCARGSLRDILKHGPLL--EDDTVNYVTQTLYGLQYLHEQG 124

Query: 125 ILHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKHYTS 184
           ++HRD+K  NLL + +G +K+ADFG++  I   + +  +   +  + APE++ G    T 
Sbjct: 125 VIHRDIKAANLLLTEEGIVKLADFGVSTRI---NRMAMTYAGSPNWMAPEVMTGQGASTV 181

Query: 185 AIDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWPEVSSFMTYNKLQIY 244
           + DIWS+G    EL+   P  P  N V+                  E + +   N  + Y
Sbjct: 182 S-DIWSLGATVVELLTGNP--PFHNLVN------------------ESACYAIVN--EEY 218

Query: 245 PPPSRDELRKRFIAASEYALDFMCGMLTMNPQKRWTAVQCLESDYFKELPPP 296
            PP         +  S    DF+      N  KR TA + L   + K++  P
Sbjct: 219 IPP---------LTLSAECKDFLSRCFQKNMFKRATAQELLAHIWLKKIQKP 261

>KLLA0F23155g 2157146..2158429 similar to sp|P22517 Saccharomyces
           cerevisiae YOL016c CMK2 Ca2+/calmodulin-dependent
           ser/thr protein kinase, type II, start by similarity
          Length = 427

 Score = 88.2 bits (217), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 63/205 (30%), Positives = 104/205 (50%), Gaps = 18/205 (8%)

Query: 6   EYTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIR------EVKYLQ 59
           +Y   K +G GT+ VV      S+G  +A+K +     K  L   +++      E+  LQ
Sbjct: 45  DYIFGKTLGAGTFGVVRQARCISSGENVAVKIL----LKKALKGQSVQLQMLYDELSILQ 100

Query: 60  EMQHPNVIELIDIFMAYDNLNLVLEFLPTDLEVV--IKDKSILFTPADIKAWMLMTLRGV 117
           ++ HPN++   D F + +   +V + L T  E+   I +K   F   D    +   L+GV
Sbjct: 101 QLNHPNIVRFKDWFESKEKFYIVTQ-LATGGELFDRILEKG-KFCEVDAVFIVKQILQGV 158

Query: 118 YHCHRNFILHRDLKPNNLLF---SPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPE 174
            + H+  I+HRDLKP N+L+   S D  + + DFG+A+ +   +E++     +  Y APE
Sbjct: 159 QYLHQRNIVHRDLKPENILYLNKSDDSPLVIGDFGIAKELKDDNELIHKAAGSMGYVAPE 218

Query: 175 LLFGAKHYTSAIDIWSVGVIFAELM 199
           +L  + H     DIWS+GVI   L+
Sbjct: 219 VLTSSGH-GKPCDIWSIGVITYTLL 242

>CAGL0K08514g complement(853314..857783) similar to sp|P34244
           Saccharomyces cerevisiae YKL101w
           serine/threonine-protein kinase, hypothetical start
          Length = 1489

 Score = 89.0 bits (219), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 80/312 (25%), Positives = 145/312 (46%), Gaps = 61/312 (19%)

Query: 11  KKVGEGTYAVVYLGCQHSTGRKIAIKEIKTS-----------------EFKDGLDMSAI- 52
           K +  GT A + +  + +  R++  +++KT+                   K+G D SA+ 
Sbjct: 111 KNIENGTLAAIKIVPKRTYNRRMRDQKMKTAGGVSSGTDSKDSSNREDPIKNGTD-SALN 169

Query: 53  -----REVKYLQEMQHPNVIELIDIFMAYDNLNLVLEFLPT-DLEVVIKDKSILFTPADI 106
                RE+  ++ + HPNV+ L++++     L LVLE++   +L   +  K  L  P  +
Sbjct: 170 PYGIEREIVIMKLISHPNVMGLLEVWENKSELYLVLEYVDGGELFDYLVSKGKLSEPEAV 229

Query: 107 KAWMLMTLRGVYHCHRNFILHRDLKPNNLLFSPDGQ-IKVADFGLARAIPAPHEILTSNV 165
             +    ++GV +CH   I HRDLKP NLL     + IK+ADFG+A A+  P+++L ++ 
Sbjct: 230 H-YFTQIIQGVSYCHSFNICHRDLKPENLLLDKKNKVIKIADFGMA-ALELPNKLLETSC 287

Query: 166 VTRWYRAPELLFGAKHYTSAIDIWSVGVI-FAELMLRIPYLPGQNDVDQMEVTFRALGTP 224
            +  Y +PE++ G  ++    D+WS G+I FA L   +P+    +++ ++ +  +A    
Sbjct: 288 GSPHYASPEIVMGKPYHGGPSDVWSCGIILFALLTGHLPF--NDDNIKKLLLKVQA---- 341

Query: 225 TDRDWPEVSSFMTYNKLQIYPPPSRDELRKRFIAASEYALDFMCGMLTMNPQKRWTAVQC 284
                          + Q+ P  + D            A D +  +L  NP+KR T  + 
Sbjct: 342 --------------GRFQLPPYLTND------------AKDLITRILVTNPEKRLTINEI 375

Query: 285 LESDYFKELPPP 296
           L     K+   P
Sbjct: 376 LNHPLIKKYRNP 387

>YDL101C (DUN1) [768] chr4 complement(280307..281848) Protein kinase
           required for induction of Rnr3p and DNA repair genes
           after DNA damage [1542 bp, 513 aa]
          Length = 513

 Score = 88.2 bits (217), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 79/322 (24%), Positives = 136/322 (42%), Gaps = 57/322 (17%)

Query: 6   EYTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIRE-VKYLQEMQHP 64
           +Y   K++G G YA+V       TG+++A+K     +  D       RE    L  +QHP
Sbjct: 199 KYLLGKELGAGHYALVKEAKNKKTGQQVAVKIFHAQQNDDQKKNKQFREETNILMRVQHP 258

Query: 65  NVIELIDIFMAYDNLNLVLEFLPTD-------LEVVIKDKSILFTPADIKAWMLMTLRGV 117
           N++ L+D F+   + + + ++L  +        E +++         + KA     L G+
Sbjct: 259 NIVNLLDSFVEPISKSQIQKYLVLEKIDDGELFERIVR--KTCLRQDESKALFKQLLTGL 316

Query: 118 YHCHRNFILHRDLKPNNLLFS-------------------PDGQIKVADFGLARAIPAPH 158
            + H   I+HRD+KP N+L +                    D Q+K+ADFGLA+      
Sbjct: 317 KYLHEQNIIHRDIKPENILLNITRRENPSQVQLGPWDEDEIDIQVKIADFGLAK-FTGEM 375

Query: 159 EILTSNVVTRWYRAPELLFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTF 218
           +   +   T  Y APE+L   K YTS +D+WS GVI    +   P    Q          
Sbjct: 376 QFTNTLCGTPSYVAPEVL-TKKGYTSKVDLWSAGVILYVCLCGFPPFSDQ---------- 424

Query: 219 RALGTPTDRDWPEVSSFMTYNKLQIYPPPSRDELRKRFIAASEYALDFMCGMLTMNPQKR 278
             LG P+ ++    + +  Y+       P  D++        +  L  +  +L +NP +R
Sbjct: 425 --LGPPSLKEQILQAKYAFYS-------PYWDKI-------DDSVLHLISNLLVLNPDER 468

Query: 279 WTAVQCLESDYFKELPPPSDPS 300
           +   + L   +F ++   S  S
Sbjct: 469 YNIDEALNHPWFNDIQQQSSVS 490

>CAGL0F04741g 478256..479584 similar to sp|P22517 Saccharomyces
           cerevisiae YOL016c CMK2 Ca2+/calmodulin-dependent
           ser/thr protein kinase, type II, hypothetical start
          Length = 442

 Score = 87.8 bits (216), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 82/300 (27%), Positives = 136/300 (45%), Gaps = 39/300 (13%)

Query: 7   YTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSA---IREVKYLQEMQH 63
           Y   K +G GT+ VV       T   +A+K +     K G D+       E+  LQ ++H
Sbjct: 45  YVFGKTLGAGTFGVVRQARYSPTNEDVAVKILLKKALK-GNDVQLQMLYDELSILQMLKH 103

Query: 64  PNVIELIDIFMAYDNLNLVLEF-LPTDL--EVVIKDKSILFTPADIKAWMLMTLRGVYHC 120
           PN++E  D F + D   +V +  +  +L   ++ K K   FT  D  +  +  L  V + 
Sbjct: 104 PNIVEFKDWFESKDKFYIVTQLAVGGELFDRILAKGK---FTERDAVSITMQILSAVDYM 160

Query: 121 HRNFILHRDLKPNNLLF---SPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLF 177
           H   ++HRDLKP N+L+   S D Q+ +ADFG+A+ +    +++     +  Y APE+L 
Sbjct: 161 HSKNVVHRDLKPENVLYIDKSDDSQLVIADFGIAKQLQDNDDLIFKAAGSLGYVAPEVLT 220

Query: 178 GAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWPEVSSFMT 237
              H     DIWS+GVI   L+        +  VD        L   T   +P     +T
Sbjct: 221 NNGH-GKPCDIWSIGVIVYTLLCGYSAFVAET-VDGF------LEECTQNKYP-----VT 267

Query: 238 YNKLQIYPPPSRDELRKRFIAASEYALDFMCGMLTMNPQKRWTAVQCLESDYFKELPPPS 297
           ++K      P  D +       S+ A +F+   LT++P +R TA + ++  +     P +
Sbjct: 268 FHK------PYWDNI-------SDEAKNFILRALTLDPAERPTAAELMKDPWITNTRPET 314

>KLLA0A05819g 541545..543659 similar to sp|P14680 Saccharomyces
           cerevisiae YJL141c YAK1 ser/thr protein kinase, start by
           similarity
          Length = 704

 Score = 88.2 bits (217), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 71/229 (31%), Positives = 116/229 (50%), Gaps = 13/229 (5%)

Query: 4   NMEYTKEKKVGEGTYAVVYLGCQHSTGRKI-AIKEIKTSEFKDGLDMSAIREVKYLQEMQ 62
           N +Y     +G+GT+  V + CQ+   ++I A+K +K+        ++  + ++ L    
Sbjct: 329 NRKYLVLDLLGQGTFGQV-VKCQNLITKEILAVKVVKSKSEYLNQSVTEAKVLELLNRQI 387

Query: 63  HPN----VIELIDIFMAYDNLNLVLEFLPTDLEVVIK-DKSILFTPADIKAWMLMTLRGV 117
            PN     + L D F+   +L LV E L  +L  ++K ++    +   IK +    L  +
Sbjct: 388 DPNNEHHFLRLHDTFVHKHHLCLVFELLSNNLYELLKLNEFHGLSMTLIKTFSKQLLDSL 447

Query: 118 YHCHRNFILHRDLKPNNLLFSPDGQ--IKVADFGLARAIPAPHEILTSNVVTRWYRAPEL 175
                + ++H DLKP N+L   + +  +KV DFG   A      I T  + +R+YRAPE+
Sbjct: 448 CVLKDSKLIHCDLKPENILLVSNDRPDLKVIDFG--SACEETRTIYTY-IQSRFYRAPEV 504

Query: 176 LFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTP 224
           L G   Y++ ID+WS G I AEL L IP  PG ++ DQ+     +LG P
Sbjct: 505 LLGIP-YSTGIDMWSFGCIVAELFLGIPIFPGNSEFDQVTRIVESLGMP 552

 Score = 30.8 bits (68), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 23/43 (53%)

Query: 252 LRKRFIAASEYALDFMCGMLTMNPQKRWTAVQCLESDYFKELP 294
           L +R I   +  L F+ G+L +NP +RWT  Q +   +  E P
Sbjct: 625 LVEREIKNRDCLLHFLRGVLNLNPLERWTPQQAILHPFITEEP 667

>Scas_711.25
          Length = 1515

 Score = 88.6 bits (218), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 58/201 (28%), Positives = 110/201 (54%), Gaps = 15/201 (7%)

Query: 9    KEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEF--KDGLDMSAIR----EVKYLQEMQ 62
            K + +G+G++  VYL    +TG  +A+K+++  ++  +D   +S +     EV  L+++ 
Sbjct: 1216 KGEMIGKGSFGAVYLCLNVTTGEMMAVKQVEVPKYSSQDEAIISTVEALRSEVSTLKDLD 1275

Query: 63   HPNVIELIDIFMAYDNL-NLVLEFLPTDLEVVIKDKSILFTPADIKAWMLMTLRGVYHCH 121
            H N+++ +  F   DN+ +L LE++       +      F    I+      LRG+ + H
Sbjct: 1276 HLNIVQYLG-FENKDNIYSLFLEYVAGGSVGSLIRMYGRFDEPLIRHLNTQVLRGLAYLH 1334

Query: 122  RNFILHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTR----WYRAPELLF 177
               ILHRD+K +NLL   DG  K++DFG++R      +I +++ +T     ++ APE++ 
Sbjct: 1335 SRGILHRDMKADNLLLDQDGVCKISDFGISR---KSKDIYSNSDMTMRGTVFWMAPEMVD 1391

Query: 178  GAKHYTSAIDIWSVGVIFAEL 198
              + Y++ +DIWS+G I  E+
Sbjct: 1392 TKQGYSAKVDIWSLGCIVLEM 1412

>CAGL0L03520g complement(401103..405446) similar to sp|Q01389
            Saccharomyces cerevisiae YJL095w BCK1, start by
            similarity
          Length = 1447

 Score = 88.2 bits (217), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 70/291 (24%), Positives = 136/291 (46%), Gaps = 36/291 (12%)

Query: 13   VGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDM-----SAIR-EVKYLQEMQHPNV 66
            +G+G++  VYL    +TG  +A+K+++  ++    ++      A++ EV  L+++ H N+
Sbjct: 1157 IGKGSFGAVYLSLNITTGEMMAVKQVEVPKYGTQNELVKDMVEALKSEVATLKDLDHLNI 1216

Query: 67   IELIDIFMAYDNLNLVLEFLPTDLEVVIKDKSILFTPADIKAWMLMTLRGVYHCHRNFIL 126
            ++ +   +  +  +L LE++       +      F    I+      L G+ + H   IL
Sbjct: 1217 VQYLGSEIRGNIYSLFLEYVAGGSVGSLIRLYGRFDEKLIRHLNTQVLSGLKYLHSKGIL 1276

Query: 127  HRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTR---WYRAPELLFGAKHYT 183
            HRD+K +NLL   DG  K++DFG+++   + +    S++  R   ++ APE++   + Y+
Sbjct: 1277 HRDMKADNLLLDEDGICKISDFGISKK--SKNIYSNSDMTMRGTVFWMAPEMVDTKQGYS 1334

Query: 184  SAIDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWPEVSSFMTYNKLQI 243
            + +DIWS+G +  E+        G+     +EV               V++     K + 
Sbjct: 1335 AKVDIWSLGCVVLEM------FAGKRPWSNLEV---------------VAAMFQIGKSKS 1373

Query: 244  YPPPSRDELRKRFIAASEYALDFMCGMLTMNPQKRWTAVQCLESDYFKELP 294
             PP   D ++      S    DF+     ++P+KR TA   LE  + K  P
Sbjct: 1374 APPIPDDTIQ----LISSKGKDFLSKCFEIDPEKRPTADDLLEHSFSKVDP 1420

>KLLA0C08525g 744554..749209 similar to sp|P53599 Saccharomyces
            cerevisiae YNR031c SSK2 MAP kinase kinase kinase of the
            high osmolarity signal transduction pathway, start by
            similarity
          Length = 1551

 Score = 88.2 bits (217), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 56/212 (26%), Positives = 103/212 (48%), Gaps = 15/212 (7%)

Query: 3    VNMEYTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDM--SAIREVKYLQE 60
            +++ + K   +G G++  VY      TG  +A+KEIK  + K    +  S   E++ ++ 
Sbjct: 1255 LSIRWQKRSFIGSGSFGTVYSAVNLDTGDILAVKEIKIQDAKSMKQIFPSLKEEMRVMEI 1314

Query: 61   MQHPNVIELIDIFMAYDNLNLVLEFLPTDLEVVIKDKSILFTPADIKAWMLMTLRGVYHC 120
            + HPN+++   + +  D +N+ +EF        + +   +      + + L  L G+   
Sbjct: 1315 LNHPNIVQYYGVEVHRDKVNIFMEFCEGSSLASLLEHGRIEDEMVTQVYTLQLLEGLACL 1374

Query: 121  HRNFILHRDLKPNNLLFSPDGQIKVADFGLARAIP---APHEILTSN---------VVTR 168
            H++ ++HRD+KP N+L   +G IK  DFG A+ I    +    L +N         + T 
Sbjct: 1375 HQSGVVHRDIKPENILLDRNGVIKYVDFGAAKLIAKNGSKRISLDANNKSTGGKDMIGTP 1434

Query: 169  WYRAPELLFGAKHYT-SAIDIWSVGVIFAELM 199
             Y APE + G  H    + DIWS+G +  E++
Sbjct: 1435 MYMAPETVTGQGHGKFGSDDIWSLGCVVLEMV 1466

>YJL141C (YAK1) [2777] chr10 complement(147885..150308)
           Serine/threonine protein kinase, negative regulator of
           cell growth acting in opposition to cAMP-dependent
           protein kinase A [2424 bp, 807 aa]
          Length = 807

 Score = 87.8 bits (216), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 86/333 (25%), Positives = 150/333 (45%), Gaps = 68/333 (20%)

Query: 13  VGEGTYAVVYLGCQHSTGRKI-AIKEIKTSEFKDGLDMSAIREVKYLQEMQHP------- 64
           +G+GT+  V + CQ+   ++I A+K +K+   +      +I E K L+ +          
Sbjct: 375 LGQGTFGQV-VKCQNLLTKEILAVKVVKS---RTEYLTQSITEAKILELLNQKIDPTNKH 430

Query: 65  NVIELIDIFMAYDNLNLVLEFLPTDL-EVVIKDKSILFTPADIKAWMLMTLRGVYHCHRN 123
           + + + D F+  ++L LV E L  +L E++ ++K    +   I+ +    L  +     +
Sbjct: 431 HFLRMYDSFVHKNHLCLVFELLSNNLYELLKQNKFHGLSIQLIRTFTTQILDSLCVLKES 490

Query: 124 FILHRDLKPNN-LLFSPDG-QIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKH 181
            ++H DLKP N LL +PD  ++K+ DFG   +       + + + +R+YRAPE++ G   
Sbjct: 491 KLIHCDLKPENILLCAPDKPELKIIDFG---SSCEEARTVYTYIQSRFYRAPEIILGIP- 546

Query: 182 YTSAIDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTD--------------R 227
           Y+++ID+WS+G I AEL L IP  PG ++ +Q+      LG P                +
Sbjct: 547 YSTSIDMWSLGCIVAELFLGIPIFPGASEYNQLTRIIDTLGYPPSWMIDMGKNSGKFMKK 606

Query: 228 DWPEVSSFMTYN-----------KLQIYPPPSR------------------------DEL 252
             PE SS  T             +  I   PS+                         EL
Sbjct: 607 LAPEESSSSTQKHRMKTIEEFCREYNIVEKPSKQYFKWRKLPDIIRNYRYPKSIQNSQEL 666

Query: 253 RKRFIAASEYALDFMCGMLTMNPQKRWTAVQCL 285
             + +   E  + F+ G+L +NP +RWT  Q +
Sbjct: 667 IDQEMQNRECLIHFLGGVLNLNPLERWTPQQAM 699

>KLLA0E04136g 382874..383995 similar to sp|P15790 Saccharomyces
           cerevisiae YIL035c CKA1 casein kinase II, catalytic
           alpha chain, start by similarity
          Length = 373

 Score = 86.7 bits (213), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 71/256 (27%), Positives = 114/256 (44%), Gaps = 38/256 (14%)

Query: 4   NMEYTKEKKVGEGTYAVVYLGCQHSTGRKIAI------------KEI----KTSEFKDGL 47
           N +Y  E KVG G Y+ V+ G Q ST  KI I            +EI      S  K+  
Sbjct: 37  NSQYEVECKVGRGKYSEVFQGVQLSTRNKIVIKMLKPVKKKKIKREITILANLSNEKNPP 96

Query: 48  DMSAIREVKY------------------LQEMQHPNVIELIDIFMAYDNLNLVLEFLPTD 89
                 E KY                  L    H N+I L+D+     +    L F   D
Sbjct: 97  TAQPYDEAKYYTNRREEVLKYARDKVYDLPHNGHENIITLLDVVRDPISKTPALIFEHID 156

Query: 90  LEVVIKDKSILFTPADIKAWMLMTLRGVYHCHRNFILHRDLKPNNLLFS-PDGQIKVADF 148
                +     F+  DI+ +M   L+ + +CH   I+HRD+KP+N++      ++++ D+
Sbjct: 157 -NTEFRRLYASFSDLDIRYYMFELLKALDYCHSMGIMHRDVKPHNVMIDHKQHKLRLIDW 215

Query: 149 GLARAIPAPHEILTSNVVTRWYRAPELLFGAKHYTSAIDIWSVGVIFAELM-LRIPYLPG 207
           GLA     P       V +R+++ PELL   + Y  ++D+WS G + A ++ L+ P+  G
Sbjct: 216 GLA-EFYHPSMEYNVRVASRFFKGPELLVDYRMYDYSLDLWSFGAMLASMVFLKEPFFYG 274

Query: 208 QNDVDQMEVTFRALGT 223
            ++ DQ+    R LG+
Sbjct: 275 SSNTDQLVKIVRVLGS 290

>CAGL0B02739g complement(262590..264620) similar to sp|P23561
           Saccharomyces cerevisiae YLR362w STE11 ser/thr protein
           kinase of the MEKK family, hypothetical start
          Length = 676

 Score = 87.8 bits (216), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 82/317 (25%), Positives = 136/317 (42%), Gaps = 69/317 (21%)

Query: 9   KEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSA----------------- 51
           K  ++G G++  VYLG    TG  +A+K++   E K  +  +A                 
Sbjct: 391 KGARIGSGSFGTVYLGMNAQTGELMAVKQV---EIKPAIAATADANVEDKNAEKNVAKAP 447

Query: 52  ------------IREVKYLQEMQHPNVIELIDIFMAYDNLNLVLEFLPTDLEVVIKDKSI 99
                         E+  L+E+QH N++          NLN+ LE++P      +     
Sbjct: 448 STNLHRKMIDALQHEMSLLKELQHENIVTYYGSSQEGGNLNIFLEYVPGGSVSSMLSNYG 507

Query: 100 LFTPADIKAWMLMTLRGVYHCHRNFILHRDLKPNNLLFSPDGQIKVADFGLARAIP---- 155
            F    I  +    L GV + HR  I+HRD+K  N+L    G +K+ DFG+++ +     
Sbjct: 508 PFEEPLIVNFTRQILIGVAYLHRKNIIHRDIKGANILIDIKGCVKITDFGISKKLSPLNQ 567

Query: 156 APHEILTSNVVTRWYRAPELLFGAKHYTSAIDIWSVGVIFAELML-RIPYLPGQNDVDQM 214
              +  TS   + ++ +PE++      TS  DIWS G +  E+   + PY P   D  QM
Sbjct: 568 ENQDKRTSLQGSVYWMSPEVV-KQTATTSKADIWSTGCVVIEMFTGKHPY-P---DFSQM 622

Query: 215 EVTFRALGTPTDRDWPEVSSFMTYNKLQIYPPPSRDELRKRFIAASEYALDFMCGMLTMN 274
           +  F+ +GT      PE+ S+ +        P  RD +RK F       LD+        
Sbjct: 623 QALFK-IGTNV---TPEIPSWAS--------PQGRDFIRKTF------ELDY-------- 656

Query: 275 PQKRWTAVQCLESDYFK 291
            Q+R TA++ L+  + +
Sbjct: 657 -QRRPTAIELLQESWLE 672

>Scas_644.15
          Length = 726

 Score = 87.4 bits (215), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 63/226 (27%), Positives = 109/226 (48%), Gaps = 6/226 (2%)

Query: 6   EYTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEI-KTSEFKDGLDMSAIREVKYLQEMQHP 64
           +Y +   +GEG +A  +   +  +G+  A K + K S   +      + E++  + M+HP
Sbjct: 91  DYRRGHFLGEGGFARCF-QIKDESGKIFAAKTVAKISIKTEKTKKKLLSEIQIHKSMKHP 149

Query: 65  NVIELIDIFMAYDNLNLVLEFLPTDLEVVIKDKSILFTPADIKAWMLMTLRGVYHCHRNF 124
           N++  +D F    N+ ++LE       + +  K    T  +++ +       V + H   
Sbjct: 150 NIVHFVDCFEDDTNVYILLEICSNGSLMDLMKKRKTLTEPEVRFFTTQICGAVKYMHSRR 209

Query: 125 ILHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKH--Y 182
           ++HRDLK  N+ F  D  +KV DFGLA  +    E   +   T  Y APE+L G KH  +
Sbjct: 210 VIHRDLKLGNIFFDKDYNLKVGDFGLAAVLANNRERKYTVCGTPNYIAPEVLMG-KHAGH 268

Query: 183 TSAIDIWSVGV-IFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDR 227
           +  +DIWS+GV I+A L+ + P+     +V    +     G P D+
Sbjct: 269 SFEVDIWSIGVMIYALLVGKPPFQAKDVNVIYDRIKACQYGYPKDK 314

>AER264C [2766] [Homologous to ScYCR073C (SSK22) - SH; ScYNR031C
            (SSK2) - SH] (1120017..1124468) [4452 bp, 1483 aa]
          Length = 1483

 Score = 87.8 bits (216), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 74/295 (25%), Positives = 130/295 (44%), Gaps = 39/295 (13%)

Query: 3    VNMEYTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDM-SAIR-EVKYLQE 60
            V++++ K   +G G++  VY      TG  +A+KEIK ++ K    +  +IR E+  L+ 
Sbjct: 1187 VSIKWQKRSFIGGGSFGSVYSAVNLDTGDILAVKEIKFNDRKTIKQVFPSIRDEMTVLEM 1246

Query: 61   MQHPNVIELIDIFMAYDNLNLVLEFLPTDLEVVIKDKSILFTPADIKAWMLMTLRGVYHC 120
            + HPNV++   + +  D +N+ +E+        +     +      + + L  L G+ + 
Sbjct: 1247 LNHPNVVQYYGVEVHRDRVNIFMEYCEGGSLASLLAHGRIEDEMVTQVYSLQMLEGLAYL 1306

Query: 121  HRNFILHRDLKPNNLLFSPDGQIKVADFGLARAIPA---------PHEILTSNVVTRWYR 171
            H + + HRD+KP N+L   +G IK  DFG A+ + +          H      + T  Y 
Sbjct: 1307 HESGVDHRDIKPENILLDFNGIIKYVDFGAAKVLASNGSKKLNLEQHMEGEKMIGTPMYM 1366

Query: 172  APELLFGAKHYT-SAIDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWP 230
            +PE + G  +    + DIWS+G +  E+                 VT R      D  W 
Sbjct: 1367 SPEAISGTGYGKFGSDDIWSLGCVILEM-----------------VTGRRPWANLDNQWA 1409

Query: 231  EVSSFMTYNKLQIYPPPSRDELRKRFIAASEYALDFMCGMLTMNPQKRWTAVQCL 285
             +         QI   PS++E+       S+  + F+   L  +P +R TAV+ L
Sbjct: 1410 IIYQVAAG---QIPMFPSKNEM-------SQAGIKFLSRCLIQDPNQRSTAVELL 1454

>ABL034W [558] [Homologous to ScYKL101W (HSL1) - SH]
           complement(333434..337711) [4278 bp, 1425 aa]
          Length = 1425

 Score = 87.8 bits (216), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 76/285 (26%), Positives = 139/285 (48%), Gaps = 43/285 (15%)

Query: 11  KKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFK-DGLDMSAI-----REVKYLQEMQHP 64
           K +G+G+   V L     +G+  AIK +     + +   ++A+     RE+  ++ + HP
Sbjct: 65  KTLGKGSSGRVRLAKNMQSGKLAAIKIVPKRNVRHNQKQVTALPYGIEREIIIMKLITHP 124

Query: 65  NVIELIDIFMAYDNLNLVLEFLPT-DLEVVIKDKSILFTPADIKAWMLMTLRGVYHCHRN 123
           N++ L +++     L LVLE++   +L   +  +  L     I  +    ++GV +CH  
Sbjct: 125 NIMALYEVWENKSELYLVLEYVEGGELFDYLIARGKLPEQEAIH-YFKQIVQGVSYCHNF 183

Query: 124 FILHRDLKPNNLLFSPDGQ-IKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKHY 182
            I HRDLKP NLL     + +K+ADFG+A A+   + +L ++  +  Y +PE++ G K++
Sbjct: 184 NICHRDLKPENLLLDKKNKTVKIADFGMA-ALETTNRLLETSCGSPHYASPEIVMGQKYH 242

Query: 183 TSAIDIWSVGVI-FAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWPEVSSFMTYNKL 241
            S  D+WS G+I FA L   +P+    ND +  ++  +                + + + 
Sbjct: 243 GSPSDVWSCGIILFALLTGHLPF----NDDNVRKLLLK----------------VQHGRY 282

Query: 242 QIYPPPSRDELRKRFIAASEYALDFMCGMLTMNPQKRWTAVQCLE 286
           Q+   PS           S+ A D +  +L ++P+KR T  + LE
Sbjct: 283 QM---PSN---------VSKEAKDLISKILVVDPEKRITVDKILE 315

>ADL102C [1639] [Homologous to ScYIL035C (CKA1) - SH]
           (503670..504788) [1119 bp, 372 aa]
          Length = 372

 Score = 86.3 bits (212), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 77/333 (23%), Positives = 152/333 (45%), Gaps = 53/333 (15%)

Query: 4   NMEYTKEKKVGEGTYAVVYLGCQHSTGR-----------------------KIAIKEIKT 40
           N +Y  E KVG G Y+ V+ G Q S+                          +A ++   
Sbjct: 37  NSQYEIETKVGHGKYSEVFQGVQLSSRSKVVVKMLKPVKKKKIKREIKVLMNLASEQRAA 96

Query: 41  SEF-KDGLDMSAIREVKYLQEMQ---------HPNVIELIDIFMAYDNLN----LVLEFL 86
           + F K+    +   EV+               H N+I L+D+    D ++    LV E++
Sbjct: 97  AGFDKETYYSNRSAEVRVYNRYDQVYTMPHNGHENIIHLLDVIK--DPISRTPALVFEYV 154

Query: 87  PT-DLEVVIKDKSILFTPADIKAWMLMTLRGVYHCHRNFILHRDLKPNNLLFS-PDGQIK 144
              D  ++       F+  DI+ +M   L+ + +CH   I+HRD+KP+N++      +++
Sbjct: 155 DNVDFRILYP----TFSDMDIRYYMFELLKALDYCHSMGIMHRDVKPHNVMIDHKQRKLR 210

Query: 145 VADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKHYTSAIDIWSVGVIFAELM-LRIP 203
           + D+GLA  +  P E   + V +R+++ PELL   + Y  ++D+WS+G + A ++ ++ P
Sbjct: 211 LIDWGLA-ELYHPKEEYNARVASRFFKGPELLVDYRMYDYSLDLWSLGTMLASMVFMKEP 269

Query: 204 YLPGQNDVDQMEVTFRALGTPTDRDW---PEVS---SFMTYNKLQIYPPPSRDELRKRFI 257
           +  G+++ DQ+    R LG+     +    +++    FM  ++    P         R +
Sbjct: 270 FFHGRSNTDQLVKIVRVLGSEDFEKYLVKYQITLPREFMDMDQYIRRPWKRFINDANRHL 329

Query: 258 AASEYALDFMCGMLTMNPQKRWTAVQCLESDYF 290
             +E  +D +  +L  +  +R TA + ++  +F
Sbjct: 330 CDNEEIIDLIDNILKYDHHERLTAREAMQHPWF 362

>AEL118C [2388] [Homologous to ScYKL168C (KKQ8) - SH; ScYJL165C
           (HAL5) - SH] (399738..401789) [2052 bp, 683 aa]
          Length = 683

 Score = 87.4 bits (215), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 68/230 (29%), Positives = 104/230 (45%), Gaps = 44/230 (19%)

Query: 13  VGEGTYAVVYLGCQ-----------------HSTGRKI-AIKEIK--------------T 40
           +G+G Y  V++ C+                    G+   AIKEIK              T
Sbjct: 370 IGQGAYGTVWVTCRSLPQDNQTETHYPTETYERNGKLFYAIKEIKPRADEPNEKFSTRLT 429

Query: 41  SEFKDGLDMSA-IREVKYLQEMQHPNVIELIDIFMAYDNLNLVLEFLPT-DLEVVIKDKS 98
           SEF  G  +S      K L    HPN+++++D+  A+D    V EF P+ DL  ++   S
Sbjct: 430 SEFVIGHSLSGGAGGTKRL--TSHPNILKVLDLMQAHDVFIEVFEFCPSGDLFSLLTRSS 487

Query: 99  ILFT---PADIKAWMLMTLRGVYHCHRNFILHRDLKPNNLLFSPDGQIKVADFGLARAIP 155
              +   P +   +M   L GV + H + + H DLKP N+LF+P+G +K+ DFG +    
Sbjct: 488 KTGSGLHPLEADCFMKQLLNGVRYMHDHGVAHCDLKPENILFTPNGTLKLCDFGSSSVFQ 547

Query: 156 APHE----ILTSNVVTRWYRAPELLFGAKHY-TSAIDIWSVGVIFAELML 200
              E      T  V +  Y APE     + Y T  +D WS G+I+  ++L
Sbjct: 548 TAWEKRVHFQTGAVGSEPYVAPEEFIPKREYDTRLVDCWSCGIIYCTMVL 597

>KLLA0C06138g 540409..542535 similar to sp|P32562 Saccharomyces
           cerevisiae YMR001c CDC5 involved in regulation of DNA
           replication, start by similarity
          Length = 708

 Score = 87.4 bits (215), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 62/244 (25%), Positives = 117/244 (47%), Gaps = 6/244 (2%)

Query: 6   EYTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEI-KTSEFKDGLDMSAIREVKYLQEMQHP 64
           +Y +   +GEG +A  +   +   G+  A K + K S   +      + E++  + M+HP
Sbjct: 89  DYHRGHFLGEGGFARCF-QMKDDKGKVFAAKTVAKLSIKSEKTRRKLLSEIQIHKSMKHP 147

Query: 65  NVIELIDIFMAYDNLNLVLEFLPTDLEVVIKDKSILFTPADIKAWMLMTLRGVYHCHRNF 124
           N+++  D F    N+ ++LE  P    + +  +    T  +++  M+  +  + + H   
Sbjct: 148 NIVQFTDCFEDDTNVYILLEICPNGSVMELLRQRKHLTEPEVRFCMIQIIGAIRYMHSRR 207

Query: 125 ILHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKH--Y 182
           ++HRDLK  N+ F  +  +K+ DFGLA  +    E   +   T  Y APE+L G KH  +
Sbjct: 208 VIHRDLKLGNIFFDKEYNLKIGDFGLAAVLANDKERKYTICGTPNYIAPEVLTG-KHTGH 266

Query: 183 TSAIDIWSVGV-IFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWPEVSSFMTYNKL 241
           +  +DIWS+GV ++A L  + P+   + +     +  R    P D+     +  +  + L
Sbjct: 267 SYEVDIWSIGVMLYALLFGKPPFQAKEVETIYERIKCRDFIFPADKPVSSDAKNLISHLL 326

Query: 242 QIYP 245
           Q+ P
Sbjct: 327 QLNP 330

>AER223C [2725] [Homologous to ScYAR019C (CDC15) - SH]
           (1044971..1047679) [2709 bp, 902 aa]
          Length = 902

 Score = 87.4 bits (215), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 56/199 (28%), Positives = 107/199 (53%), Gaps = 9/199 (4%)

Query: 6   EYTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEMQHPN 65
            Y  ++ +G+G Y VVY     +T + IAIK I+    +       + E+  L+ ++H N
Sbjct: 18  HYALKQVIGKGAYGVVYKAVNRATDQVIAIKAIEYENEE--ELHEHMLEIDLLKNLKHEN 75

Query: 66  VIELIDIFMAYDNLNLVLEF-LPTDLEVVIKDKSILFTPADIKAWMLMTLRGVYHCHRNF 124
           +++      +   L ++LE+ +   L  +IK +++  + A  K ++  TLRG+ + H   
Sbjct: 76  IVKYHGFIQSSHELYILLEYCIRGSLRDLIKKEAL--SEAKAKTYVRQTLRGLQYLHDQG 133

Query: 125 ILHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKHYTS 184
           ++HRD+K  NLL + +G +K+ADFG++  +   + +  +   +  + APE++ G K  ++
Sbjct: 134 VIHRDIKAANLLLTENGVVKLADFGVSTRV---NNMAMTYAGSPNWMAPEVMLG-KGAST 189

Query: 185 AIDIWSVGVIFAELMLRIP 203
             DIWS+G    EL+   P
Sbjct: 190 VSDIWSLGATVVELLTGNP 208

>CAGL0M02233g complement(267332..269635) highly similar to sp|P22216
           Saccharomyces cerevisiae YPL153c SPK1 ser/thr/tyr
           protein kinase, hypothetical start
          Length = 767

 Score = 87.0 bits (214), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 76/306 (24%), Positives = 132/306 (43%), Gaps = 48/306 (15%)

Query: 13  VGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEMQHPNVIELIDI 72
           VG G +A V    + +TG+  A+K I   +    +D    RE++ LQ++ HP ++ L   
Sbjct: 194 VGTGAFATVKKAVERNTGKTFAVKIINKRKVVGNMD-GVSRELEVLQKLNHPRIVSLKAF 252

Query: 73  FMAYDNLNLVLEFLPT-DLEVVIKDKSILFTPADIKAWMLMTLRGVYHCHRNFILHRDLK 131
           +    N  +V+EF+   DL   +     +   A  +      L  + + H   I HRDLK
Sbjct: 253 YEDEANYYMVMEFISGGDLMDFVAAHGAVGEEAG-REISRQILEAIQYIHSKGISHRDLK 311

Query: 132 PNNLLFSPDG--QIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFG----------- 178
           P+N+L   D    +K+ DFGLA+ +     I+ +   T  Y APE++ G           
Sbjct: 312 PDNILIEQDDPVLVKITDFGLAK-VQGNGSIMKTFCGTLAYVAPEVIGGFTGATGEEETE 370

Query: 179 --AKHYTSAIDIWSVG-VIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWPEVSSF 235
                Y+S +D+WS+G ++F  L   +P+                 G+  ++ + ++   
Sbjct: 371 EERIEYSSLVDMWSMGCLVFVILTGHLPF----------------SGSTQEQLYEQI--- 411

Query: 236 MTYNKLQIYPPPSRDELRKRFIAASEYALDFMCGMLTMNPQKRWTAVQCLESDYFKELPP 295
               K   +  P +D         S+ A DF+ G+L ++  KR T    L   + K+   
Sbjct: 412 ---RKGSYHEGPLKD------FRISDEARDFIDGLLQVDQSKRMTVDDALNHPWIKQCSS 462

Query: 296 PSDPSS 301
             D +S
Sbjct: 463 QFDANS 468

>ABL011C [581] [Homologous to ScYLR362W (STE11) - SH]
           (378259..380364) [2106 bp, 701 aa]
          Length = 701

 Score = 86.7 bits (213), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 66/255 (25%), Positives = 114/255 (44%), Gaps = 35/255 (13%)

Query: 9   KEKKVGEGTYAVVYLGCQHSTGRKIAIKEIK--------------------------TSE 42
           K  ++G G++  VYLG    TG  +A+K+++                          T  
Sbjct: 417 KGARIGSGSFGSVYLGMNAHTGELMAVKQVELEPTTVMASSDDKKSHPSSNAVVKKLTDP 476

Query: 43  FKDGLDMSAIREVKYLQEMQHPNVIELIDIFMAYDNLNLVLEFLPTDLEVVIKDKSILFT 102
            +DG   S+ + +  L+E+ H N++          NLN+ LE++P      + +    F 
Sbjct: 477 PQDGGRASSTK-MNLLKELHHENIVTYYGSSQEGGNLNIFLEYVPGGSVSSMLNSYGPFE 535

Query: 103 PADIKAWMLMTLRGVYHCHRNFILHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILT 162
              +K +   TL G+ + HR  I+HRD+K  NLL    G +K+ DFG+++ +   ++   
Sbjct: 536 EPLVKNFTRQTLVGLTYLHRKNIIHRDIKGANLLIDIKGSVKITDFGISKKLSPLNKKQN 595

Query: 163 SNVVTR---WYRAPELLFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFR 219
                +   ++ APE++      T   DIWSVG +  E+       P   D  QM+  F+
Sbjct: 596 KRASLQGSVYWMAPEVVKQVV-TTEKADIWSVGCVVVEMFTGKHPFP---DFSQMQAIFK 651

Query: 220 ALGTPTDRDWPEVSS 234
            +GT T  + P  +S
Sbjct: 652 -IGTNTIPELPSWAS 665

>Kwal_55.20326
          Length = 750

 Score = 86.7 bits (213), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 66/261 (25%), Positives = 115/261 (44%), Gaps = 40/261 (15%)

Query: 9   KEKKVGEGTYAVVYLGCQHSTGRKIAIKEIK-----------------TSEFKDGLDMSA 51
           K  ++G G++  VYLG    TG  +A+K+++                   ++    + SA
Sbjct: 460 KGARIGSGSFGSVYLGMNAQTGELMAVKQVELQPTAVAAGVVSVPDEVKKQYNQNANGSA 519

Query: 52  IR---------------EVKYLQEMQHPNVIELIDIFMAYDNLNLVLEFLPTDLEVVIKD 96
           ++               E+  L+E+QH N++          NLN+ LE++P      + +
Sbjct: 520 VKNSSQVHRKMVDALQHEMGLLKELQHENIVTYYGSSQEGGNLNIFLEYVPGGSVSSMLN 579

Query: 97  KSILFTPADIKAWMLMTLRGVYHCHRNFILHRDLKPNNLLFSPDGQIKVADFGLARAIPA 156
               F    I+ +    L G+ + HR  I+HRD+K  N+L    G +K+ DFG+++ +  
Sbjct: 580 SYGPFEEPLIRNFTRQILIGLSYLHRKDIIHRDIKGANILIDIKGCVKITDFGISKKLSP 639

Query: 157 PHEILTSNVVTR---WYRAPELLFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDVDQ 213
            ++        +   ++ APE++      T   DIWSVG +  E+       P   D  Q
Sbjct: 640 LNQQQNKRASLQGSVYWMAPEVVKQVV-TTKKADIWSVGCVIIEMFTGKHPFP---DFSQ 695

Query: 214 MEVTFRALGTPTDRDWPEVSS 234
           M+  F+ +GT T  D P  SS
Sbjct: 696 MQAIFK-IGTNTFPDSPSWSS 715

>Scas_713.7
          Length = 983

 Score = 86.7 bits (213), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 54/200 (27%), Positives = 100/200 (50%), Gaps = 7/200 (3%)

Query: 5   MEYTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEMQHP 64
           ++Y  ++ +G+G+Y VVY      T + +AIKE+      D   +  + E+  L+ + H 
Sbjct: 24  VQYQLKQVIGKGSYGVVYKAVNKKTLQIVAIKEVNYDN--DDELIEIMTEIDLLKNLNHV 81

Query: 65  NVIELIDIFMAYDNLNLVLEFLPT-DLEVVIKDKSILFTPADIKAWMLMTLRGVYHCHRN 123
           N+++         NL ++LEF     L+ ++          D K ++  TL G+ + H  
Sbjct: 82  NIVKYHGFIQKSSNLYIILEFCSKGSLKNLLTGYKDGIPELDAKVYIRQTLNGLVYLHEQ 141

Query: 124 FILHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKHYT 183
            ++HRD+K  NLL   +  +K+ADFG++  +      L  ++   W  +PE++ G +  +
Sbjct: 142 GVIHRDIKAANLLLDSNDVVKLADFGVSTKVSNTAMTLAGSL--HW-MSPEII-GNRGAS 197

Query: 184 SAIDIWSVGVIFAELMLRIP 203
           +  DIWS+G    EL+   P
Sbjct: 198 TLSDIWSLGATVVELVTGNP 217

>YCR073C (SSK22) [598] chr3 complement(242584..246579) Map kinase
            kinase kinase (MAPKKK) with strong similarity to Ssk2p,
            participates in the high-osmolarity signal transduction
            pathway [3996 bp, 1331 aa]
          Length = 1331

 Score = 86.7 bits (213), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 76/306 (24%), Positives = 125/306 (40%), Gaps = 53/306 (17%)

Query: 3    VNMEYTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAI-----REVKY 57
            V+M + K   +G GT+  VY       G  +A+KEIK     D   M  I      E+  
Sbjct: 1030 VSMRWQKRSFIGGGTFGQVYSAINLENGEILAVKEIK---IHDTTTMKKIFPLIKEEMTV 1086

Query: 58   LQEMQHPNVIELIDIFMAYDNLNLVLEFLPTDLEVVIKDKSILFTPADIKAWMLMTLRGV 117
            L+ + HPN+++   + +  D +N+ +E+        + D   +      + +    L G+
Sbjct: 1087 LEMLNHPNIVQYYGVEVHRDKVNIFMEYCEGGSLASLLDHGRIEDEMVTQVYTFELLEGL 1146

Query: 118  YHCHRNFILHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVV----------- 166
             + H++ ++HRD+KP N+L   +G IK  DFG AR +         N             
Sbjct: 1147 AYLHQSGVVHRDIKPENILLDFNGIIKYVDFGTARTVVGSRTRTVRNAAVQDFGVETKSL 1206

Query: 167  -----TRWYRAPELLFGA--KHYTSAIDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFR 219
                 T  Y APE + G+  K    A D+W++G +  E+                  T R
Sbjct: 1207 NEMMGTPMYMAPETISGSAVKGKLGADDVWALGCVVLEM-----------------ATGR 1249

Query: 220  ALGTPTDRDWPEVSSFMTYNKLQIYPPPSRDELRKRFIAASEYALDFMCGMLTMNPQKRW 279
               +  D +W  +         Q+   P+RDE+      A+  A  F+   L  +P  R 
Sbjct: 1250 RPWSNLDNEWAIMYHVAAGRIPQL---PNRDEM-----TAAGRA--FLERCLVQDPTMRA 1299

Query: 280  TAVQCL 285
            TAV+ L
Sbjct: 1300 TAVELL 1305

>CAGL0I05192g complement(493635..494756) highly similar to sp|P15790
           Saccharomyces cerevisiae YIL035c CKA1 casein kinase II,
           start by similarity
          Length = 373

 Score = 85.1 bits (209), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 78/341 (22%), Positives = 152/341 (44%), Gaps = 70/341 (20%)

Query: 6   EYTKEKKVGEGTYAVVYLGCQHSTGRKIAI------------------------------ 35
           +Y  E KVG G Y+ V+ G Q ++ + I I                              
Sbjct: 39  DYEIEMKVGRGKYSEVFQGVQLASRKHIVIKMLKPVKKKKIRREIKILTNLSNEKNPPTA 98

Query: 36  KEIKTSEFKDGLDMSAIREVK-YLQEM---QHPNVIELIDIFMAYDNLN----LVLEFLP 87
           +E     +    D + +++++ Y+ E+    H N+I+L D+    D ++    LV E + 
Sbjct: 99  QEFNRDLYFSNRDENILKQIRPYIYELPHHGHENIIQLFDVIR--DPISRTPALVFEHVN 156

Query: 88  T-DLEVVIKDKSILFTPADIKAWMLMTLRGVYHCHRNFILHRDLKPNNLLFS-PDGQIKV 145
             D  V+    S +    DI+ +M   L+ + +CH   I+HRD+KP+N++      ++++
Sbjct: 157 NMDFRVLYPKLSDI----DIRYYMFELLKALDYCHSMGIMHRDVKPHNVMIDHKQRKLRL 212

Query: 146 ADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKHYTSAIDIWSVGVIFAELML-RIPY 204
            D+GLA       E     V +R+++ PELL   + Y  ++D+WS G + A ++  + P+
Sbjct: 213 IDWGLAEFYHVNME-YNVRVASRFFKGPELLVDYRMYDYSLDLWSFGTMLASMIFQKEPF 271

Query: 205 LPGQNDVDQMEVTFRALGTPTDRDWPEVSSFMTYNKLQIYPPPSRDEL------------ 252
             G ++ DQ+    R LG+       +   ++   K QI  P    ++            
Sbjct: 272 FHGTSNTDQLVKIVRVLGS------DDFEKYLI--KYQITLPREFHDMDQYIRRPWYRFV 323

Query: 253 --RKRFIAASEYALDFMCGMLTMNPQKRWTAVQCLESDYFK 291
             + R ++ +E  +D +  +L  + Q+R TA + +   +F+
Sbjct: 324 NDQNRHLSDNEDVIDLLDNLLRYDHQERLTAKEAMGHPWFE 364

>Kwal_26.8796
          Length = 796

 Score = 86.3 bits (212), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 80/295 (27%), Positives = 133/295 (45%), Gaps = 44/295 (14%)

Query: 9   KEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEMQHPNVIE 68
           K++ VG+G +A V    +  TG+  A+K I   +    +D  A RE++ LQ + HP ++ 
Sbjct: 190 KDEVVGQGAFATVKKAIERKTGKTHAVKIISKRKVVGVMDGVA-RELEVLQRLDHPRIVS 248

Query: 69  LIDIFMAYDNLNLVLEFLPT-DLEVVIKDKSILFTPADIKAWMLMTLRGVYHCHRNFILH 127
           L   +   D+  LV+EF+   DL   +     +   A  +      L  V + H   I H
Sbjct: 249 LKGFYEDKDSHYLVMEFVSGGDLMDFVAAHGSVGEDAG-REITRQILEAVKYIHSMGISH 307

Query: 128 RDLKPNNLLFSPDGQ--IKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFG------- 178
           RDLKP+N+L   D    +K+ DFGLA+ I      + +   T  Y APE++ G       
Sbjct: 308 RDLKPDNILIERDDPVLVKITDFGLAK-IQGNGTFMKTFCGTLAYVAPEVISGKNSGEKE 366

Query: 179 AKHYTSAIDIWSVG-VIFAELMLRIPYLPG-QNDVDQMEVTFRALGTPTDRDWPEVSSFM 236
              Y+S +D+WS+G +++  L   +P+    QND+      ++ +   +  + P      
Sbjct: 367 GNTYSSLVDMWSIGCLVYVILTGHLPFSGSTQNDL------YKQITAGSYHEGP------ 414

Query: 237 TYNKLQIYPPPSRDELRKRFIAASEYALDFMCGMLTMNPQKRWTAVQCLESDYFK 291
               L+ Y               S+ A DF+   L ++P+ R TA Q L   + K
Sbjct: 415 ----LKDY-------------RISDDARDFIESFLQVDPRNRMTAEQALRHPWIK 452

>Kwal_26.7788
          Length = 1267

 Score = 86.3 bits (212), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 64/199 (32%), Positives = 105/199 (52%), Gaps = 7/199 (3%)

Query: 11  KKVGEGTYAVVYLGCQHSTGRKIAIKEI-KTSEFKDG-LDMSAIREVKYLQEMQHPNVIE 68
           K +G+G+   V L     TG+  AIK + KT   + G L     RE+  ++ + HPNV+ 
Sbjct: 62  KTLGKGSSGRVRLAKNMETGKLAAIKIVPKTKSSRTGSLPYGIEREIIIMKLISHPNVMG 121

Query: 69  LIDIFMAYDNLNLVLEFLPT-DLEVVIKDKSILFTPADIKAWMLMTLRGVYHCHRNFILH 127
           L +++     L LVLE++   +L   +  +  L     I  +    + G  +CH   I H
Sbjct: 122 LYEVWENKLELFLVLEYVDGGELFDYLVSRGRLPEKEAIH-YFRQIIEGTAYCHGFNICH 180

Query: 128 RDLKPNNLLF-SPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKHYTSAI 186
           RDLKP NLL    + +IK+ADFG+A A+   +++L ++  +  Y +PE++ G  +     
Sbjct: 181 RDLKPENLLLDKKNKRIKIADFGMA-ALQTSNKLLETSCGSPHYASPEIVMGKNYNGGPS 239

Query: 187 DIWSVGVI-FAELMLRIPY 204
           D+WS G+I FA L   +P+
Sbjct: 240 DVWSCGIILFALLTGHLPF 258

>CAGL0L07326g 808532..810052 similar to sp|P39009 Saccharomyces
           cerevisiae YDL101c DUN1 protein kinase, start by
           similarity
          Length = 506

 Score = 85.9 bits (211), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 78/301 (25%), Positives = 129/301 (42%), Gaps = 57/301 (18%)

Query: 6   EYTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIRE-VKYLQEMQHP 64
           +Y   K +G G YA+V      +TG  +A+K     +  D       RE    L ++ HP
Sbjct: 192 KYLLGKDLGSGHYAIVKEAKNKTTGETVAVKIFHPQQNDDQKKNKQFREETTILMKIHHP 251

Query: 65  NVIELIDIFMAYDNLNLVLEFLPTD-------LEVVIKDKSILFTPADIKAWMLMTLRGV 117
           N++ L+D F+   +   + ++L  +        + ++K  S+     + KA     L G+
Sbjct: 252 NIVNLLDSFVEPISKTQIQKYLVLEKIDDGELFDRIVKKTSL--PQEESKAIFKQILTGL 309

Query: 118 YHCHRNFILHRDLKPNNLLF------SPDG-------------QIKVADFGLARAIPAPH 158
            + H   I+HRD+KP N+L       SPD              Q+K+ADFGLA+      
Sbjct: 310 KYLHSQNIIHRDIKPENILLNIRRRQSPDERQLGPWDEDEIDIQVKIADFGLAK-FTGEM 368

Query: 159 EILTSNVVTRWYRAPELLFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTF 218
           +   +   T  Y APE+L   K YTS +D+WS GVI    +   P    Q          
Sbjct: 369 QFTNTLCGTPSYVAPEVLV-KKGYTSKVDLWSAGVILYVCLCGFPPFSDQ---------- 417

Query: 219 RALGTPTDRDWPEVSSFMTYNKLQIYPPPSRDELRKRFIAASEYALDFMCGMLTMNPQKR 278
             LG P+ ++    + +  Y+       P  DE+        + AL  +  +L ++P+ R
Sbjct: 418 --LGPPSLKEQIMSAKYAFYS-------PYWDEI-------DDAALHLISNLLVLDPENR 461

Query: 279 W 279
           +
Sbjct: 462 Y 462

>AAR009W [195] [Homologous to ScYOL016C (CMK2) - SH; ScYFR014C
           (CMK1) - SH] complement(358947..360308) [1362 bp, 453
           aa]
          Length = 453

 Score = 85.1 bits (209), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 57/198 (28%), Positives = 98/198 (49%), Gaps = 6/198 (3%)

Query: 6   EYTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEMQHPN 65
           +Y   K +G G + VV         + +AIK +     K         E+  LQ++ HPN
Sbjct: 55  DYIFGKTLGAGAFGVVRQARNSKQNQNVAIKILLKRALKGNELQMLYDELSILQKLDHPN 114

Query: 66  VIELIDIFMAYDNLNLVLEFLPTDLEVVIKD-KSILFTPADIKAWMLMTLRGVYHCHRNF 124
           +++  D F + +   +V + L T  E+  +  K   FT  D    ++  L  V + H   
Sbjct: 115 IVKFKDWFESREKFYIVTQ-LATGGELFDRILKKGKFTETDAVKIVVQMLTAVEYMHSQN 173

Query: 125 ILHRDLKPNNLLF---SPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKH 181
           ++HRDLKP N+L+   S + Q+ ++DFG+A+ + +  +++     +  Y APE+L  + H
Sbjct: 174 VVHRDLKPENVLYLDPSDESQLVISDFGIAKQLSSESQLIHRAAGSMGYVAPEVLTTSGH 233

Query: 182 YTSAIDIWSVGVIFAELM 199
                DIWS+GVI   L+
Sbjct: 234 -GKPCDIWSLGVITYTLL 250

>Kwal_33.13984
          Length = 649

 Score = 85.5 bits (210), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 72/234 (30%), Positives = 127/234 (54%), Gaps = 23/234 (9%)

Query: 4   NMEYTKEKKVGEGTYAVVYLGCQHSTGRKI-AIKEIKT-SEFKDGLDMSAIREVKYLQ-- 59
           N +Y     +G+GT+  V + CQ+   ++I A+K +K+ SE+ +     +I E K L+  
Sbjct: 275 NRKYLVLDILGQGTFGQV-VKCQNLLTKEILAVKVVKSKSEYLN----QSITEAKILELL 329

Query: 60  ------EMQHPNVIELIDIFMAYDNLNLVLEFLPTDL-EVVIKDKSILFTPADIKAWMLM 112
                 + +H + + + + F+  ++L LV E L ++L E++ +++    + + I+ +   
Sbjct: 330 NGKIDPQGEH-HFLRMHETFVHKNHLCLVFELLSSNLYELLKQNQFHGLSISLIRTFARQ 388

Query: 113 TLRGVYHCHRNFILHRDLKPNN-LLFSPDG-QIKVADFGLARAIPAPHEILTSNVVTRWY 170
            L  +     + ++H DLKP N LL S D  ++KV DFG A         L + + +R+Y
Sbjct: 389 LLDSLCVLKEHKLIHCDLKPENILLVSLDRPELKVIDFGSACE---ETRTLYTYIQSRFY 445

Query: 171 RAPELLFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTP 224
           RAPE++ G   Y++ ID+WS+G I AEL L IP  PG ++ +Q+      LG P
Sbjct: 446 RAPEVILGIP-YSTGIDMWSLGCIIAELFLGIPIFPGSSEFNQITRIVDTLGLP 498

>ACL006W [1043] [Homologous to ScYMR001C (CDC5) - SH]
           complement(344395..346521) [2127 bp, 708 aa]
          Length = 708

 Score = 85.5 bits (210), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 58/202 (28%), Positives = 103/202 (50%), Gaps = 7/202 (3%)

Query: 6   EYTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEI-KTSEFKDGLDMSAIREVKYLQEMQHP 64
           +Y +   +GEG +A  +   +  +G+  A K + K S   +      + E++  + M+HP
Sbjct: 72  DYHRGMFLGEGGFARCF-QMKDDSGKVFAAKTVAKISIKSEKTRKKLLSEIQIHKSMKHP 130

Query: 65  NVIELIDIFMAYDNLNLVLEFLPT-DLEVVIKDKSILFTPADIKAWMLMTLRGVYHCHRN 123
           N+++  D F    N+ ++LE  P   L  ++K +  L  P +++ +    +  + + H  
Sbjct: 131 NIVQFTDCFEDDTNVYILLEICPNGSLMDLLKQRKQLTEP-EVRFFTTQIVGAIKYMHSR 189

Query: 124 FILHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKH-- 181
            I+HRDLK  N+ F     +K+ DFGLA  +    E   +   T  Y APE+L G KH  
Sbjct: 190 RIIHRDLKLGNIFFDKHFNLKIGDFGLAAVLANDRERKYTICGTPNYIAPEVLTG-KHTG 248

Query: 182 YTSAIDIWSVGVIFAELMLRIP 203
           ++  +DIWS+GV+   L++  P
Sbjct: 249 HSFEVDIWSIGVMIYALLIGKP 270

>Scas_707.3
          Length = 1598

 Score = 85.5 bits (210), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 55/152 (36%), Positives = 84/152 (55%), Gaps = 6/152 (3%)

Query: 6   EYTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEMQH-- 63
           +YT  K + +G Y  VYL  +  TG   AIK +K S+      ++ ++  + +  +Q   
Sbjct: 698 DYTILKPISKGAYGSVYLARKKITGDYFAIKVLKKSDMIAKNQVTNVKSERAIMMVQSDK 757

Query: 64  PNVIELIDIFMAYDNLNLVLEFLPT-DLEVVIKDKSILFTPAD-IKAWMLMTLRGVYHCH 121
           P V  L   F   +NL LV+E+LP  DL  +IK   + + P   +K ++   + GV   H
Sbjct: 758 PYVARLFATFQNKENLFLVMEYLPGGDLATLIK--MMGYLPDQWVKQYLTEIIVGVDDMH 815

Query: 122 RNFILHRDLKPNNLLFSPDGQIKVADFGLARA 153
           RN+I+H DLKP+NLL    G +K+ DFGL+RA
Sbjct: 816 RNWIIHHDLKPDNLLIDNLGHVKLTDFGLSRA 847

>Scas_616.10
          Length = 1461

 Score = 85.1 bits (209), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 52/157 (33%), Positives = 88/157 (56%), Gaps = 9/157 (5%)

Query: 53  REVKYLQEMQHPNVIELIDIFMAYDNLNLVLEFLPTDL---EVVIKDKSILFTPADIKAW 109
           RE+  ++ + HPNV+ L +++     L LVLE++        +V K K    +  +   +
Sbjct: 185 REIVIMKLISHPNVMALYEVWENKSELYLVLEYVDGGELFDYLVSKGK---LSEKEAVHY 241

Query: 110 MLMTLRGVYHCHRNFILHRDLKPNNLLFSPDGQ-IKVADFGLARAIPAPHEILTSNVVTR 168
               ++GV +CH   I HRDLKP NLL     + IK+ADFG+A A+  P+++L ++  + 
Sbjct: 242 FKQIIQGVSYCHSFNICHRDLKPENLLLDKKNKSIKIADFGMA-ALELPNKLLQTSCGSP 300

Query: 169 WYRAPELLFGAKHYTSAIDIWSVGVI-FAELMLRIPY 204
            Y +PE++ G  ++    D+WS G+I FA L   +P+
Sbjct: 301 HYASPEIVMGKSYHGGPSDVWSCGIILFALLTGHLPF 337

>Kwal_56.22476
          Length = 697

 Score = 84.3 bits (207), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 55/204 (26%), Positives = 101/204 (49%), Gaps = 11/204 (5%)

Query: 6   EYTKEKKVGEGTYAVVYL----GCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEM 61
           +Y +   +GEG +A  +     G +    + +A   IK+ + +  L    + E++  + M
Sbjct: 78  DYHRGHFLGEGGFARCFQIKDDGGKIFAAKTVAKISIKSEKTRKKL----LSEIQIHKSM 133

Query: 62  QHPNVIELIDIFMAYDNLNLVLEFLPTDLEVVIKDKSILFTPADIKAWMLMTLRGVYHCH 121
           +H N+++ +D F    N+ ++LE  P    + +  +  + T  +++ +    +  V + H
Sbjct: 134 RHTNIVQFVDCFEDDTNVYILLEICPNGSLMDLLKRRKMLTEPEVRFFTTQIVGAVKYMH 193

Query: 122 RNFILHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKH 181
              ++HRDLK  N+ F     +KV DFGLA  +    E   +   T  Y APE+L G KH
Sbjct: 194 SRRVIHRDLKLGNIFFDKHYNLKVGDFGLAAVLANDRERKYTVCGTPNYIAPEVLTG-KH 252

Query: 182 --YTSAIDIWSVGVIFAELMLRIP 203
             ++  +DIWS GV+   L++  P
Sbjct: 253 TGHSYEVDIWSCGVMIYALLIGKP 276

>KLLA0A06820g complement(615686..618004) some similarities with
           sp|P38970 Saccharomyces cerevisiae YJL165c HAL5 ser/thr
           protein kinase, hypothetical start
          Length = 772

 Score = 84.0 bits (206), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 65/227 (28%), Positives = 99/227 (43%), Gaps = 40/227 (17%)

Query: 13  VGEGTYAVVYLGCQ---------------HSTGRKIAIKEIK--------------TSEF 43
           +G+G Y VV L  +               H      A+KE+K              TSEF
Sbjct: 460 IGQGAYGVVKLCYKFIDPDEPDLKDNTYFHDNKLFYAVKELKPRPDEPPKKFSTRLTSEF 519

Query: 44  KDGLDMSAIREVKYLQEMQHPNVIELIDIFMAYDNLNLVLEFLPT-DLEVVI----KDKS 98
             GL +S   + +      HPN++ +ID+    +    V+EF P+ DL  +I    K  S
Sbjct: 520 VIGLSLSGGNKSRRSSARTHPNILNVIDLMQTPNAFYEVMEFCPSGDLYSLITRSSKSDS 579

Query: 99  ILFTPADIKAWMLMTLRGVYHCHRNFILHRDLKPNNLLFSPDGQIKVADFGLARAIPAPH 158
           +L  P +   +M   L G+ + H + + H D+KP NLLF P G +K+ DFG +       
Sbjct: 580 VLH-PLEADCFMKQLLHGIQYMHAHGVAHCDIKPENLLFLPTGVLKICDFGTSSVFQTAW 638

Query: 159 E----ILTSNVVTRWYRAPELLFGAKHYTSA-IDIWSVGVIFAELML 200
           E      T    +  Y APE     + Y    +D WS G+I+  ++L
Sbjct: 639 EKKAHFQTGPAGSEPYVAPEEFIPKQQYDPRLVDCWSCGIIYCVMVL 685

>Scas_653.25
          Length = 666

 Score = 84.0 bits (206), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 60/209 (28%), Positives = 100/209 (47%), Gaps = 15/209 (7%)

Query: 11  KKVGEGTYAVVYLGCQHSTGRKIAIKEIK---TSEFKDGLDMSAIREVKYLQEMQHPNVI 67
           +K+G G    V     HS  ++ A+K  K     E         I+E      + HPN+I
Sbjct: 273 QKLGSGANGCVVQLQNHSNDKRFAMKTFKPNPNGETTKQYQKRCIKEFILSSHLSHPNII 332

Query: 68  ELIDIFMA-YDNLNLVLEFLPTDLEVVIKDKSILFTPADIKAWMLMTLRGVYHCHRNFIL 126
           E +DIF      ++ ++E+ P D   ++  ++ L T  +   +      GV + H   I 
Sbjct: 333 ETLDIFYNPSGQISEIMEWCPHDFFNIVMSRTHLLTRRETFCYFKQLCNGVRYLHTLGIA 392

Query: 127 HRDLKPNNLLFSPDGQIKVADFG------LARAIPAPHEILTSN--VVTRWYRAPELLFG 178
           HRDLK +N + + +G +K+ DFG      L ++     E++ S   V +  Y APE+L  
Sbjct: 393 HRDLKLDNCVITYNGILKLIDFGSATIFQLNKSTEEKPELIPSRGIVGSDPYLAPEVLLS 452

Query: 179 AK--HYTSAIDIWSVGVIFAELML-RIPY 204
            +  +  S  D+WS+G+IF  +ML R P+
Sbjct: 453 KEIPYDASLADVWSLGIIFCAIMLKRFPW 481

>KLLA0F11319g 1042436..1044967 similar to sgd|S0006071 Saccharomyces
           cerevisiae YPL150w, start by similarity
          Length = 843

 Score = 84.0 bits (206), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 75/281 (26%), Positives = 121/281 (43%), Gaps = 41/281 (14%)

Query: 7   YTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEMQHPNV 66
           Y   K +GEG++  VYL     T +K+ +K        +  D + +REV Y ++   P +
Sbjct: 37  YKISKFIGEGSFGKVYLATHRLTHQKVVLKT------GNKRDPNVVREVFYHRQFDFPYI 90

Query: 67  IELIDIFMAYDNLNLVLEFLPTD--LEVVIKDKSILFTPADIKAWMLMTLRGVYHCHRNF 124
            +L ++ +    + +VLE+       E ++K++ +    +  K         VY+ H   
Sbjct: 91  TKLYEVIVTESRVWMVLEYCSGHELYEHLLKEQRLSLEES--KKLFSQIASAVYYAHELK 148

Query: 125 ILHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKHYTS 184
            +HRDLK  N+L   +G  K+ DFG  R + A    L +   T  Y APEL+    +   
Sbjct: 149 CVHRDLKLENVLLDGNGHAKLTDFGFTREM-ATRSQLETICGTTVYMAPELIERKCYDGF 207

Query: 185 AIDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWPEVSSFMTYNKLQIY 244
            +DIWS+G+I   ++    Y+P   D D                           KL+I 
Sbjct: 208 KVDIWSLGIILYTMI--NGYMPFDEDDD------------------------IKTKLKIV 241

Query: 245 PPPSRDELRKRFIAASEYALDFMCGMLTMNPQKRWTAVQCL 285
                DEL       S+ A+D + GML  NP +R +  Q L
Sbjct: 242 ----NDELDFNQEWISDDAIDLIQGMLRKNPNERISLAQVL 278

>CAGL0K10604g complement(1029226..1030566) similar to sp|P27466
           Saccharomyces cerevisiae YFR014c CMK1
           Ca2+/calmodulin-dependent ser/thr protein kinase type I,
           hypothetical start
          Length = 446

 Score = 83.2 bits (204), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 78/285 (27%), Positives = 129/285 (45%), Gaps = 34/285 (11%)

Query: 7   YTKEKKVGEGTYAVVYLGCQHSTGRKIAIK-EIKTSEFKDGLDMSAIREVKYLQEMQHPN 65
           Y  ++ +G G++ VV    Q  +   +A+K  +K +  K+G       E+  +Q + HPN
Sbjct: 65  YLFQRTLGAGSFGVVKRAKQLHSDEDVAVKILLKRALEKNGGLEPIYDELNIIQHLDHPN 124

Query: 66  VIELIDIFMAYDNLNLVLEFLPTD--LEVVIKDKSILFTPADIKAWMLMTLRGVYHCHRN 123
           +++  D F       +V +        + ++ D    +T  D    ++  L+ V + H  
Sbjct: 125 IVKFKDWFETESKFYIVTQLASGGELFDRIMHDGK--YTEEDAVNIVVQILKAVEYLHSQ 182

Query: 124 FILHRDLKPNNLLF---SPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAK 180
            I+HRDLKP NLL+   S D +I +ADFG+AR +    +++     +  Y APE +F + 
Sbjct: 183 NIIHRDLKPENLLYLDKSKDSRIVLADFGIARQLENDDDVIYRPAGSLGYVAPE-VFTSD 241

Query: 181 HYTSAIDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWPEVSSFMTYNK 240
            +    DIWSVGVI   L+    Y P           F+A     D    EV+S     K
Sbjct: 242 GHGKPSDIWSVGVITYTLL--CGYSP-----------FKA--ESVDGFLDEVTSDENPVK 286

Query: 241 LQIYPPPSRDELRKRFIAASEYALDFMCGMLTMNPQKRWTAVQCL 285
            Q          R  +   SE A +F+  +L ++P  R +A + L
Sbjct: 287 FQ----------RPYWDGISELAKNFILRILDLDPACRPSATELL 321

>Scas_201.1*
          Length = 274

 Score = 81.6 bits (200), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 61/192 (31%), Positives = 96/192 (50%), Gaps = 14/192 (7%)

Query: 17  TYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSA---IREVKYLQEMQHPNVIELIDIF 73
           T+ VV    Q  +   +A+K +  +  K G D+       E+  LQ + HPN++   D F
Sbjct: 45  TFGVVRQARQFFSQEAVAVKILLKNALK-GNDVQLQMLYDELSILQRLHHPNIVAFKDWF 103

Query: 74  MAYDNLNLVLEFLPTDLEV---VIKDKSILFTPADIKAWMLMTLRGVYHCHRNFILHRDL 130
            + D   +V + L T  E+   +IK     FT  D    M+  L  V + H   I+HRDL
Sbjct: 104 ESRDKFYIVTQ-LATGGELFDRIIKKGK--FTEVDAVNIMVQLLDAVKYIHSQNIVHRDL 160

Query: 131 KPNNLLF---SPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKHYTSAID 187
           KP N+L+   S + Q+ +ADFG+A+ + +  +++     +  Y APE+L    H     D
Sbjct: 161 KPENVLYLDPSDESQLVIADFGIAKELKSNDDLIFKGAGSLGYVAPEVLTKEGH-GKPCD 219

Query: 188 IWSVGVIFAELM 199
           IWS+GVI   L+
Sbjct: 220 IWSLGVITYTLL 231

>AEL284C [2221] [Homologous to ScYGR052W - SH] (106480..107919)
           [1440 bp, 479 aa]
          Length = 479

 Score = 82.8 bits (203), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 62/229 (27%), Positives = 104/229 (45%), Gaps = 15/229 (6%)

Query: 1   MKVNMEYTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEI-KTSEFKDGLDMSAI---REVK 56
           M  N  Y   + +  G+++VV+      TG+ +A+K + K  +  + L   A     E  
Sbjct: 1   MHGNHRYKVGRLIQSGSFSVVHHAQDCQTGQDVALKYVRKPHDNPEQLQKVAALVHNEYA 60

Query: 57  YLQEM-QHPNVIELIDIFMAYDNLNLVLEFLP-TDLEVVIKDKSILFTPA---DIKAWML 111
            L+ +  H N+ +L+D +   D    VLE+    DL   IK  +I   P    +  +++ 
Sbjct: 61  ILRRLGTHRNICQLLDFYEDADTYVFVLEYCAYGDLYDFIK--AIRERPTMRINFHSFLF 118

Query: 112 MTLRGVYHCHRNFILHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYR 171
                + +CH   + HRD+KP N+L    GQ+K+ DFGL++      +     + T  Y 
Sbjct: 119 QLCSAISYCHSKDVSHRDIKPENVLMDDRGQVKLTDFGLSQIGSVSKDYC---IGTEKYL 175

Query: 172 APELLFGAKHYTSAIDIWSVGV-IFAELMLRIPYLPGQNDVDQMEVTFR 219
           APE      H T A D WS+G+ IF  +    P+    +D  +    F+
Sbjct: 176 APETFLREYHNTFATDYWSLGITIFCLMFGSCPFESASSDAPKRSANFQ 224

>Scas_633.29
          Length = 789

 Score = 83.2 bits (204), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 93/310 (30%), Positives = 140/310 (45%), Gaps = 56/310 (18%)

Query: 4   NMEYTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEMQH 63
           + EY K + +G G  + VY   ++S  +  A+K +   EF D        E++ L+++ +
Sbjct: 297 DTEYEKIELLGRGGSSRVY-KVKNSQNKVFALKRVSFDEFDDSSVDGFKGEIELLEKLSN 355

Query: 64  PN-VIELIDIFMAYDNLNLVLEFLPTDLEVVIKDKSILFTPADIKAWMLMTLRGVYHC-- 120
            + V++L D  M    L L++E    DL  ++  +S +  P D+  ++    R V  C  
Sbjct: 356 ESRVVKLFDYQMDSGVLFLIMECGDHDLSQILSQRSDM--PLDMD-FVRYHAREVVRCIK 412

Query: 121 --HRNFILHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEI---LTSNVVTRWYRAPEL 175
             H   I+H DLKP N +F   G +K+ DFG+A AIP  H +     + + T  Y APE 
Sbjct: 413 IVHDAGIVHSDLKPANFVFVK-GILKIIDFGIANAIP-DHTVNIYRENQIGTPNYMAPEA 470

Query: 176 LFGAKHYTSA------------IDIWSVGVIFAELML-RIPY--LPGQNDVDQMEVTFRA 220
           L  A +YT+              DIWS G I  +++  R PY    GQN          A
Sbjct: 471 LV-AMNYTNENDGGNKWKVGKPSDIWSCGCIIYQMIYGRPPYAGFQGQN-------RLLA 522

Query: 221 LGTPTDRDWPEVSSFMTYNKLQIYPPPSRDELRKRFIAASEYALDFMCGMLTMNPQKRWT 280
           +  P   D   + S  T N   I  P S               +D M G LT +P+KRW+
Sbjct: 523 IMNP---DVKVIFSEKTANNESI--PRS--------------LIDLMKGCLTRDPEKRWS 563

Query: 281 AVQCLESDYF 290
             Q LES +F
Sbjct: 564 VDQVLESPFF 573

>Kwal_26.8941
          Length = 661

 Score = 83.2 bits (204), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 71/247 (28%), Positives = 112/247 (45%), Gaps = 27/247 (10%)

Query: 11  KKVGEGTYAVVYLGCQHSTGRKIAIKEIKT---SEFKDGLDMSAIREVKYLQEMQHPNVI 67
           K +G G    V +  + S G   A+KE +    +E           E      + HPNVI
Sbjct: 135 KILGSGAGGSVRVIVRPSDGATFAVKEFRPRRPTELAKDYAKKCTAEFCIGSTLHHPNVI 194

Query: 68  ELIDIF--MAYDNLNLVLEFLPTDLEVVIKDKSILFTPADIKAWMLMTLRGVYHCHRNFI 125
           E +DIF     +    V+E+ P D   V+   ++  +  +I   +     GV + H   +
Sbjct: 195 ETLDIFSDAKQNKYYEVMEYCPIDFFAVVMSGNM--SRGEINCCLRQLSEGVRYLHNMGL 252

Query: 126 LHRDLKPNNLLFSPDGQIKVADFGLA--------RAIPAPHEILTSNVVTRWYRAPELLF 177
            HRDLK +N + + DG +K+ DFG A         ++   H I+ S+     Y APE++ 
Sbjct: 253 AHRDLKLDNCVMTCDGILKLIDFGSAVVFKYPFDSSVTMAHGIVGSDP----YLAPEVMT 308

Query: 178 GAKHYTSA-IDIWSVGVIFAELML-RIPY-LPGQNDVDQMEVTFRALGTPTDRDWPEVSS 234
             K Y    +DIWS+G+I+  +ML R P+  P ++D +     FR    P D +   V S
Sbjct: 309 STKRYDPQFVDIWSIGIIYCCMMLKRFPWKTPKESDDN-----FRLFCLPDDVEHDYVKS 363

Query: 235 FMTYNKL 241
              + KL
Sbjct: 364 AREHEKL 370

>KLLA0E01584g 149713..150960 highly similar to sp|P39009
           Saccharomyces cerevisiae YDL101c DUN1 protein kinase,
           start by similarity
          Length = 415

 Score = 82.8 bits (203), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 66/225 (29%), Positives = 100/225 (44%), Gaps = 31/225 (13%)

Query: 6   EYTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAI-REVKYLQEMQHP 64
           +Y   K++G G YA+V       TG  +A+K     +  D         E K L  +QHP
Sbjct: 100 KYLAGKELGTGHYAIVKEARNKETGETVAVKIFHPQQNDDDKRTKKFTEETKILLSIQHP 159

Query: 65  NVIELIDIFM-----AYDNLNLVLEFLPTD--LEVVIKDKSILFTPADIKAWMLMTLRGV 117
           N+++LID F+           LVLE +      E +++  ++     + KA     L G+
Sbjct: 160 NIVKLIDRFVEPVSKTQIQTYLVLEKINDGELFERIVRKNNL--REDETKALFRQLLNGL 217

Query: 118 YHCHRNFILHRDLKPNNLLFSP-------------------DGQIKVADFGLARAIPAPH 158
            + H   I+HRD+KP N+L S                    D Q+K+ADFGLA+      
Sbjct: 218 KYLHSRNIIHRDIKPENILLSISKRRSPEEIALGPWDDDELDIQVKIADFGLAK-FTGEM 276

Query: 159 EILTSNVVTRWYRAPELLFGAKHYTSAIDIWSVGVIFAELMLRIP 203
           +   +   T  Y APE+L     YTS +D+WS GV+    +   P
Sbjct: 277 KFTNTLCGTPSYVAPEVLVKT-GYTSRVDMWSAGVLLYVCLCGFP 320

>Scas_720.94
          Length = 1683

 Score = 83.2 bits (204), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 60/230 (26%), Positives = 102/230 (44%), Gaps = 35/230 (15%)

Query: 2    KVNMEYTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAI-----REVK 56
             +++ + K   +G GT+  VY       G  +A+KEIK    +D   M  I      E+ 
Sbjct: 1356 NLSIRWQKRNFIGGGTFGTVYSAVNLDNGEILAVKEIK---IQDSKTMKKIFPLVKEEMT 1412

Query: 57   YLQEMQHPNVIELIDIFMAYDNLNLVLEFLPTDLEVVIKDKSILFTPADIKAWMLMTLRG 116
             L+ + HPN+++   + +  D +N+ +E+        + +   +      + + L  L G
Sbjct: 1413 VLEMLNHPNIVQYYGVEVHRDKVNIFMEYCEGGSMASLLEHGRIEDEMVTQVYTLELLEG 1472

Query: 117  VYHCHRNFILHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILT-------------- 162
            + + H+  ++HRD+KP N+L   +G IK  DFG AR I      +T              
Sbjct: 1473 LAYLHQAGVVHRDIKPENILLDFNGIIKYVDFGAARKIAKNGTKVTNINSKSKDDDEPDE 1532

Query: 163  ------SNVV-----TRWYRAPELLFGAKHYT--SAIDIWSVGVIFAELM 199
                  +N V     T  Y APE + G K+ T   + DIWS G +  E++
Sbjct: 1533 KDTEGGANSVHDMLGTPMYMAPESITGYKNKTKFGSDDIWSFGCVVLEMI 1582

>Scas_704.50
          Length = 369

 Score = 82.0 bits (201), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 83/341 (24%), Positives = 149/341 (43%), Gaps = 66/341 (19%)

Query: 4   NMEYTKEKKVGEGTYAVVYLGCQHSTGRKIAI------------KEIK------------ 39
           N +Y  E KVG G Y+ V+ G + +    I I            +EI             
Sbjct: 37  NKDYEIEVKVGRGKYSEVFQGVKLNDRSPIVIKMLKPVKKKKIKREISILTNLSNEKTPP 96

Query: 40  -TSEFKDGLDMSAIRE------VKYLQEM---QHPNVIELIDIFMAYDNLNLVLEFLPTD 89
            T  F   L  +  +E        YL ++    H N+I+L DI     +    L F   D
Sbjct: 97  TTLPFDVDLYYTNKKESVLKFKADYLYDLPHDGHKNIIQLFDIIKDPISKTPALVFEHVD 156

Query: 90  LEVVIKDKSILF---TPADIKAWMLMTLRGVYHCHRNFILHRDLKPNNLLFS-PDGQIKV 145
                 D  +L+   T  DI+ +M   L+ + +CH   I+HRD+KP+N++    + ++++
Sbjct: 157 ----NIDFRVLYPKLTDMDIRYYMFELLKALDYCHSMGIMHRDVKPHNVMIDHKNKKLRL 212

Query: 146 ADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKHYTSAIDIWSVGVIFAELML-RIPY 204
            D+GLA    A  E     V +R+++ PELL   + Y  ++D+WS G + A ++  + P+
Sbjct: 213 IDWGLAEFYHANME-YNVRVASRFFKGPELLVDYRMYDYSLDLWSFGTMLASMVFQKEPF 271

Query: 205 LPGQNDVDQMEVTFRALGTPTDRDWPEVSSFMTYNKLQIYPPPSRDELRK---------- 254
             G ++ DQ+    R LG+       +   ++T  K +I  P    ++ +          
Sbjct: 272 FHGTSNTDQLVKIVRVLGS------EDFEKYLT--KYEITLPREFHDMDQYIRRPWYRFI 323

Query: 255 ----RFIAASEYALDFMCGMLTMNPQKRWTAVQCLESDYFK 291
               R +  +E  +D +  +L  + Q+R TA + +   +F+
Sbjct: 324 NDANRHLCDNEDIIDLIDNLLKYDHQERLTAKEAMGHPWFE 364

>Kwal_33.13112
          Length = 505

 Score = 82.4 bits (202), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 76/291 (26%), Positives = 133/291 (45%), Gaps = 44/291 (15%)

Query: 7   YTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEMQHPNV 66
           Y  ++ VG+G++  VY      TG  +A+K I   E +D +D+ A +E+ +L E++ P V
Sbjct: 36  YDIKECVGKGSFGDVYRAIDKETGEMVAVKIINLEETQDDIDVLA-QEIYFLSELRAPFV 94

Query: 67  IELIDIFMAYDNLNLVLEFLP----TDLEVVIKDKSILFTPADIKAWMLM-TLRGVYHCH 121
                 ++   ++ +V+EF       DL   + +  +   P +  A+++   L G+ + H
Sbjct: 95  TTYYKTYVEDVSMWIVMEFCGGGSCADLLKHLPEHRL---PENKVAYIIREVLYGLEYLH 151

Query: 122 RNFILHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSN--VVTRWYRAPELLFGA 179
               +HRD+K  N+L + +G++K+ DFG++  I A    L  N  V T ++ APE++   
Sbjct: 152 SQRKIHRDVKAANILLTDEGEVKLGDFGVSGQIMA---TLKRNTFVGTPYWMAPEIIARD 208

Query: 180 KHYTSAIDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWPEVSSFMTYN 239
             Y    DIWS+G+   EL+                      G P    +  +   M   
Sbjct: 209 NGYDEKADIWSLGITAMELL---------------------TGQPPYAKYDPMKVLMN-- 245

Query: 240 KLQIYPPPSRDELRKRFIAASEYALDFMCGMLTMNPQKRWTAVQCLESDYF 290
            + +  PP    L+ RF ++   A DF+   LT +P  R TA   L   + 
Sbjct: 246 -IPLRKPP---RLQGRFTSS---ARDFIALCLTKDPALRPTASDLLSHKFL 289

>Scas_477.5
          Length = 703

 Score = 82.8 bits (203), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 75/318 (23%), Positives = 130/318 (40%), Gaps = 71/318 (22%)

Query: 9   KEKKVGEGTYAVVYLGCQHSTGRKIAIKE------------------------------- 37
           K  ++G G++  VYLG    TG  +A+K+                               
Sbjct: 408 KGARIGSGSFGTVYLGMNAQTGELMAVKQVGITAPPTPSAVVDKSKNSNSNGSGKNNSNG 467

Query: 38  -IKTSEFKDGLDM------SAIREVKYLQEMQHPNVIELIDIFMAYDNLNLVLEFLPTDL 90
            I   + K+  +M      +   E+  L+E+ H N++          NLN+ LE++P   
Sbjct: 468 KIANDQAKNSPNMHKKMVDALQHEMNLLKELHHENIVTYYGSSQEGPNLNIFLEYVPGGS 527

Query: 91  EVVIKDKSILFTPADIKAWMLMTLRGVYHCHRNFILHRDLKPNNLLFSPDGQIKVADFGL 150
              + +    F  + I  ++   L GV + H   I+HRD+K  N+L    G +K+ DFG+
Sbjct: 528 VSSMLNNYGPFEESLIVNFIRQVLIGVAYLHNKNIIHRDIKGANILIDTKGCVKITDFGI 587

Query: 151 ARAIP--APHEILTSNVVTRWYRAPELLFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQ 208
           ++ +   +  +   S   + ++ APE++      T   DIWS G +  E+       P  
Sbjct: 588 SKKLSPLSKQDKRASLQGSVYWMAPEVV-KQTATTEKADIWSTGCVVIEMFTGKHPFP-- 644

Query: 209 NDVDQMEVTFRALGTPTDRDWPEVSSFMTYNKLQIYPPPSRDELRKRFIAASEYALDFMC 268
            D  QM+  F+ +GT T    PEV S+                       AS+   DF+ 
Sbjct: 645 -DFSQMQTIFK-IGTNTT---PEVPSW-----------------------ASDLGKDFLS 676

Query: 269 GMLTMNPQKRWTAVQCLE 286
               +N +KR +A++ L+
Sbjct: 677 KTFEVNYKKRLSALEILQ 694

>Kwal_26.8709
          Length = 829

 Score = 82.4 bits (202), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 58/209 (27%), Positives = 103/209 (49%), Gaps = 15/209 (7%)

Query: 13  VGEGTYAVVYLGCQHSTG------RKIAIKEIK--TSEFKDGLDMSAIREVKYLQEMQHP 64
           +GEG +  V LG   ++       +++AIK I+  T       ++   RE+  L+ + HP
Sbjct: 46  LGEGEFGKVKLGWSKTSNSSMDVPKQVAIKLIRRDTIPKNSEKEIKIYREINALKHLNHP 105

Query: 65  NVIELIDIFMAYDNLNLVLEFLPTD--LEVVIKDKSILFTPADIKAWMLMTLRGVYHCHR 122
           N++ L ++      + +VLE+       + + K + +   PA      L++  GVY+ H 
Sbjct: 106 NIVRLEEVLQNSKYIGIVLEYASGGEFYKYIQKKRRLKEGPACRLFAQLIS--GVYYMHS 163

Query: 123 NFILHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKHY 182
             ++HRDLK  NLL   +  + + DFG        +E++ ++  +  Y APEL+  A+ Y
Sbjct: 164 KGLVHRDLKLENLLLDKNENLLITDFGFVNEFLPENELMKTSCGSPCYAAPELVVTARPY 223

Query: 183 TS-AIDIWSVGVIFAELMLRIPYLPGQND 210
            +   D+WS GVI   ++    YLP  +D
Sbjct: 224 EARKADVWSCGVILYAMLAG--YLPWDDD 250

>CAGL0M10153g complement(1010688..1013291) some similarities with
           sp|Q03497 Saccharomyces cerevisiae YHL007c ser/thr
           protein kinase of the pheromone pathway, hypothetical
           start
          Length = 867

 Score = 82.4 bits (202), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 64/223 (28%), Positives = 106/223 (47%), Gaps = 14/223 (6%)

Query: 12  KVGEGTYAVVYLGCQHSTGRK-IAIKEIKTSEFKDGLDMSAIREVKYLQEMQHPNVIELI 70
           K+G+G    VYL    S   + +AIK++     K       + E+  +   +H N++  I
Sbjct: 571 KIGQGASGGVYLSHSRSDKSQCVAIKQMNLE--KQPKKELIVNEIMVMSSSKHQNIVNYI 628

Query: 71  DIFMAYDNLNLVLEFLPTDLEVVIKDKSILFTPADIKAWMLMTLRGVYHCHRNFILHRDL 130
           D +++  +L +V+E++       +    +L T   I A     L+G+   H   +LHRD+
Sbjct: 629 DSYLSGLDLWVVMEYMEGGCLTDVVTYCVL-TEGQIGAVCREVLQGLEFLHSKGVLHRDI 687

Query: 131 KPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKHYTSAIDIWS 190
           K +N+L S +G IK+ DFG    +       T+ V T ++ APE++   K Y   +DIWS
Sbjct: 688 KSDNVLLSMNGDIKLTDFGFCAQVNDTVIKRTTMVGTPYWMAPEIV-SRKEYGPKVDIWS 746

Query: 191 VGVIFAELML-RIPYLPGQNDVDQMEVTFRALGTPTDRDWPEV 232
           +G++  E++    PYL         E   RAL        PEV
Sbjct: 747 LGIMIIEMIEGEPPYL--------NETPLRALYLIATNGRPEV 781

>Scas_651.19
          Length = 801

 Score = 81.6 bits (200), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 67/226 (29%), Positives = 103/226 (45%), Gaps = 41/226 (18%)

Query: 13  VGEGTYAVVYLGCQ-------------HSTGRKI--AIKEIK--------------TSEF 43
           +G G Y VV +  +              S G+K+  A+KE+K              TSEF
Sbjct: 495 IGHGAYGVVKVCARPLNPNIDETPLQTFSNGQKLFFAVKELKLKNATQTEKFSTRITSEF 554

Query: 44  KDGLDMSAIREVKYLQEMQHPNVIELIDIFMAYDNLNLVLEFLPT-DLEVVIKDKSILFT 102
             G  +S  R  K    +  PN++++ID+    D    V+EF P+ DL  ++  KS   T
Sbjct: 555 IIGHSLS--RSHKKGDRVS-PNILKIIDLLENNDTFFEVMEFCPSGDLYSLLTRKSKNGT 611

Query: 103 ---PADIKAWMLMTLRGVYHCHRNFILHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHE 159
              P +   +M   L GV + H + + H DLKP N+LF PDG +K+ DFG +       E
Sbjct: 612 ALHPLEADCFMKQLLHGVKYMHDHGVAHCDLKPENILFHPDGLLKICDFGTSCVFQTAWE 671

Query: 160 ----ILTSNVVTRWYRAPELLFGAKHYT-SAIDIWSVGVIFAELML 200
                 +  + +  Y APE     K Y    +D WS GV++  +++
Sbjct: 672 KHVHFQSGAMGSEPYVAPEEFISGKEYDPRLVDCWSCGVVYCTMVM 717

>Kwal_27.9773
          Length = 406

 Score = 80.9 bits (198), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 67/242 (27%), Positives = 105/242 (43%), Gaps = 45/242 (18%)

Query: 6   EYTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEMQHPN 65
           EY   +++G G++  V       T R +  KEIK            I E   L +++H N
Sbjct: 18  EYQVLEEIGRGSFGSVRKVVHVPTNRVLVRKEIKYGHMNSKERQQLISECAILSQLKHEN 77

Query: 66  VIELIDIFMAYDNLNLVLEFLPT-DLEVVIK--DKSILFTPADIKAW--MLMTLRGVYHC 120
           ++E  +     D L   +E+    DL  +I    K   + P  +  W  M+  L  +Y C
Sbjct: 78  IVEFYEWDSDVDVLYFYMEYCSNGDLSQMISHFKKERKYIPERL-VWSVMVQVLVALYRC 136

Query: 121 H---------------------RNFILHRDLKPNNLLFS----PDGQ------------I 143
           H                      N ++HRDLKP N+  S    PD +            +
Sbjct: 137 HYGSDLAPLETIYDRMKPPVKGSNVVIHRDLKPGNIFLSTERVPDARVALQAFDYSKISV 196

Query: 144 KVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKHYTSAIDIWSVGVIFAEL-MLRI 202
           K+ DFGLA+++ A  E  T+ V T +Y +PE+L   + Y+   DIWS+G +  E+  LR 
Sbjct: 197 KLGDFGLAKSLGASVEFATTYVGTPYYMSPEVLMD-QPYSPLSDIWSLGCVIYEMCTLRP 255

Query: 203 PY 204
           P+
Sbjct: 256 PF 257

>KLLA0E06413g complement(577669..581154) gi|22858696|gb|AAN05732.1
            Kluyveromyces lactis protein kinase C, start by
            similarity
          Length = 1161

 Score = 81.6 bits (200), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 74/263 (28%), Positives = 127/263 (48%), Gaps = 18/263 (6%)

Query: 11   KKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYL----QEMQHPNV 66
            K +G+G +  V L    +T    AIK +K        D+ + R  K +     E +HP +
Sbjct: 838  KVLGKGNFGKVLLARSKNTSNLCAIKVLKKDNIIKNHDIESARAEKKVFLLATETKHPFL 897

Query: 67   IELIDIFMAYDNLNLVLEFLPT-DLEVVIKDKSILFTPADI-KAWMLMTLRGVYHCHRNF 124
              L   F   + +   +EF+   DL   ++++ +    A    A +L++L+   + H N 
Sbjct: 898  TNLYCSFQTENRIYFAMEFIGGGDLMWHVQNRRLSVRRAKFYAAEVLLSLK---YFHDNG 954

Query: 125  ILHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKHYTS 184
            +++RDLK  N+L +P+G IK+AD+GL +         ++   T  + APE+L G + YT 
Sbjct: 955  VIYRDLKLENILLTPEGHIKIADYGLCKDNMWYGNKTSTFCGTPEFMAPEILKG-QAYTK 1013

Query: 185  AIDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWPEVSSFMTYNKLQIY 244
            A+D W+ GV+  +++L      G+   D+ EV F A+ T    D P     M  + +QI+
Sbjct: 1014 AVDWWTFGVLLYQMLLCQSPFSGE---DEDEV-FNAILT----DEPLYPIDMAGDIVQIF 1065

Query: 245  PPPSRDELRKRFIAASEYALDFM 267
                  +  KR  A  + AL+ M
Sbjct: 1066 QGLLTKDPEKRLGAGPKDALEIM 1088

>CAGL0M02299g 273725..276406 similar to tr|Q12152 Saccharomyces
           cerevisiae YPL150w, start by similarity
          Length = 893

 Score = 81.6 bits (200), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 58/195 (29%), Positives = 97/195 (49%), Gaps = 11/195 (5%)

Query: 7   YTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEMQHPNV 66
           Y  +K++GEG++  VYL     T +K+ +K        D  D + +REV Y ++  +P +
Sbjct: 42  YKIQKQIGEGSFGKVYLATHRPTKQKVVLKT------GDKSDPNVVREVFYHRQFDYPYI 95

Query: 67  IELIDIFMAYDNLNLVLEFLP-TDLEVVIKDKSILFTPADIKAWMLMTLRG-VYHCHRNF 124
            +L ++ +    + + LE+ P  +L   +  KS L  P    A +   + G V++ H   
Sbjct: 96  TKLYEVIVTETKVWMALEYCPGKELYDHLLSKSRL--PTLECAELFAQITGAVHYAHTLN 153

Query: 125 ILHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKHYTS 184
            +HRDLK  N+L   +G  K+ DFG  R       +L +   T  Y APE++    +   
Sbjct: 154 CVHRDLKLENVLLDKNGNAKLTDFGFTRE-SMTKAVLETVCGTTVYMAPEMIQHKPYDGF 212

Query: 185 AIDIWSVGVIFAELM 199
            +DIWS+GVI   L+
Sbjct: 213 KVDIWSLGVILYTLL 227

>KLLA0F08877g 825217..826182 gi|27526975|emb|CAD36965.1
           Kluyveromyces lactis cyclin-dependent kinase activating
           kinase 1, start by similarity
          Length = 321

 Score = 80.1 bits (196), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 40/141 (28%), Positives = 75/141 (53%), Gaps = 14/141 (9%)

Query: 114 LRGVYHCHRNFILHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAP 173
           + G+ + H N I+HRD+KP N++ +   ++ + DFG++      +E  T +  T  Y+AP
Sbjct: 122 IEGLVYIHGNGIIHRDVKPQNIMLNSYNEVVLGDFGISYNRNLDNEAKTCDCSTSIYKAP 181

Query: 174 ELLFGAKHYTSAIDIWSVGVIFAEL-------------MLRIPYLPGQNDVDQMEVTFRA 220
           ELLF   +Y   IDIW++ V+ ++L             ++ I +    +D+  +   F  
Sbjct: 182 ELLFSVSNYKFEIDIWALAVLISQLWNDKTQSKSKSSKVIDIDF-DECSDIKLVLTLFDK 240

Query: 221 LGTPTDRDWPEVSSFMTYNKL 241
            G P++ DWP+V+   ++N +
Sbjct: 241 FGKPSNEDWPQVTKNESFNGM 261

>KLLA0C17160g 1498959..1501454 similar to sp|P53104 Saccharomyces
           cerevisiae YGL180w APG1 essential for autophagocytosis,
           start by similarity
          Length = 831

 Score = 81.3 bits (199), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 70/256 (27%), Positives = 114/256 (44%), Gaps = 56/256 (21%)

Query: 7   YTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIR-EVKYLQEMQHPN 65
           Y+ EK++G+G++AVVY G     GR IAIK +  S+ K+   +  +  E+  L++++HP+
Sbjct: 21  YSVEKEIGKGSFAVVYKGLSLRDGRNIAIKAVSRSKLKNKKLLENLEVEIAILKKIKHPH 80

Query: 66  VIELIDIFMAYDNLNLVLEFLP-TDLEVVIKDKSILFTPADIKAWMLMTLRGVY------ 118
           ++ LID      +  L++E+    DL   IK +  L     +K  ++ T+   Y      
Sbjct: 81  IVGLIDCERTSSDFYLIMEYCALGDLTFFIKKRKNLV----LKHPLIKTVFEHYPPPSTE 136

Query: 119 HCHRNFIL---------------------HRDLKPNNLL-------------FSPDGQI- 143
           H   N +L                     HRD+KP NLL             F   G + 
Sbjct: 137 HNGLNRVLVVNYLQQLSSALKFLRSKNLVHRDIKPQNLLLCTPLLDYNDPKTFHELGFVG 196

Query: 144 -------KVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKHYTSAIDIWSVGVIFA 196
                  K+ADFG AR +P    +  +   +  Y APE+L   + Y +  D+WSVG +  
Sbjct: 197 IYNLPILKIADFGFARFLPNT-SLAETLCGSPLYMAPEIL-NYQKYNAKADLWSVGTVLY 254

Query: 197 ELMLRIPYLPGQNDVD 212
           E+    P     N ++
Sbjct: 255 EMCCGRPPFKASNHLE 270

>YGL180W (ATG1) [1811] chr7 (160069..162762) Serine/threonine
           protein kinase involved in induction of autophagy after
           nutrient limitation [2694 bp, 897 aa]
          Length = 897

 Score = 80.9 bits (198), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 83/328 (25%), Positives = 139/328 (42%), Gaps = 94/328 (28%)

Query: 7   YTKEKKVGEGTYAVVYLGCQHSTGRK---IAIKEIKTSEFKDGLDMSAIR-EVKYLQEMQ 62
           YT EK++G+G++A VY G  H T  K   +AIKE+  ++ K+   +  +  E+  L++++
Sbjct: 24  YTAEKEIGKGSFATVYRG--HLTSDKSQHVAIKEVSRAKLKNKKLLENLEIEIAILKKIK 81

Query: 63  HPNVIELIDIFMAYDNLNLVLEFLP-TDLEVVIKDKSILFTPADIKAWMLMTLRGVYH-- 119
           HP+++ LID      +  L++E+    DL  ++K +  L     +       LR V+   
Sbjct: 82  HPHIVGLIDCERTSTDFYLIMEYCALGDLTFLLKRRKELMENHPL-------LRTVFEKY 134

Query: 120 ---------CHRNFIL-------------------HRDLKPNNLLFSP------DGQ--- 142
                     HR F+L                   HRD+KP NLL S       D +   
Sbjct: 135 PPPSENHNGLHRAFVLSYLQQLASALKFLRSKNLVHRDIKPQNLLLSTPLIGYHDSKSFH 194

Query: 143 ------------IKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKHYTSAIDIWS 190
                       +K+ADFG AR +P    +  +   +  Y APE+L   + Y +  D+WS
Sbjct: 195 ELGFVGIYNLPILKIADFGFARFLPNT-SLAETLCGSPLYMAPEIL-NYQKYNAKADLWS 252

Query: 191 VGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWPEVSSFMTYNKLQIYPPPSRD 250
           VG +  E+    P     N ++  +   RA          +V +F +Y  ++    P   
Sbjct: 253 VGTVVFEMCCGTPPFRASNHLELFKKIKRA---------NDVITFPSYCNIE----PELK 299

Query: 251 ELRKRFIAASEYALDFMCGMLTMNPQKR 278
           EL              +C +LT +P +R
Sbjct: 300 EL--------------ICSLLTFDPAQR 313

>Scas_640.14*
          Length = 728

 Score = 80.9 bits (198), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 57/211 (27%), Positives = 101/211 (47%), Gaps = 16/211 (7%)

Query: 13  VGEGTYAVVYLGCQHST---------GRKIAIKEIKTSEFKDGLD--MSAIREVKYLQEM 61
           +GEG +  V +G   ++          +++AIK I+    K G +  M   RE+  L+ +
Sbjct: 44  LGEGEFGKVKMGWSTTSSSSGKITEDSKQVAIKLIRRDFIKKGSEKEMKIFREINSLKHL 103

Query: 62  QHPNVIELIDIFMAYDNLNLVLEFLPT-DLEVVIKDKSILFTPADIKAWMLMTLRGVYHC 120
            HPN++ L ++      + +VLE+    +    ++ K  L      + +  + + GV + 
Sbjct: 104 THPNIVRLEEVLQNSKYIGIVLEYASGGEFYKYVQRKRRLKEATACRLFAQL-ISGVSYM 162

Query: 121 HRNFILHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAK 180
           H   I+HRDLK  NLL      + + DFG      A +E++ ++  +  Y APEL+   +
Sbjct: 163 HSKGIVHRDLKLENLLLDKHENLIITDFGFVNEFYADNELMKTSCGSPCYAAPELVITTE 222

Query: 181 HYTS-AIDIWSVGVIFAELMLRIPYLPGQND 210
            Y +   DIWS G+I   ++    YLP  +D
Sbjct: 223 PYKARKADIWSCGIILYGMLA--GYLPWDDD 251

>Scas_718.90
          Length = 647

 Score = 80.9 bits (198), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 58/198 (29%), Positives = 100/198 (50%), Gaps = 11/198 (5%)

Query: 11  KKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYL--QEMQHPNVIE 68
           KK+GEG    V +  Q + G+  A+K  +  +  + +  S    V++     + H N+IE
Sbjct: 319 KKLGEGATGSVSI-VQGTDGKMFAVKMFRAPKTTNVVTYSKKITVEFCIGSTLHHQNIIE 377

Query: 69  LIDIFMAYDNLNLVLEFLPTDL-EVVIKDKSILFTPADIKAWMLMTLRGVYHCHRNFILH 127
             D+    +   +V+E+ P D   +V+ D   L T  ++  +      GV + H   I H
Sbjct: 378 TFDMLREGETFLVVMEYAPYDFFNLVMAD---LMTTKEVSCYFKQLCNGVNYLHDMGIAH 434

Query: 128 RDLKPNNLLFSPDGQIKVADFGLARAIPAPHE--ILTSN--VVTRWYRAPELLFGAKHYT 183
           RDLK +N + S +G +K+ DFG A     P+E  I+ +   V +  Y APELL  + +  
Sbjct: 435 RDLKLDNCVVSHNGILKLIDFGSAVIFQYPYENKIVKAQGIVGSDPYLAPELLNTSTYDP 494

Query: 184 SAIDIWSVGVIFAELMLR 201
             +D+WS+ +I+  ++LR
Sbjct: 495 RPVDVWSIAIIYYCMILR 512

>ACR142W [1189] [Homologous to ScYPL153C (RAD53) - SH]
           complement(597519..600032) [2514 bp, 837 aa]
          Length = 837

 Score = 80.9 bits (198), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 72/287 (25%), Positives = 127/287 (44%), Gaps = 44/287 (15%)

Query: 13  VGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEMQHPNVIELIDI 72
           VG+G +A V    + +TG+  A+K I   +    +D    RE++ L+ + HP ++ L   
Sbjct: 223 VGQGAFATVKKAVERNTGKTFAVKIINKRKVMGNVD-GVTRELEVLRRLNHPRIVSLKGF 281

Query: 73  FMAYDNLNLVLEFLPT-DLEVVIKDKSILFTPADIKAWMLMTLRGVYHCHRNFILHRDLK 131
           +   ++  L++EF+   DL   +     +   A  +      L  V + H   I HRDLK
Sbjct: 282 YEDDESYYLLMEFVSGGDLMDFVAAHGSVGEDAG-REITRQILEAVRYIHEQGISHRDLK 340

Query: 132 PNNLLFSPDGQ--IKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFG---------AK 180
           P+N+L   D    +K+ DFGLA+ I      + +   T  Y APE++ G           
Sbjct: 341 PDNILIEQDDPVLVKITDFGLAK-IQDNTTFMKTFCGTLAYVAPEVIGGKNPEGNGANGN 399

Query: 181 HYTSAIDIWSVG-VIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWPEVSSFMTYN 239
            Y+S +D+WS+G +++  L   +P+          E  ++ +   +  + P         
Sbjct: 400 LYSSLVDMWSIGCLVYVILTGHLPF-----SGSTQEQLYKQIANGSYHEGP--------- 445

Query: 240 KLQIYPPPSRDELRKRFIAASEYALDFMCGMLTMNPQKRWTAVQCLE 286
                       L+  +I  S+ A DF+  +L +NP  R TA + L+
Sbjct: 446 ------------LKDYWI--SDEARDFIDSLLQINPVDRLTAERALQ 478

>Scas_700.34
          Length = 864

 Score = 80.9 bits (198), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 72/265 (27%), Positives = 120/265 (45%), Gaps = 34/265 (12%)

Query: 13  VGEGTYAVVYLG------CQHSTG----RKIAIKEIK--TSEFKDGLDMSAIREVKYLQE 60
           +GEG +  V LG         S+G    +++AIK I+  T       ++   RE+  L+ 
Sbjct: 54  LGEGEFGKVKLGWPKNSLPSSSSGIDVPKQVAIKLIRRDTISKDSSKEIKIYREINALKH 113

Query: 61  MQHPNVIELIDIFMAYDNLNLVLEFLPTD--LEVVIKDKSILFTPADIKAWMLMTLRGVY 118
           + HPN+++L ++      + +VLE+       + + + K +   PA         + GV+
Sbjct: 114 LTHPNIVKLEEVLQNSKYIGIVLEYASGGEFYKYIQRKKRLKEGPA--CRLFAQLINGVH 171

Query: 119 HCHRNFILHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFG 178
           + H   ++HRDLK  NLL      + + DFG      +  E++ ++  +  Y APEL+  
Sbjct: 172 YIHSKGLVHRDLKLENLLLDKHENLIITDFGFVSEFYSHGELMKTSCGSPCYAAPELVVS 231

Query: 179 AKHYTS-AIDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWPEVSSFMT 237
            K Y +   DIWS GVI   ++    YLP  +D           G P   D   +  ++T
Sbjct: 232 TKPYEAKKADIWSCGVILYAMLAG--YLPWDDDA----------GNPDGDDISRLYHYIT 279

Query: 238 YNKLQ----IYPPPSRDELRKRFIA 258
              L+    I P P RD LR+  I+
Sbjct: 280 QTPLKFPDYINPIP-RDLLRRILIS 303

>CAGL0K12496g 1218391..1219473 similar to sp|P43568 Saccharomyces
           cerevisiae YFL029c CAK1 cdk-activating protein kinase,
           hypothetical start
          Length = 360

 Score = 79.7 bits (195), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 60/219 (27%), Positives = 99/219 (45%), Gaps = 51/219 (23%)

Query: 65  NVIELIDIFMAYDNLNLVLEFLPTDLEVVIKD----------------------KSILFT 102
           +VI+LI+      N+ L  +F P DLE  ++                       +S    
Sbjct: 60  HVIKLIEDQCKNSNIELWFKFYPIDLEDYLRSCFKPQNKFNPYYTLGEVLETSLRSSYVN 119

Query: 103 PADI----KAWMLMTLRGVYHCHRNFILHRDLKPNNLLFS--PDGQIKVA--DFGLARAI 154
             D+    K + L  ++G+   H++ I+HRD+KP N++      G+  +   DFG++  I
Sbjct: 120 EFDVNEFAKDFFLQIVKGLNFIHQSGIIHRDIKPRNIVLEKLSTGKFNLVLIDFGISYDI 179

Query: 155 PAPH-----EILTSNVVTRWYRAPELLFGAKHYTSAIDIWSVGVIFAELM---------- 199
              +     +   ++V T  Y+APELLFG K+Y+SA+DIW++ VI +             
Sbjct: 180 TETNIDERPDSKITDVSTSIYKAPELLFGVKNYSSAVDIWAMLVILSNFFSLASDCKNYL 239

Query: 200 ---LRIPYLPGQNDVDQMEV---TFRALGTPTDRDWPEV 232
                  Y PG+ D   +++    F   G PT  +WPEV
Sbjct: 240 SSCFDDGYRPGEEDGSDIKLIFSIFEKFGVPTANEWPEV 278

>CAGL0K01661g complement(146952..148400) some similarities with
           tr|Q12100 Saccharomyces cerevisiae YDL025c, hypothetical
           start
          Length = 482

 Score = 79.7 bits (195), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 61/201 (30%), Positives = 98/201 (48%), Gaps = 14/201 (6%)

Query: 11  KKVGEGTYAVVYLGCQHSTGRKIAIKEIKTS-----EFKDGLDMSAIREVKYLQEMQHPN 65
           KK+GEG    V +  + S G++ A+K  +TS     E  +        E      + H N
Sbjct: 183 KKIGEGASGSVSI-VKKSNGQQYAVKMFRTSPNSTQEQIEKYCKKITAEFCMGSTLHHAN 241

Query: 66  VIELIDIFMAYDNLNLVLEFLPTDLEVVIKDKSILFTPADIKAWMLMTLRGVYHCHRNFI 125
           VIE  DI    ++L +V+E+ P D   ++   ++  +P +I  +      GV + H   I
Sbjct: 242 VIETFDIIREGNSLLMVMEYAPYDFFDLVMTNTM--SPDEISCYFKQLCHGVNYLHAMGI 299

Query: 126 LHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHE----ILTSNVVTRWYRAPELLFGAKH 181
            HRDLK +N + + DG +K+ DFG A     P+E      T  V +  Y +PELL    H
Sbjct: 300 AHRDLKLDNCVVTNDGILKLIDFGSAVIFQYPYERNIVKATGIVGSDPYLSPELL-EMNH 358

Query: 182 YTSAI-DIWSVGVIFAELMLR 201
           Y   + D+WS+ +I+  + L+
Sbjct: 359 YDPRLADVWSLAIIYYCMTLK 379

>CAGL0K12562g 1234866..1239914 similar to sp|P43565 Saccharomyces
           cerevisiae YFL033c RIM15 protein kinase involved in
           expression of meiotic genes, hypothetical start
          Length = 1682

 Score = 80.5 bits (197), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 60/170 (35%), Positives = 86/170 (50%), Gaps = 16/170 (9%)

Query: 11  KKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEMQH--PNVIE 68
           K + +G Y  VYL  +  TG   AIK ++ S+      ++ ++  + +  +Q   P V  
Sbjct: 786 KPISKGAYGSVYLARKKLTGDYFAIKVLRKSDMIAKNQVTNVKSERAIMMVQSDKPYVAR 845

Query: 69  LIDIFMAYDNLNLVLEFLPT-DLEVVIKDKSILFTPAD-IKAWMLMTLRGVYHCHRNFIL 126
           L   F   DNL LV+E+LP  DL  ++K    L  P + +K ++   + GV   H N I+
Sbjct: 846 LYATFQNKDNLFLVMEYLPGGDLATLLKMMGCL--PDEWVKQYLSEIIIGVEDMHNNGII 903

Query: 127 HRDLKPNNLLFSPDGQIKVADFGLARA--------IPAPHEILTSNVVTR 168
           H DLKP NLL    G +K+ DFGL+RA        IP P  I  SN  TR
Sbjct: 904 HHDLKPENLLIDVSGHLKLTDFGLSRAGLVKRHRHIPKP--ISLSNADTR 951

>Scas_692.24
          Length = 718

 Score = 80.1 bits (196), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 60/190 (31%), Positives = 94/190 (49%), Gaps = 16/190 (8%)

Query: 61  MQHPNVIELIDIFMAYDNLNL--VLEFLPTDLEVVIKDKSILFTPADIKAWMLMTLRGVY 118
           + HPNVIE +DIF          V+++ P D   V+    +  +  +I   +   L GV 
Sbjct: 271 LHHPNVIETVDIFSDSKQNKYFEVMQYCPVDFFAVVMTGKM--SRGEINCCLKQLLEGVK 328

Query: 119 HCHRNFILHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHE---ILTSNVV-TRWYRAPE 174
           + H   + HRDLK +N + + DG +K+ DFG A     P+E    +   +V +  Y APE
Sbjct: 329 YLHSMGLAHRDLKLDNCVMNEDGILKLIDFGSAVVFRYPYEDDIAMAHGIVGSDPYLAPE 388

Query: 175 LLFGAKHYT-SAIDIWSVGVIFAELML-RIPY-LPGQNDVDQMEVTFRALGTPTDRDWPE 231
           ++   K Y    +DIWSVG+I+  +ML R P+  P ++D +     FR    P D +   
Sbjct: 389 VITSTKSYDPQCVDIWSVGIIYCCMMLKRFPWKAPRESDDN-----FRLYSMPDDMEHDY 443

Query: 232 VSSFMTYNKL 241
           V S   + +L
Sbjct: 444 VESARHHEEL 453

>KLLA0D07304g 623352..624749 some similarities with sp|P32491
           Saccharomyces cerevisiae YPL140c MKK2 protein kinase of
           the map kinase kinase (MEK) family, hypothetical start
          Length = 465

 Score = 79.3 bits (194), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 60/195 (30%), Positives = 102/195 (52%), Gaps = 16/195 (8%)

Query: 13  VGEGTYAVVYLGCQHSTGRKI-AIKEIKTSEFKDGLDMSAIREVKYLQEMQHPNVIELID 71
           +GEGT   V   C+   G KI A+K I T E  DG +    RE+++ +  +   ++    
Sbjct: 185 LGEGTGGSV-TKCKLRNGSKIFALKTIATIE-NDGSEKQIFRELQFNKSCKSDFIVRYYG 242

Query: 72  IFMAYDN--LNLVLEFLPT-DLEVVIKDKSILFTPADIKAWML-----MTLRGVYHCHRN 123
           +F   +   + + +E++    L+ V K   +L     I   +L       LRG+++ H  
Sbjct: 243 MFACEETSTIFIAMEYMGGRSLDSVYKH--LLSKGGRIGEKVLGKIAESVLRGLFYLHER 300

Query: 124 FILHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKHYT 183
            I+HRD+KP N+LF+  GQIK+ DFG++    A + + T+   T +Y APE + G + Y+
Sbjct: 301 KIIHRDIKPQNILFNEIGQIKLCDFGVSGE--AVNSLATTFTGTSYYMAPERIQG-QPYS 357

Query: 184 SAIDIWSVGVIFAEL 198
              D+WS+G+   E+
Sbjct: 358 VTSDVWSLGLTLLEV 372

>CAGL0C02893g complement(286017..287966) similar to tr|Q08732
           Saccharomyces cerevisiae YOR267c, hypothetical start
          Length = 649

 Score = 79.3 bits (194), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 57/201 (28%), Positives = 96/201 (47%), Gaps = 12/201 (5%)

Query: 11  KKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIR---EVKYLQEMQHPNVI 67
           K +G G    V +  + + G   A+KE +  +  + +   A +   E      + HPNVI
Sbjct: 219 KLLGSGAGGSVKILTRPTDGATFAVKEFRPRKPNESVKEYAKKCTAEFCIGSSLHHPNVI 278

Query: 68  ELIDIFM--AYDNLNLVLEFLPTDLEVVIKDKSILFTPADIKAWMLMTLRGVYHCHRNFI 125
           E +D+F     +    V+++ P D   V+    +  +  +I   +     GV + H   +
Sbjct: 279 ETVDVFSDSKQNKYYEVMQYCPIDFFAVVMTGKM--SRGEINCCLKQLTEGVRYLHSMGL 336

Query: 126 LHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHE---ILTSNVV-TRWYRAPELLFGAKH 181
            HRDLK +N + + DG IK+ DFG A     P E    +   +V +  Y APE++   K 
Sbjct: 337 AHRDLKLDNCVMTADGIIKLIDFGSAVVFRYPFEDDVTMAHGIVGSDPYLAPEVITSTKS 396

Query: 182 YT-SAIDIWSVGVIFAELMLR 201
           Y    +DIWS+G+I+  +ML+
Sbjct: 397 YDPQCVDIWSIGIIYCCMMLK 417

>ADR174C [1916] [Homologous to ScYOR267C - SH] (1008798..1010813)
           [2016 bp, 671 aa]
          Length = 671

 Score = 79.3 bits (194), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 61/208 (29%), Positives = 101/208 (48%), Gaps = 13/208 (6%)

Query: 5   MEYTKEKKV-GEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGL-DMSAIREVKYL--QE 60
            +Y K  KV G G    V +  + S GR  A+K+ +     + + D +     +Y+    
Sbjct: 114 QKYGKLGKVLGSGAGGSVKVLVRPSDGRTFAVKQFRPRRPGESVKDYARKCTSEYMIGSM 173

Query: 61  MQHPNVIELIDIFM--AYDNLNLVLEFLPTDLEVVIKDKSILFTPADIKAWMLMTLRGVY 118
           + HPNVIE +D+F     +    V+E+ P D   V+   S   +  +I       + GV 
Sbjct: 174 LHHPNVIETLDVFSNSKQNQYYEVMEYCPVDFFAVVM--SGQMSRGEINCCFKQLVEGVN 231

Query: 119 HCHRNFILHRDLKPNNLLFSPDGQIKVADFGLA----RAIPAPHEILTSNVVTRWYRAPE 174
           + H     HRDLK +N + + DG +K+ DFG A        A  ++    V +  Y APE
Sbjct: 232 YLHSKGYAHRDLKLDNCVMTRDGILKLIDFGSAFVFKYTYEADEKMAHGVVGSDPYLAPE 291

Query: 175 LLFGAKHYTSA-IDIWSVGVIFAELMLR 201
           +L   K Y++  +DIWS+G+I+  ++L+
Sbjct: 292 VLTSTKSYSAPLVDIWSIGIIYCCMILK 319

>YIL035C (CKA1) [2632] chr9 complement(287789..288907) Casein kinase
           II (protein kinase CK2), catalytic (alpha) subunit [1119
           bp, 372 aa]
          Length = 372

 Score = 78.6 bits (192), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 67/252 (26%), Positives = 121/252 (48%), Gaps = 42/252 (16%)

Query: 63  HPNVIELIDIFMAYDNLN----LVLEFLPTDLEVVIKDKSILF---TPADIKAWMLMTLR 115
           H N+I L DI    D ++    LV E++         D  IL+   T  +I+ +M   L+
Sbjct: 130 HANIIHLFDIIK--DPISKTPALVFEYVDN------VDFRILYPKLTDLEIRFYMFELLK 181

Query: 116 GVYHCHRNFILHRDLKPNNLLFS-PDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPE 174
            + +CH   I+HRD+KP+N++    + ++++ D+GLA       E     V +R+++ PE
Sbjct: 182 ALDYCHSMGIMHRDVKPHNVMIDHKNKKLRLIDWGLAEFYHVNME-YNVRVASRFFKGPE 240

Query: 175 LLFGAKHYTSAIDIWSVGVIFAELML-RIPYLPGQNDVDQMEVTFRALGTPTDRDWPEVS 233
           LL   + Y  ++D+WS G + A ++  R P+  G ++ DQ+    + LGT         S
Sbjct: 241 LLVDYRMYDYSLDLWSFGTMLASMIFKREPFFHGTSNTDQLVKIVKVLGT---------S 291

Query: 234 SFMTY-NKLQIYPPPSRDELRK-------RFI-------AASEYALDFMCGMLTMNPQKR 278
            F  Y  K +I  P    ++ +       RFI       + ++  +D +  +L  + Q+R
Sbjct: 292 DFEKYLLKYEITLPREFYDMDQYIRKPWHRFINDGNKHLSGNDEIIDLIDNLLRYDHQER 351

Query: 279 WTAVQCLESDYF 290
            TA + +   +F
Sbjct: 352 LTAKEAMGHPWF 363

>CAGL0J03828g 362722..364125 similar to sp|P32490 Saccharomyces
           cerevisiae YOR231w MKK1 ser/thr protein kinase or
           sp|P32491 Saccharomyces cerevisiae YPL140c MKK2, start
           by similarity
          Length = 467

 Score = 79.0 bits (193), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 59/216 (27%), Positives = 106/216 (49%), Gaps = 21/216 (9%)

Query: 13  VGEGTYAVVYLGCQHSTGRKI-AIKEIKTSEFKDGLDMSAIREVKYLQEMQHPNVIELID 71
           +GEG    V   C+  TG+K+ A+K I             +RE+++ +  +   ++    
Sbjct: 186 LGEGAGGSV-AKCKLRTGKKVFALKTINILNGDPEFQKQLLRELQFNKSFKSEYIVRYFG 244

Query: 72  IFMAYDN--LNLVLEFLP-TDLEVVIKDKSILFTPADIKAWML-----MTLRGVYHCHRN 123
           +F    N  + + +E++    LE + K+  +L     I   +L       LRG+ + H  
Sbjct: 245 MFTDEQNSSIYIAMEYMGGKSLEAIYKE--LLSRGGRISEKVLGKISEAVLRGLSYLHEK 302

Query: 124 FILHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKHYT 183
            ++HRD+KP N+L + DGQ+K+ DFG++    A + + T+   T +Y APE + G + Y+
Sbjct: 303 KVIHRDIKPQNILLNEDGQVKLCDFGVSGE--AVNSLATTFTGTSYYMAPERIQG-QPYS 359

Query: 184 SAIDIWSVGVIFAELML-RIPYLPGQNDVDQMEVTF 218
              D+WS+G+   E+     P+ P     D+M  T 
Sbjct: 360 VTCDVWSLGLTILEVAQGHFPFGP-----DKMATTI 390

>YFL033C (RIM15) [1651] chr6 complement(69113..74425)
           Serine/threonine protein kinase, positive regulator of
           IME2 expression and of sporulation [5313 bp, 1770 aa]
          Length = 1770

 Score = 79.3 bits (194), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 53/152 (34%), Positives = 80/152 (52%), Gaps = 6/152 (3%)

Query: 6   EYTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEMQH-- 63
           +Y   K + +G Y  VYL  +  TG   AIK ++ S+      ++ ++  + +  +Q   
Sbjct: 793 DYDILKPISKGAYGSVYLARKKLTGDYFAIKVLRKSDMIAKNQVTNVKSERAIMMVQSDK 852

Query: 64  PNVIELIDIFMAYDNLNLVLEFLPT-DLEVVIKDKSILFTPAD-IKAWMLMTLRGVYHCH 121
           P V  L   F   DNL LV+E+LP  DL  +IK   + + P    K ++   + GV   H
Sbjct: 853 PYVARLFASFQNKDNLFLVMEYLPGGDLATLIK--MMGYLPDQWAKQYLTEIVVGVNDMH 910

Query: 122 RNFILHRDLKPNNLLFSPDGQIKVADFGLARA 153
           +N I+H DLKP NLL    G +K+ DFGL+RA
Sbjct: 911 QNGIIHHDLKPENLLIDNAGHVKLTDFGLSRA 942

 Score = 33.5 bits (75), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 18/34 (52%)

Query: 170  YRAPELLFGAKHYTSAIDIWSVGVIFAELMLRIP 203
            Y APE + G        D WSVG IF EL+L  P
Sbjct: 1153 YLAPETIEGKGEDNKQCDWWSVGCIFFELLLGYP 1186

>Kwal_55.21545
          Length = 865

 Score = 79.3 bits (194), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 52/203 (25%), Positives = 99/203 (48%), Gaps = 5/203 (2%)

Query: 3   VNMEYTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEM- 61
           V+  + + + +G G + VVY G    T +  AIK +      D ++    +E+++L  + 
Sbjct: 15  VSTLFKRTEVIGRGKFGVVYKGYYTKTKQVCAIKVLNLDSADDEVE-DVQKEIQFLSSLK 73

Query: 62  QHPNVIELIDIFMAYDNLNLVLEFLPT-DLEVVIKDKSILFTPADIKAWMLMTLRGVYHC 120
           Q PN+      ++    L +++E+     L  +++   I      I   M   L  + H 
Sbjct: 74  QVPNITHYYGSYLNDTKLWVIMEYCAGGSLRTLLRPGKI--GEQYIGVIMRELLTALMHI 131

Query: 121 HRNFILHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAK 180
           H++ ++HRD+K  N+L + DG IK+ DFG+A  +        +   T ++ APE++    
Sbjct: 132 HKDGVIHRDIKAANVLITNDGHIKLCDFGVAAQLSQTKIRRQTMAGTPYWMAPEVIMEGV 191

Query: 181 HYTSAIDIWSVGVIFAELMLRIP 203
           +Y + +DIWS+G+   E+    P
Sbjct: 192 YYDTKVDIWSLGITAYEIATGNP 214

>Scas_700.28
          Length = 896

 Score = 79.3 bits (194), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 55/185 (29%), Positives = 88/185 (47%), Gaps = 9/185 (4%)

Query: 12  KVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEMQHPNVIELID 71
           ++GEG++  VYL     T  K+ +K        D  D + +REV Y ++  +P + +L +
Sbjct: 43  QIGEGSFGKVYLAQHRPTHTKVVLKS------SDKNDPNIVREVFYHRQFDYPYITKLYE 96

Query: 72  IFMAYDNLNLVLEFLPTDLEVVIKDKSILFTPADIKAWMLMTL-RGVYHCHRNFILHRDL 130
           + +    + + LE+ P   E+  +  S+   P D    +   +  GV++ H    +HRDL
Sbjct: 97  VIITETKVWMALEYCPGK-ELYDRVLSMHRVPTDECVQLFAQIVGGVHYAHSLNCVHRDL 155

Query: 131 KPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKHYTSAIDIWS 190
           K  N+L    G  K+ DFG  R        L +   T  Y APEL+    +    IDIWS
Sbjct: 156 KLENILLDKSGDAKLTDFGFTREC-MTKTTLETICGTTVYMAPELIERKSYDGFKIDIWS 214

Query: 191 VGVIF 195
           +GVI 
Sbjct: 215 LGVIL 219

>Scas_683.12
          Length = 356

 Score = 77.8 bits (190), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 60/198 (30%), Positives = 92/198 (46%), Gaps = 13/198 (6%)

Query: 5   MEYTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEMQHP 64
           M Y+K   +  GT++ VY          +A+K +  S++  G  M+   E+  +    HP
Sbjct: 1   MTYSKLTPIQTGTFSTVYKAWSSQRNEYVALKIMPKSKYSSG-GMANEFEIMKILGRSHP 59

Query: 65  NVIELIDIFMAYDNLNLVLEFLPT----DLEVVIKDKSILFTPADIKAWMLMTLR----G 116
           N+  ++D +   +   LVLE+       D   V K +     P+ I+      LR     
Sbjct: 60  NICSMLDFYQDTNYYVLVLEYCEYGDLYDFLSVAKRQGDQIHPSTIQLDFAKVLRQISSA 119

Query: 117 VYHCHRNFILHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELL 176
           + + H   I HRD+KP N+L + +G IK+AD+G A       E   S++ T  YRAPE  
Sbjct: 120 IMYSHSLGIAHRDIKPENILLTKEGDIKLADWGHAIRDSFSKE---SHIGTDNYRAPETF 176

Query: 177 FGAKHY-TSAIDIWSVGV 193
                Y T  ID WS+GV
Sbjct: 177 DCTIEYDTFKIDYWSLGV 194

>Scas_715.34
          Length = 1150

 Score = 79.0 bits (193), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 71/262 (27%), Positives = 123/262 (46%), Gaps = 16/262 (6%)

Query: 11   KKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYL----QEMQHPNV 66
            K +G+G +  V L    +TGR  AIK +K        D+ + R  K +     + +HP +
Sbjct: 827  KVLGKGNFGKVILSRSKNTGRLCAIKVLKKDNIIQNHDIESARAEKKVFLLATKTKHPFL 886

Query: 67   IELIDIFMAYDNLNLVLEFLPT-DLEVVIKDKSILFTPADIKAWMLMTLRGVYHCHRNFI 125
              L   F   + +   +EF+   DL   ++++ +    A  K +    L  + + H N +
Sbjct: 887  TNLYCSFQTENRIYFAMEFIGGGDLMWHVQNQRLSVRRA--KFYAAEVLLALKYFHDNGV 944

Query: 126  LHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKHYTSA 185
            ++RDLK  N+L +P G IK+AD+GL +     +   ++   T  + APE+L   + YT A
Sbjct: 945  IYRDLKLENILLTPQGHIKIADYGLCKDEMWYNNKTSTFCGTPEFMAPEIL-KEQGYTRA 1003

Query: 186  IDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWPEVSSFMTYNKLQIYP 245
            +D W+ GV+  +++L      G +D D++   F A+ T    D P     M  + +QI+ 
Sbjct: 1004 VDWWAFGVLLYQMLLCQSPFSG-DDEDEV---FNAILT----DEPLYPIDMAGDIVQIFQ 1055

Query: 246  PPSRDELRKRFIAASEYALDFM 267
                 +   R  A    AL+ M
Sbjct: 1056 GLLTKDPENRLGAGQRDALEVM 1077

>KLLA0B13112g complement(1146006..1148198) similar to sp|P23561
           Saccharomyces cerevisiae YLR362w STE11 ser/thr protein
           kinase of the MEKK family, start by similarity
          Length = 730

 Score = 78.6 bits (192), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 62/264 (23%), Positives = 114/264 (43%), Gaps = 43/264 (16%)

Query: 9   KEKKVGEGTYAVVYLGCQHSTGRKIAIKEIK----------------------------- 39
           K  ++G G++  VYLG    TG  +A+K+++                             
Sbjct: 441 KGARIGSGSFGSVYLGMNAETGELMAVKQVELKPTAVTAGVVSIADESKKAHSPGGGNTA 500

Query: 40  ---TSEFKDGLDMSAIREVKYLQEMQHPNVIELIDIFMAYDNLNLVLEFLPTDLEVVIKD 96
              TS+    +  +   E+  L+E+ H N++          NLN+ LE++P      + +
Sbjct: 501 VKNTSQIHRKMIDALQHEMNILKELHHENIVTYYGSSQEGGNLNIFLEYVPGGSVSSMLN 560

Query: 97  KSILFTPADIKAWMLMTLRGVYHCHRNFILHRDLKPNNLLFSPDGQIKVADFGLARAIPA 156
               F    +K +    L G+ + H+  I+HRD+K  N+L    G +K+ DFG+++ +  
Sbjct: 561 NYGPFDEPLVKNFTRQILIGLAYLHKRNIIHRDIKGANILIDIKGGVKITDFGISKKLSP 620

Query: 157 PHEILTSNVVTR---WYRAPELLFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDVDQ 213
            ++        +   ++ APE++      T   DIWSVG +  E+       P   D  Q
Sbjct: 621 LNKQQNKRASLQGSVYWMAPEVVKQVV-TTEKADIWSVGCVIVEMFTGKHPFP---DFSQ 676

Query: 214 MEVTFRALGTPTDRDWPEVSSFMT 237
           M+  F+ +GT      PE+ S+++
Sbjct: 677 MQAIFK-IGTNI---IPEIPSWVS 696

>Kwal_23.3590
          Length = 499

 Score = 78.2 bits (191), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 69/225 (30%), Positives = 101/225 (44%), Gaps = 33/225 (14%)

Query: 7   YTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIRE-VKYLQEMQHPN 65
           Y   K++G G YA+V       +G  +A+K        D       RE  K L  +QH N
Sbjct: 186 YIAGKELGSGHYAIVKEAIDKDSGDVVAVKIFHAQHNDDQKKTKQFREETKILMSIQHKN 245

Query: 66  VIELIDIFM-----AYDNLNLVLEFLPTDLEVVIK-DKSILFTPADIKAWMLMTLRGVYH 119
           +++LID F+     A     LVLE + +D E+  +  +       +  A     L G+ +
Sbjct: 246 IVKLIDRFVEPVSKAQIQTFLVLEKV-SDGELFDRIVRKTRLREDETNAIFKQILNGLRY 304

Query: 120 CHRNFILHRDLKPNNLLFS-------------------PDGQIKVADFGLARAIPAPHEI 160
            H   I+HRD+KP N+L S                    D  IK+ADFGLA+ I    E+
Sbjct: 305 LHAKNIIHRDIKPENILLSIRKRRHSDEQQLGPWDDDEIDITIKIADFGLAKFIG---EM 361

Query: 161 LTSNVV--TRWYRAPELLFGAKHYTSAIDIWSVGVIFAELMLRIP 203
             +N +  T  Y APE+L     YTS +D+WS GV+    +   P
Sbjct: 362 QFTNTLCGTPSYVAPEVLTKTG-YTSRVDMWSAGVLLYVCLCGFP 405

>Kwal_33.14434
          Length = 759

 Score = 78.2 bits (191), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 63/210 (30%), Positives = 103/210 (49%), Gaps = 24/210 (11%)

Query: 7   YTKE-KKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIRE-VKYLQE---- 60
           YTK  + +G G    V L  +    +  A+KE +T       D  A R+ VK +      
Sbjct: 403 YTKTGENLGAGAGGSVRLVRRTQDNKLFAVKEFRTK-----FDHEAKRDYVKKITSEYCI 457

Query: 61  ---MQHPNVIELIDIFMAYDNLNL--VLEFLPTDLEVVIKDKSILFTPADIKAWMLMTLR 115
              ++HPN+IE ++I   YDN  +  V+EF   DL  ++    + +   +I       L 
Sbjct: 458 GTTLRHPNIIETVEIV--YDNNRILQVMEFCDYDLFAIVMSNKMSYE--EICCCFKQILT 513

Query: 116 GVYHCHRNFILHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHE---ILTSNVV-TRWYR 171
           GV + H   + HRDLK +N + +  G +K+ DFG A     P     + +S +V +  Y 
Sbjct: 514 GVQYLHSMGLAHRDLKLDNCVINKHGVVKLIDFGAAAVFSYPFSKTLVESSGIVGSDPYL 573

Query: 172 APELLFGAKHYTSAIDIWSVGVIFAELMLR 201
           APE+   +K+    +D+WSV +IFA ++L+
Sbjct: 574 APEVCIFSKYDPRPVDVWSVAIIFACMVLK 603

>CAGL0G09020g 860266..861351 highly similar to sp|P06245
           Saccharomyces cerevisiae YPL203w TPK2 cAMP-dependent
           protein kinase 2, catalytic chain, hypothetical start
          Length = 361

 Score = 77.4 bits (189), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 55/193 (28%), Positives = 95/193 (49%), Gaps = 11/193 (5%)

Query: 11  KKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIR----EVKYLQEMQHPNV 66
           + +G G++  V+L      GR  AIK +K ++    + M  I     E + L+ ++HP +
Sbjct: 55  RTLGTGSFGRVHLVRSVHNGRYYAIKVLKKAQV---VKMKQIEHTNDERRMLKLVEHPFL 111

Query: 67  IELIDIFMAYDNLNLVLEFLPTDLEVVIKDKSILFTPADIKAWMLMTLRGVYHCHRNFIL 126
           I +   F    NL +V++++       +  KS  F     K +       + + H + I+
Sbjct: 112 IRMWGTFQDSRNLFMVMDYIEGGELFTLLRKSQRFPNPVAKFYAAEVTLALEYLHFHNII 171

Query: 127 HRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKHYTSAI 186
           +RDLKP N+L   +G IK+ DFG A+ +      L     T  Y APE++   K Y  ++
Sbjct: 172 YRDLKPENILLDRNGHIKITDFGFAKEVETVTWTLCG---TPDYIAPEVI-ATKPYNKSV 227

Query: 187 DIWSVGVIFAELM 199
           D WS+GV+  E++
Sbjct: 228 DWWSLGVLIYEML 240

>Scas_660.20
          Length = 957

 Score = 78.2 bits (191), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 58/218 (26%), Positives = 105/218 (48%), Gaps = 16/218 (7%)

Query: 10  EKKVGEGTYAVVYLGC-QHSTGRKIAIKEIKTSEFKDGLDMSAIREV-------KYLQEM 61
           ++++G G+Y+ VY    + +T R  AIK    +     +  S ++ V         L + 
Sbjct: 14  KEELGHGSYSTVYKAIDKRNTKRIFAIKVCSKAHI---IKESKVKYVTIEKNTLNLLAKA 70

Query: 62  QHPNVIELIDIFMAYDNLNLVLEFLPTDLEVVIKDKSILFTPADIKAWMLMTLRGVYHCH 121
            HP +++L   F   +NL  VL++LP    + +  K   F+    K + +  +  +   H
Sbjct: 71  HHPGIVKLYYTFHDEENLYYVLDYLPGGELLSLLHKMKTFSEVWSKHFTVQLVDTLEFIH 130

Query: 122 RNFILHRDLKPNNLLFSPDGQIKVADFGLARAIPA----PHEILTSNVVTRWYRAPELLF 177
              ++HRDLKP N+L   DG++ + DFG A    A     ++  +S V T  Y +PELL 
Sbjct: 131 SQGVIHRDLKPENVLLDRDGKLMITDFGAAYTTTAGNNDANKSSSSFVGTAEYVSPELLL 190

Query: 178 GAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDVDQME 215
             +   S+ D+W++G +  + +   P   G+N++   E
Sbjct: 191 HNQCSFSS-DVWALGCMIFQFVTGSPPFRGENELKTFE 227

>Kwal_56.24059
          Length = 353

 Score = 77.0 bits (188), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 54/193 (27%), Positives = 94/193 (48%), Gaps = 11/193 (5%)

Query: 11  KKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIR----EVKYLQEMQHPNV 66
           + +G G++  V+L      GR  AIK +K  +    + M  I     E + L+ + HP +
Sbjct: 47  RTLGTGSFGRVHLVRSVHNGRYYAIKVLKKEQV---IRMKQIEHTNDERRMLKLVDHPFL 103

Query: 67  IELIDIFMAYDNLNLVLEFLPTDLEVVIKDKSILFTPADIKAWMLMTLRGVYHCHRNFIL 126
           I +   F    NL +V++++       +  KS  F     K +    +  + + H + I+
Sbjct: 104 IRMWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVILALEYLHSHDII 163

Query: 127 HRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKHYTSAI 186
           +RDLKP N+L   +G IK+ DFG A+ +      L     T  Y APE++   K Y  ++
Sbjct: 164 YRDLKPENILLDRNGHIKITDFGFAKEVDTVTWTLCG---TPDYIAPEVI-ATKPYNKSV 219

Query: 187 DIWSVGVIFAELM 199
           D WS+G++  E++
Sbjct: 220 DWWSLGILIFEML 232

>Scas_690.13
          Length = 354

 Score = 77.0 bits (188), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 55/193 (28%), Positives = 94/193 (48%), Gaps = 11/193 (5%)

Query: 11  KKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIR----EVKYLQEMQHPNV 66
           + +G G++  V+L      GR  AIK +K  +    + M  I     E + L+ ++HP +
Sbjct: 48  RTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQV---VRMKQIEHTNDERRMLKLVEHPFL 104

Query: 67  IELIDIFMAYDNLNLVLEFLPTDLEVVIKDKSILFTPADIKAWMLMTLRGVYHCHRNFIL 126
           I +   F    NL +V++++       +  KS  F     K +      G+ + H + I+
Sbjct: 105 IRMWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVTLGLEYLHSHNII 164

Query: 127 HRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKHYTSAI 186
           +RDLKP N+L   +G IK+ DFG A+ +      L        Y APE++   K Y  ++
Sbjct: 165 YRDLKPENILLDRNGHIKITDFGFAKEVDTVTWTLCGPPD---YIAPEVI-ATKPYNKSV 220

Query: 187 DIWSVGVIFAELM 199
           D WS+GV+  E++
Sbjct: 221 DWWSLGVLIFEML 233

>Kwal_26.8751
          Length = 848

 Score = 77.8 bits (190), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 63/225 (28%), Positives = 111/225 (49%), Gaps = 20/225 (8%)

Query: 11  KKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEMQHPNVIELI 70
           K VGEG++  VYL     T +K+ +K           D + +REV Y ++  + ++ +L 
Sbjct: 41  KIVGEGSFGKVYLASHCLTHQKVVLK------MGSKNDPNVVREVFYHRQFDYSHITKLY 94

Query: 71  DIFMAYDNLNLVLEFLPTD--LEVVIKDKSILFTPADIKAWMLMTLRG-VYHCHRNFILH 127
           ++ +  + + + LE+ P     E ++  K I   P +  + +   + G VY+ H    +H
Sbjct: 95  EVIVTENYVWMALEYCPGKELYEYLLAKKHI---PLEECSELFSQIVGAVYYAHSMKCVH 151

Query: 128 RDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKHYTSAID 187
           RDLK  N+L    G  K+ DFG  R   A   IL +   T  Y APEL+    +    ID
Sbjct: 152 RDLKLENILLDKKGHAKLTDFGFTREC-ATKGILETICGTTVYMAPELIERKPYEGYKID 210

Query: 188 IWSVGVI-FAELMLRIPYLPGQNDVDQMEVTFRALG-TPT-DRDW 229
            WS+G+I +  +   +P+    ++VD+++  ++ +   PT D D+
Sbjct: 211 TWSLGIILYTMIHGTMPF----DEVDEVKTKYKIVHYNPTYDNDY 251

>ACR119W [1166] [Homologous to ScYPL141C - SH; ScYOR233W (KIN4) -
           SH] complement(560761..563556) [2796 bp, 931 aa]
          Length = 931

 Score = 77.8 bits (190), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 68/264 (25%), Positives = 123/264 (46%), Gaps = 27/264 (10%)

Query: 13  VGEGTYAVVYLGCQHST----GRKIAIKEIK--TSEFKDGLDMSAIREVKYLQEMQHPNV 66
           +GEG +  V LG   +      R +AIK I+  T       ++   RE+  L+ + HPN+
Sbjct: 51  LGEGEFGKVKLGWSKARLDGDSRNVAIKLIRRDTVPKNSEKEIKIYRELNALKLLSHPNI 110

Query: 67  IELIDIFMAYDNLNLVLEFLPT-DLEVVIKDKSILFTPADIKAWMLMTLRGVYHCHRNFI 125
           + L ++      + +VL++    +    I+ K  L  P   + +  + + GV++ H   +
Sbjct: 111 VRLEEVLQNSKYIGIVLQYASGGEFYKYIQKKRRLKEPPACRLFAQL-ISGVHYIHYKGL 169

Query: 126 LHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKHYTS- 184
            HRDLK  NLL      + + DFG        ++++ ++  +  Y APEL+  +K Y++ 
Sbjct: 170 AHRDLKLENLLLDEHENLIITDFGFVNEF-HKNDLMRTSCGSPCYAAPELVVSSKPYSAQ 228

Query: 185 AIDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWPEVSSFMTYNKLQ-- 242
             D+WS GVI   ++    YLP  +D +           P   D  ++  ++T+  L+  
Sbjct: 229 KADVWSCGVILYAMLAG--YLPWDDDPE----------NPEGEDIAKLYQYITHTSLKFP 276

Query: 243 --IYPPPSRDELRKRFIAASEYAL 264
             I P P RD L++  ++  E  L
Sbjct: 277 EYIKPIP-RDLLKRILVSNPEVRL 299

>AFR335C [3527] [Homologous to ScYOL100W (PKH2) - SH; ScYDR490C
           (PKH1) - SH] (1046762..1049863) [3102 bp, 1033 aa]
          Length = 1033

 Score = 77.8 bits (190), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 62/216 (28%), Positives = 100/216 (46%), Gaps = 25/216 (11%)

Query: 13  VGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKY----------LQEMQ 62
           +G+G+Y+ V L     +G+K A K I   E+     +   ++VKY          L   +
Sbjct: 206 LGDGSYSTVVLATCIESGKKYAAK-ILNKEY-----LIKQKKVKYVNIEKNTLQRLNSSR 259

Query: 63  HPNVIELIDIFMAYDNLNLVLEFLPTDLEVVIKDKSILFTPADIKAWMLMTLRGVYHCHR 122
            P VI+L   F    NL  +LE+ P    + +  +    +    K +    L  ++H H+
Sbjct: 260 VPGVIKLYFTFQDEANLYFLLEYAPNGDFLSVMKRFGTLSEECTKYYGAQILDAIHHLHK 319

Query: 123 NFILHRDLKPNNLLFSPDGQIKVADFGLARAIP-----APHEILT---SNVVTRWYRAPE 174
             I+HRD+KP N+L     +IK+ DFG A+ I       P+++ T   S V T  Y +PE
Sbjct: 320 QGIIHRDVKPENILLDKTMKIKLTDFGTAKLIGREDENKPYDLNTRSKSFVGTAEYVSPE 379

Query: 175 LLFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQND 210
           LL    +  S  DIW+ G I  +++   P     N+
Sbjct: 380 LL-NDNYVDSRCDIWAFGCILFQMVAGKPPFKATNE 414

>Kwal_33.14167
          Length = 838

 Score = 77.0 bits (188), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 89/309 (28%), Positives = 132/309 (42%), Gaps = 54/309 (17%)

Query: 6   EYTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEMQ-HP 64
           EY K + +G G  + VY     +  +  A+K +   EF D        E++ L++++  P
Sbjct: 514 EYEKLELLGRGGTSKVYKVKNANNNKVYALKRVSFDEFDDSSIDGFKGEIELLKKLETQP 573

Query: 65  NVIELIDIFMAYDNLNLVLEFLPTDLEVVIKDKSILFTPADI---KAWMLMTLRGVYHCH 121
            V++LID  M +  L +V+E    DL   +  +S +  P D+   +      L+ V   H
Sbjct: 574 RVVKLIDHEMDHGVLYVVMECGDHDLSQTLAHRSGM--PLDVEFVRYHAQEMLKCVKVVH 631

Query: 122 RNFILHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEI---LTSNVVTRWYRAPELLFG 178
              I+H DLKP N +F   G +K+ DFG+A A+P  H +     + + T  Y APE L  
Sbjct: 632 DAGIVHSDLKPANFVFV-KGILKIIDFGIANAVPE-HTVNIYRETQIGTPNYMAPEALV- 688

Query: 179 AKHYT-------------SAIDIWSVGVIFAELML-RIPY--LPGQNDVDQMEVTFRALG 222
           A +YT                DIWS G I  +++  R PY    GQN         R L 
Sbjct: 689 AMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQN---------RLLA 739

Query: 223 TPTDRDWPEVSSFMTYNKLQIYPPPSRDELRKRFIAASEYALDFMCGMLTMNPQKRWTAV 282
                  PEV       K+ +YP     E         + A+D M   L  NP KRWT  
Sbjct: 740 IMN----PEV-------KI-VYP-----EKTSNGDTVPKTAIDTMKACLERNPNKRWTVE 782

Query: 283 QCLESDYFK 291
           +     + K
Sbjct: 783 EVANGSFVK 791

>CAGL0M09361g complement(928484..931918) highly similar to sp|P24583
            Saccharomyces cerevisiae YBL105c PKC1 ser/thr protein
            kinase, start by similarity
          Length = 1144

 Score = 77.0 bits (188), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 71/262 (27%), Positives = 119/262 (45%), Gaps = 16/262 (6%)

Query: 11   KKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYL----QEMQHPNV 66
            K +G+G +  V L    +T R  AIK +K        D+ + R  K +     + +HP +
Sbjct: 821  KVLGKGNFGKVILSRSKNTNRLCAIKVLKKDNIIQNHDIESARAEKKVFLLATKTKHPFL 880

Query: 67   IELIDIFMAYDNLNLVLEFLPT-DLEVVIKDKSILFTPADIKAWMLMTLRGVYHCHRNFI 125
              L   F   + +   +EF+   DL   ++++ +    A  K +    L  +   H N +
Sbjct: 881  TNLYCSFQTENRIYFAMEFIGGGDLMWHVQNQRLSVRRA--KFYAAEVLLALKFFHDNGV 938

Query: 126  LHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKHYTSA 185
            ++RDLK  N+L +P+G IK+AD+GL +         ++   T  + APELL   + YT A
Sbjct: 939  IYRDLKLENILLTPEGHIKIADYGLCKDGMWYGNKTSTFCGTPEFMAPELL-REQDYTKA 997

Query: 186  IDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWPEVSSFMTYNKLQIYP 245
            +D W+ GV+  +++L      G    D  +  F A+ T    D P     M  + +QI+ 
Sbjct: 998  VDWWAFGVLLYQMLLCQSPFSG----DDEDEVFNAILT----DEPLYPIDMAGDIVQIFQ 1049

Query: 246  PPSRDELRKRFIAASEYALDFM 267
                 +  KR  A    AL+ M
Sbjct: 1050 GLLTKDPEKRLGAGPRDALEIM 1071

>AFR724C [3917] [Homologous to ScYDR523C (SPS1) - SH]
           (1769897..1771219) [1323 bp, 440 aa]
          Length = 440

 Score = 76.6 bits (187), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 76/291 (26%), Positives = 130/291 (44%), Gaps = 49/291 (16%)

Query: 13  VGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEMQHPNVIE---- 68
           +G G +  VY     ++   +AIK +   +  + +D+ A +E+ +L E++ P +      
Sbjct: 26  IGRGNFGDVYKARDLTSNEIVAIKVVNLEDTDEPIDLLA-QEIFFLSELRSPYITNYKTA 84

Query: 69  -LID----IFMAYDNLNLVLEFLPTDLEVVIKDKSILFTPADIKAWMLMTLRGVYHCHRN 123
            L+D    I M Y       E L    E  + ++   F  +++       L G+ + H  
Sbjct: 85  FLVDVSMWIVMEYCGGGSCAELLKYTPEHKVTEEQCAFIVSEV-------LIGLDYLHSQ 137

Query: 124 FILHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKH-Y 182
             +HRD+K  N+L + +G +K+ DFG++  +    +  T  V T ++ APE++   K  Y
Sbjct: 138 RKIHRDIKSANILLTDNGHVKLGDFGVSGQMMVTRKRDTF-VGTPFWMAPEVIDRNKQGY 196

Query: 183 TSAIDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWPEVSSFMTYNKLQ 242
               DIWS+G+   EL++  P L   +  D M    +AL     RD              
Sbjct: 197 NEMADIWSLGITVIELLMGHPPL---DKYDAM----KALMAIPKRD-------------- 235

Query: 243 IYPPPSRDELRKRFIAASEYALDFMCGMLTMNPQKRWTAVQCLESDYFKEL 293
              PP  D   KRF   S +A DF+   L  +P +R TA + L+  + K +
Sbjct: 236 ---PPKLD---KRF---SSHARDFVAQCLIKDPSQRPTAAELLKHRFVKRV 277

>AFL090W [3103] [Homologous to ScYPL203W (TPK2) - SH]
           complement(274336..275376) [1041 bp, 346 aa]
          Length = 346

 Score = 75.9 bits (185), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 55/193 (28%), Positives = 94/193 (48%), Gaps = 11/193 (5%)

Query: 11  KKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIR----EVKYLQEMQHPNV 66
           + +G G++  V+L      GR  AIK +K  +    + M  I     E + L+ ++HP +
Sbjct: 40  RTLGTGSFGRVHLVRSIHNGRYYAIKVLKKQQV---IRMKQIEHTNDERRMLKVVEHPFL 96

Query: 67  IELIDIFMAYDNLNLVLEFLPTDLEVVIKDKSILFTPADIKAWMLMTLRGVYHCHRNFIL 126
           I +   F    NL +V++++       +  KS  F     K +       + + H + I+
Sbjct: 97  IRMWGTFQDARNLFIVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVTLALEYLHAHNII 156

Query: 127 HRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKHYTSAI 186
           +RDLKP N+L   +G IK+ DFG A+ +      L     T  Y APE++   K Y  +I
Sbjct: 157 YRDLKPENILLDRNGHIKITDFGFAKEVDTVTWTLCG---TPDYIAPEVI-TTKPYNKSI 212

Query: 187 DIWSVGVIFAELM 199
           D WS+G++  E++
Sbjct: 213 DWWSLGILIFEML 225

>Scas_707.7
          Length = 376

 Score = 76.3 bits (186), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 57/221 (25%), Positives = 98/221 (44%), Gaps = 49/221 (22%)

Query: 116 GVYHCHRNFILHRDLKPNNLLFS--PDGQIK--VADFGLARAIPAPHEIL-------TSN 164
           G+   H   I+HRD+KP N++     DG I   + DFG++    AP + L        ++
Sbjct: 151 GINSIHEQKIIHRDIKPQNVMLEIHDDGSISLLITDFGISYDHEAPADKLREPPLQKITD 210

Query: 165 VVTRWYRAPELLFGAKHYTSAIDIWSVGVIFAELMLR-------IP--------YLPGQN 209
           V T +Y++PELLFG K+Y   +DIW++ V+ ++   +       +P         L   +
Sbjct: 211 VSTSFYKSPELLFGIKNYEFEVDIWALLVLLSQFFQKETNIENFVPSMFDDGSGVLDSGS 270

Query: 210 DVDQMEVTFRALGTPTDRDWPEVSSFMTYNKLQIYPPPSRD---------ELRKRFI--- 257
           D+  +   F  +GTP  +DWP+V  + + +          D         E +KR +   
Sbjct: 271 DIRLIFSIFEMVGTPGVKDWPKVIEYGSKDAFVGMFGEKGDGRYILHESFENQKRRVLND 330

Query: 258 -----------AASEYALDFMCGMLTMNPQKRWTAVQCLES 287
                            +D + GM+    ++RW++ Q LES
Sbjct: 331 WMPRLYELNNETQKNTLIDCILGMVPFASEQRWSSKQLLES 371

>Kwal_27.9763
          Length = 868

 Score = 76.6 bits (187), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 55/208 (26%), Positives = 102/208 (49%), Gaps = 11/208 (5%)

Query: 7   YTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEMQHPNV 66
           Y  ++ VG+G Y +VY      T +++AIK I+  E +       + E+  L+ ++H N+
Sbjct: 23  YALKQVVGKGAYGIVYRAINRQTHKQVAIKVIEYDEEE--ELNEHMLEIDLLKNLKHENI 80

Query: 67  IELIDIFMAYDNLNLVLEFLPT-DLEVVIKDKSILFTPADIKAWMLMTLRGVYHCHRNFI 125
           ++          L ++LE+     L  +IK   +       K ++  TL G+ + H   +
Sbjct: 81  VKYHGFIQKSHQLFILLEYCSQGSLRDLIKRGPV--EEQQCKTYIRQTLHGLKYLHDQGV 138

Query: 126 LHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKHYTSA 185
           +HRD+K  NLL      +K+ADFG++  +   + +  +   +  + APE++ G    T +
Sbjct: 139 IHRDIKAANLLLDAQNVVKLADFGVSTRV---NNLAMTYAGSPNWMAPEVMMGQGASTVS 195

Query: 186 IDIWSVGVIFAELMLRIPYLPGQNDVDQ 213
            DIWS+G    E++   P  P  N V++
Sbjct: 196 -DIWSLGATVVEILTGNP--PFHNLVNE 220

>YDL025C (YDL025C) [836] chr4 complement(405341..407203)
           Serine/threonine protein kinase with similarity to
           members of the NPR1 subfamily [1863 bp, 620 aa]
          Length = 620

 Score = 76.3 bits (186), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 57/204 (27%), Positives = 97/204 (47%), Gaps = 16/204 (7%)

Query: 11  KKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKD-GLDMSAI--------REVKYLQEM 61
           +K+GEG    V +  + + G+  A K  +     + G + S +         E      +
Sbjct: 306 RKLGEGASGSVSV-VERTDGKLFACKMFRKPHLNNEGTNQSQLANYSKKVTTEFCIGSTL 364

Query: 62  QHPNVIELIDIFMAYDNLNLVLEFLPTDLEVVIKDKSILFTPADIKAWMLMTLRGVYHCH 121
            H N++E +D+    D   LV+E+ P D   ++   S L T  ++  +      GV + H
Sbjct: 365 HHENIVETLDMLTEGDTYLLVMEYAPYDFFNLVM--SNLMTQDEVNCYFKQLCHGVNYLH 422

Query: 122 RNFILHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHE--ILTSN--VVTRWYRAPELLF 177
              + HRDLK +N + + DG +K+ DFG A     P+E  I+ S+  V +  Y APELL 
Sbjct: 423 SMGLAHRDLKLDNCVVTKDGILKLIDFGSAVVFQYPYEDTIVKSHGIVGSDPYLAPELLK 482

Query: 178 GAKHYTSAIDIWSVGVIFAELMLR 201
              +     D+WS+ +IF  ++L+
Sbjct: 483 QTSYDPRVADVWSIAIIFYCMVLK 506

>YBL105C (PKC1) [98] chr2 complement(14241..17696) Protein kinase C,
            regulates MAP kinase cascade involved in regulating cell
            wall metabolism [3456 bp, 1151 aa]
          Length = 1151

 Score = 76.6 bits (187), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 54/195 (27%), Positives = 97/195 (49%), Gaps = 8/195 (4%)

Query: 11   KKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYL----QEMQHPNV 66
            K +G+G +  V L    +T R  AIK +K        D+ + R  K +     + +HP +
Sbjct: 828  KVLGKGNFGKVILSKSKNTDRLCAIKVLKKDNIIQNHDIESARAEKKVFLLATKTKHPFL 887

Query: 67   IELIDIFMAYDNLNLVLEFLPT-DLEVVIKDKSILFTPADIKAWMLMTLRGVYHCHRNFI 125
              L   F   + +   +EF+   DL   ++++ +    A  K +    L  + + H N +
Sbjct: 888  TNLYCSFQTENRIYFAMEFIGGGDLMWHVQNQRLSVRRA--KFYAAEVLLALKYFHDNGV 945

Query: 126  LHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKHYTSA 185
            ++RDLK  N+L +P+G IK+AD+GL +         ++   T  + APE+L   + YT A
Sbjct: 946  IYRDLKLENILLTPEGHIKIADYGLCKDEMWYGNRTSTFCGTPEFMAPEIL-KEQEYTKA 1004

Query: 186  IDIWSVGVIFAELML 200
            +D W+ GV+  +++L
Sbjct: 1005 VDWWAFGVLLYQMLL 1019

>KLLA0D07348g 626999..629728 weakly similar to sgd|S0006062
           Saccharomyces cerevisiae YPL141c, start by similarity
          Length = 909

 Score = 76.3 bits (186), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 52/194 (26%), Positives = 93/194 (47%), Gaps = 8/194 (4%)

Query: 13  VGEGTYAVVYLGCQHSTG---RKIAIKEIKTSEFKDGLD--MSAIREVKYLQEMQHPNVI 67
           +GEG +  V LG   S     + +AIK I+        +  +   RE+  L+ + HPN++
Sbjct: 62  LGEGEFGKVKLGWSKSNSDESKNVAIKLIRRDTIPKNSEKEVKIYREINALKHLAHPNIV 121

Query: 68  ELIDIFMAYDNLNLVLEFLPT-DLEVVIKDKSILFTPADIKAWMLMTLRGVYHCHRNFIL 126
            L ++      + +VL +    +    I+ K  L  PA  + +  + + GV++ H   + 
Sbjct: 122 TLEEVLQNSKYIGIVLHYASGGEFYKYIQKKRRLKEPAACRLFAQL-ISGVHYMHHKGLA 180

Query: 127 HRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKHYTS-A 185
           HRDLK  NLL      + + DFG      + ++++ ++  +  Y APEL+   K Y +  
Sbjct: 181 HRDLKLENLLLDEHENLIITDFGFVNEFSSRNDLMKTSCGSPCYAAPELVVTTKAYEARK 240

Query: 186 IDIWSVGVIFAELM 199
            D+WS GVI   ++
Sbjct: 241 ADVWSCGVILYAML 254

>Scas_685.24
          Length = 515

 Score = 75.9 bits (185), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 55/209 (26%), Positives = 105/209 (50%), Gaps = 19/209 (9%)

Query: 7   YTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEMQHPNV 66
           Y  ++ VG G +  VY     +T + +AIK +      + L++ A +E+ +L E++ P +
Sbjct: 22  YIVKECVGRGNFGDVYRAIDRTTNKVVAIKVVDLENTNERLEVLA-QEIFFLAELKSPYI 80

Query: 67  IELIDIFMAYDNLNLVLEFLP----TDL-----EVVIKDKSILFTPADIKAWMLMTLRGV 117
           I  I   +   ++ +V+E+      +DL        + +K + +   +I       L+G+
Sbjct: 81  INYITTLLEDASMWIVMEYCGGGSCSDLLKYYFNNGLPEKKVAYITREI-------LKGL 133

Query: 118 YHCHRNFILHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLF 177
            + H    +HRD+K  N+L + +G +K+ DFG++  + +     T  V T ++ APE+  
Sbjct: 134 QYLHEQKKIHRDIKAANILLTEEGHVKLGDFGVSGQLKSTLRRGTI-VGTPYWMAPEVAS 192

Query: 178 -GAKHYTSAIDIWSVGVIFAELMLRIPYL 205
              + Y   IDIWS+G+   EL+  +P L
Sbjct: 193 QNIEGYDEKIDIWSLGITVFELLKGVPPL 221

>CAGL0L06006g complement(670707..673535) similar to sp|P53104
           Saccharomyces cerevisiae YGL180w APG1 essential for
           autophagocytosis, hypothetical start
          Length = 942

 Score = 76.3 bits (186), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 75/323 (23%), Positives = 135/323 (41%), Gaps = 82/323 (25%)

Query: 6   EYTKEKKVGEGTYAVVYLGCQHST---GRKIAIKEIKTSEFKDGLDMSAIR-EVKYLQEM 61
           +Y  EK++G+G++A VY G  H T      IA+K +  S+ K+   +  +  E+  L+++
Sbjct: 10  KYVVEKEIGKGSFATVYRG--HVTTDPKSHIAVKAVARSKLKNKKLLENLEIEIAILKKI 67

Query: 62  QHPNVIELIDIFMAYDNLNLVLEFLP-TDLEVVIKDKSIL-------------------- 100
           +HP+++ LID      +  LV+++    DL  +IK +  L                    
Sbjct: 68  KHPHIVGLIDCERTTTDFYLVMDYCALGDLTFLIKKRKELENNHPLLQTVFNKYPPPSKE 127

Query: 101 ---FTPADIKAWMLMTLRGVYHCHRNFILHRDLKPNNLLFSP------DGQ--------- 142
                 A +  ++      +       ++HRD+KP NLL +       D +         
Sbjct: 128 HNGLNRAFVVCYLQQLASALKFLRSKNLVHRDIKPQNLLLATPLTNYRDSKTFHELGYVG 187

Query: 143 ------IKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKHYTSAIDIWSVGVIFA 196
                 +K+ADFG AR +P+   +  +   +  Y APE+L   + Y +  D+WSVG +  
Sbjct: 188 IYNLPILKIADFGFARFLPST-SLAETLCGSPLYMAPEIL-NYQKYNAKADLWSVGTVLF 245

Query: 197 ELMLRIPYLPGQNDVDQMEVTFRALGTPTDR-DWPEVSSFMTYNKLQIYPPPSRDELRKR 255
           E+   +P     N ++     F+ +    D  ++PEV                 D L+  
Sbjct: 246 EMCCGVPPFTASNHLE----LFKKIKRAHDEINFPEVCEV-------------EDGLK-- 286

Query: 256 FIAASEYALDFMCGMLTMNPQKR 278
                    + +C +LT +P KR
Sbjct: 287 ---------ELICSLLTFDPAKR 300

>CAGL0J03872g 365869..367854 similar to sp|Q01919 Saccharomyces
           cerevisiae YOR233w KIN4 ser/thr protein kinase or
           tr|Q03002 Saccharomyces cerevisiae YPL141c, start by
           similarity
          Length = 661

 Score = 75.9 bits (185), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 58/217 (26%), Positives = 100/217 (46%), Gaps = 17/217 (7%)

Query: 13  VGEGTYAVVYLGCQH--STG--------RKIAIKEIKTSEF--KDGLDMSAIREVKYLQE 60
           +GEG +  V LG     STG        +++AIK I+          ++   RE+  L+ 
Sbjct: 50  LGEGEFGKVKLGWTRTPSTGPEQRPAVSKQVAIKLIRRDTIVKNSEKEIKIYREINALKH 109

Query: 61  MQHPNVIELIDIFMAYDNLNLVLEFLPT-DLEVVIKDKSILFTPADIKAWMLMTLRGVYH 119
           + HPNV+ L ++      + +VLE+    +    I+ K  L      + +  + + GV +
Sbjct: 110 LTHPNVVRLEEVLQNSKYIGIVLEYASGGEFYKYIQRKRRLKESTACRLFAQL-ISGVTY 168

Query: 120 CHRNFILHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGA 179
            H   ++HRDLK  NLL   +  + + DFG        +E + ++  +  Y APEL+   
Sbjct: 169 MHSKNLVHRDLKLENLLLDKNENLVITDFGFVNEFLPDNEYMKTSCGSPCYAAPELVIST 228

Query: 180 KHYTS-AIDIWSVGVIFAELMLRIPYLPGQNDVDQME 215
           + Y +   D+WS G+I   ++    YLP  +D    E
Sbjct: 229 RPYVARKADVWSCGIILYAML--AGYLPWDDDSTNPE 263

>KLLA0D03190g 267933..269051 highly similar to sp|P06245
           Saccharomyces cerevisiae YPL203w TPK2 cAMP-dependent
           protein kinase 2, catalytic chain, start by similarity
          Length = 372

 Score = 75.1 bits (183), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 54/193 (27%), Positives = 94/193 (48%), Gaps = 11/193 (5%)

Query: 11  KKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIR----EVKYLQEMQHPNV 66
           + +G G++  V+L      GR  AIK +K  +    + M  I     E + L+ ++HP +
Sbjct: 66  RTLGTGSFGRVHLVRSVHNGRYYAIKVLKKHQI---IRMKQIEHTNDERRMLKLVEHPFL 122

Query: 67  IELIDIFMAYDNLNLVLEFLPTDLEVVIKDKSILFTPADIKAWMLMTLRGVYHCHRNFIL 126
           I +   F    NL +V++++       +  KS  F     K +       + + H + I+
Sbjct: 123 IRMWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVTLALEYLHSHNII 182

Query: 127 HRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKHYTSAI 186
           +RDLKP N+L   +G IK+ DFG A+ +      L     T  Y APE++   K Y  ++
Sbjct: 183 YRDLKPENILLDRNGHIKITDFGFAKEVITVTWTLCG---TPDYIAPEVI-TTKPYNKSV 238

Query: 187 DIWSVGVIFAELM 199
           D WS+G++  E++
Sbjct: 239 DWWSLGILIFEML 251

>ADR317C [2058] [Homologous to ScYDL028C (MPS1) - SH]
           (1263082..1265541) [2460 bp, 819 aa]
          Length = 819

 Score = 75.9 bits (185), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 92/316 (29%), Positives = 140/316 (44%), Gaps = 64/316 (20%)

Query: 6   EYTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEMQHPN 65
           EY K + +G G  + VY   ++S+ R  A+K +   EF D        E++ L+++++  
Sbjct: 491 EYEKVELLGRGGSSKVY-KVRNSSNRIYALKRVSFDEFDDASADGFKGEIELLKKLENQT 549

Query: 66  -VIELIDIFMAYDNLNLVLEFLPTDLEVVIKDKSILFTPADI---KAWMLMTLRGVYHCH 121
            V++LID  M +  L +V+E    DL  V+  +S +  P DI   +      L+ V   H
Sbjct: 550 RVVKLIDHEMNHGVLYVVMECGDHDLSQVLAQRSSM--PLDIEFVRYHAQEMLKCVKVVH 607

Query: 122 RNFILHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEI---LTSNVVTRWYRAPELLFG 178
              I+H DLKP N +F   G +K+ DFG+A A+P  H +     + + T  Y APE L  
Sbjct: 608 DAGIVHSDLKPANFVFV-KGILKIIDFGIANAVPD-HTVNIYRDTQIGTPNYMAPEALV- 664

Query: 179 AKHYTS------------------AIDIWSVGVIFAELML-RIPY--LPGQNDVDQMEVT 217
           A +YT                     DIWS G I  +++  + PY    GQN        
Sbjct: 665 AMNYTQDSDQIQQEMHHNRWKVGKPSDIWSCGCIMYQMIYGKPPYGSFQGQN-------- 716

Query: 218 FRALGTPTDRDWPEVSSFMTYNKLQIYP--PPSRDELRKRFIAASEYALDFMCGMLTMNP 275
            R L        PEV          +YP   P+ D     F+  +  ALD +   L  NP
Sbjct: 717 -RLLAIMN----PEVKI--------VYPEKTPTGD-----FVPRT--ALDTIKACLERNP 756

Query: 276 QKRWTAVQCLESDYFK 291
           ++RWT  + L   + K
Sbjct: 757 ERRWTVDELLRGPFIK 772

>CAGL0I06248g 600351..602792 similar to sp|P38970 Saccharomyces
           cerevisiae YJL165c HAL5 ser/thr protein kinase, start by
           similarity
          Length = 813

 Score = 75.9 bits (185), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 64/247 (25%), Positives = 105/247 (42%), Gaps = 43/247 (17%)

Query: 64  PNVIELIDIFMAYDNLNLVLEFLPT-DLEVVIKDKSIL------FTPADIKAWMLMTLRG 116
           PN++ +ID+    +    V+E  P  DL  ++  +S          P +   +M   LRG
Sbjct: 579 PNILRVIDLMETNNTFIEVMELCPAGDLHSLLVSRSQSGNAIGSLHPLEADCFMKQLLRG 638

Query: 117 VYHCHRNFILHRDLKPNNLLFSPDGQIKVADFGLARAIPAP---HEILTSNVV-TRWYRA 172
           V + H + I H DLKP NLLF P+G +K+ DFG +         H    + V+ +  Y A
Sbjct: 639 VQYMHDHGIAHCDLKPENLLFHPNGLLKICDFGTSSVFQTAWEKHVHFQNGVIGSEPYVA 698

Query: 173 PELLFGAKHYT-SAIDIWSVGVIFAELMLRIPYLPGQ-------NDVDQMEVTFRALGTP 224
           PE+    K Y    ID WS G+++  ++       GQ        + D +  +F      
Sbjct: 699 PEVFQLGKDYDPRLIDCWSCGIVYCTMVF------GQYLWKIAIENKDSLYASF------ 746

Query: 225 TDRDWPEVSSFMTYNKLQIYPPPSRDELRKRFIAASEYALDFMCGMLTMNPQKRWTAVQC 284
                  +S     N+  ++     +ELR      ++   + +  M   NP+KR T  + 
Sbjct: 747 -------ISQMKDENQFSLF-----EELRHVNADLNKLRKNVLYNMFQTNPEKRITVDKI 794

Query: 285 LESDYFK 291
           L S + K
Sbjct: 795 LHSSWMK 801

>CAGL0E05720g 569028..570104 similar to sp|P38991 Saccharomyces
           cerevisiae YPL209c IPL1 ser/thr protein kinase, start by
           similarity
          Length = 358

 Score = 74.7 bits (182), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 60/223 (26%), Positives = 111/223 (49%), Gaps = 10/223 (4%)

Query: 11  KKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSE-FKDGLDMSAIREVKYLQEMQHPNVIEL 69
           +K+G+G +  VY      +G   A+K I+ +E  +  L     REV     M HPN+I+L
Sbjct: 104 RKLGKGKFGKVYCVRHKKSGFICALKAIEKNEILQFNLLKQLKREVDIQLGMDHPNIIKL 163

Query: 70  IDIFMAYDNLNLVLEF-LPTDLEVVIKDKSILFTPADIKAWMLMTLRGVYHCHRNFILHR 128
              F     + L++E  +  +L   +K+    F       ++      +++ H+  I+HR
Sbjct: 164 YAHFHDEKRVYLLMEHSINGELYKSLKNNGP-FNDVLASHYIYQIADALHYMHKKRIIHR 222

Query: 129 DLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKHYTSAIDI 188
           D+KP N+L   D  +K+ADFG +   P   +  T    T  Y +PE++   + Y   +D+
Sbjct: 223 DVKPENVLIGFDNVVKLADFGWSILNPEGSKRKTL-CGTIDYLSPEMI-TPREYDEQVDV 280

Query: 189 WSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWPE 231
           W++GV+  EL++ +P      + +  E+T++ +    D ++PE
Sbjct: 281 WALGVLAYELVVGVPPF----EENSKELTYKRI-LKCDLNFPE 318

>ACR191C [1238] [Homologous to ScYBL105C (PKC1) - SH] (680398..683847)
            [3450 bp, 1149 aa]
          Length = 1149

 Score = 75.9 bits (185), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 71/266 (26%), Positives = 122/266 (45%), Gaps = 24/266 (9%)

Query: 11   KKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYL----QEMQHPNV 66
            K +G+G +  V L    +T R  AIK +K        D+ + R  K +     + +HP +
Sbjct: 826  KVLGKGNFGKVLLARSKNTDRLCAIKVLKKDHIIQNHDIESARAEKKVFLLATKAKHPFL 885

Query: 67   IELIDIFMAYDNLNLVLEFLPT-DLEVVIKDKSILFTPADIKAWMLMTLRGVYHCHRNFI 125
              L   F   + +   +EF+   DL   ++++ +    A  K +    L  + + H N I
Sbjct: 886  TNLYCSFQTENRIYFAMEFIGGGDLMWHVQNQRLSVRRA--KFYAAEVLLALKYFHDNGI 943

Query: 126  LHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELL----FGAKH 181
            ++RDLK  N+L + +G IK+AD+GL +      E+   N  + +   PE +       + 
Sbjct: 944  IYRDLKLENILLTLEGHIKIADYGLCK-----DEMWFGNRTSTFCGTPEFMAPEILREQA 998

Query: 182  YTSAIDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWPEVSSFMTYNKL 241
            YT A+D W+ GV+  +++L      G +D D++   F A+ T    D P     M  + +
Sbjct: 999  YTKAVDWWAFGVLLYQMLLCQSPFSG-DDEDEV---FNAILT----DEPLYPIDMAGDIV 1050

Query: 242  QIYPPPSRDELRKRFIAASEYALDFM 267
            QI+      +  KR  A S  AL+ M
Sbjct: 1051 QIFQGLLTKDPEKRLGAGSRDALEVM 1076

>Scas_640.16
          Length = 505

 Score = 74.7 bits (182), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 56/202 (27%), Positives = 102/202 (50%), Gaps = 16/202 (7%)

Query: 13  VGEGTYAVVYLGCQHSTGRKI-AIKEIKTSEFKDGLDMSAIREVKYLQEMQHPNVIELID 71
           +GEG    V   C+   G+K+ A+K + T            RE+++ +  +   ++    
Sbjct: 216 LGEGAGGSVE-KCKLKHGKKVFALKIVNTLNTDPEFQKQIFRELQFNKSFKSDYIVRYYG 274

Query: 72  IF--MAYDNLNLVLEFLP-TDLEVVIKDKSILFTPADIKAWML-----MTLRGVYHCHRN 123
           +F  +   ++ + +E++    LE V K+  +L     I   +L       LRG+ + H  
Sbjct: 275 MFNDVNSSSIYIAMEYMGGKSLEAVYKN--LLSRGGRISEKVLGKISESVLRGLSYLHEQ 332

Query: 124 FILHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKHYT 183
            ++HRD+KP N+LF+  GQ+K+ DFG++    A + + T+   T +Y APE + G + Y+
Sbjct: 333 KVIHRDIKPQNILFNEKGQVKLCDFGVSGE--AVNSLATTFTGTSFYMAPERIQG-QPYS 389

Query: 184 SAIDIWSVGVIFAELML-RIPY 204
              DIWS+G+   E+   R P+
Sbjct: 390 VTCDIWSLGLTILEVAQGRFPF 411

>KLLA0B03586g complement(326871..329075) similar to sp|P11792
           Saccharomyces cerevisiae YHR205w SCH9 serine/threonine
           protein kinase involved in stress response and
           nutrient-sensing signaling pathway, start by similarity
          Length = 734

 Score = 74.7 bits (182), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 71/252 (28%), Positives = 107/252 (42%), Gaps = 20/252 (7%)

Query: 3   VNMEYTKEKK-------------VGEGTYAVVYLGCQHSTGRKIAIKEI-KTSEFKDGLD 48
           ++ EYT  KK             +G+GT+  VY   +  T R  A+K + K    K    
Sbjct: 308 IHWEYTSTKKRQYGPQDFEVLRLLGKGTFGQVYQVRKKDTMRIYAMKVLSKKVIVKKNEI 367

Query: 49  MSAIREVKYL---QEMQHPNVIELIDIFMAYDNLNLVLEFLPTDLEVVIKDKSILFTPAD 105
              I E   L        P ++ L   F    +L LV +F+          K   FT   
Sbjct: 368 AHTIGERNILVRTASKSSPFIVGLKFSFQTPTDLYLVTDFMSGGELFWHLQKEGRFTEDR 427

Query: 106 IKAWMLMTLRGVYHCHRNFILHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNV 165
            K ++   +  + + H N I++RDLKP N+L   +G I + DFGL++A     +   +  
Sbjct: 428 AKFYIAELVLALEYLHDNDIVYRDLKPENILLDANGNIALCDFGLSKA--DLKDRTNTFC 485

Query: 166 VTRWYRAPELLFGAKHYTSAIDIWSVGVIFAELMLR-IPYLPGQNDVDQMEVTFRALGTP 224
            T  Y APELL     YT  +D WS+GV+  E+     P+    N     ++ F  +  P
Sbjct: 486 GTTEYLAPELLMDETGYTKMVDFWSLGVLIFEMCCGWSPFFASDNQKMYQKIAFGKVKFP 545

Query: 225 TDRDWPEVSSFM 236
            D   PE  SF+
Sbjct: 546 RDVLSPEGRSFV 557

>AEL205W [2301] [Homologous to ScYNL298W (CLA4) - SH; ScYOL113W
           (SKM1) - SH] complement(246871..249252) [2382 bp, 793
           aa]
          Length = 793

 Score = 74.3 bits (181), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 56/222 (25%), Positives = 104/222 (46%), Gaps = 30/222 (13%)

Query: 11  KKVGEGTYAVVYLG--------------CQH----STGRKIAIKEIKTSEFKDGLDMSAI 52
           +K G+G    VYL                QH    + G K+AIK++  S  K       +
Sbjct: 502 EKAGQGASGSVYLAQRLKIPPYDENSGVSQHELNDNIGDKVAIKQMILS--KQPRKELIV 559

Query: 53  REVKYLQEMQHPNVIELIDIFM-AYDNLNLVLEFLPTDLEVVIKDKSIL-------FTPA 104
            E+  +++ QH N++  ++ ++   D+L +V+E++       + + SI         T  
Sbjct: 560 NEILVMKDSQHKNIVNFLEAYLKTEDDLWVVMEYMEGGSLTDVIENSIGSDASESPMTEP 619

Query: 105 DIKAWMLMTLRGVYHCHRNFILHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSN 164
            I   +  T +G+   H   I+HRD+K +N+L    G++K+ DFG    +        + 
Sbjct: 620 QIAYIVRETCQGLKFLHDKHIIHRDIKSDNVLLDTHGRVKITDFGFCAKLTDKRSKRATM 679

Query: 165 VVTRWYRAPELLFGAKHYTSAIDIWSVGVIFAELML-RIPYL 205
           V T ++ APE++   + Y   +D+WS+G++  E++    PYL
Sbjct: 680 VGTPYWMAPEVV-KQREYDEKVDVWSLGIMTIEMLEGEPPYL 720

>ACR133C [1180] [Homologous to ScYPL150W - SH] (581468..584023)
           [2556 bp, 851 aa]
          Length = 851

 Score = 74.3 bits (181), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 54/203 (26%), Positives = 97/203 (47%), Gaps = 15/203 (7%)

Query: 11  KKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEMQHPNVIELI 70
           K+VGEG++  VYL     T +K+ +K    S      D + +REV Y ++ ++P + +L 
Sbjct: 41  KQVGEGSFGKVYLATHKLTHQKVVLKTGAKS------DPNVVREVFYHRQFEYPFITKLY 94

Query: 71  DIFMAYDNLNLVLEFLPTD--LEVVIKDKSILFTPAD-IKAWMLMTLRGVYHCHRNFILH 127
           ++ +    + + LE+ P +   + ++  + I   P D  +      +  V++ H    +H
Sbjct: 95  EVIVTETRVWMALEYCPGNELYDYLLLKQRI---PLDETRRLFAQIVSAVFYAHSLQCVH 151

Query: 128 RDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKHYTSAID 187
           RDLK  N+L   +G   + DFG  R      ++ T    T  Y APEL+    +    +D
Sbjct: 152 RDLKLENILLDKNGYAMLTDFGFTRECATKTQLETV-CGTTVYMAPELIKREAYDGYKVD 210

Query: 188 IWSVGVIFAELMLRIPYLPGQND 210
            WS+G+I   ++    Y+P   D
Sbjct: 211 TWSLGIILYTMLH--GYMPFDED 231

>KLLA0D08415g 714473..716797 similar to sp|P22211 Saccharomyces
           cerevisiae YNL183c NPR1 ser/thr protein kinase, start by
           similarity
          Length = 774

 Score = 74.3 bits (181), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 55/198 (27%), Positives = 93/198 (46%), Gaps = 9/198 (4%)

Query: 11  KKVGEGTYAVVYLGCQHSTGRKIAIKEIK---TSEFKDGLDMSAIREVKYLQEMQHPNVI 67
           + +G G    V L  + S  +  A+KE +     E K         E      ++HPN+I
Sbjct: 427 ENLGAGAGGSVRLMKRISDNQVFAVKEFRPKFEHESKRDYVKKITSEYCIGTTLRHPNII 486

Query: 68  ELIDIFMAYDNLNLVLEFLPTDLEVVIKDKSILFTPADIKAWMLMTLRGVYHCHRNFILH 127
             I+I    + +  V+E+   DL  ++    + +   +I       L GV + H   + H
Sbjct: 487 STIEIVYENNRIFQVMEYCDYDLFAIVMSNKMSY--EEICCCFKQILTGVEYLHSIGLAH 544

Query: 128 RDLKPNNLLFSPDGQIKVADFGLARAIPAPHE---ILTSNVV-TRWYRAPELLFGAKHYT 183
           RD+K +N + +  G +K+ DFG A     PH    I +S +V +  Y APE+    K+  
Sbjct: 545 RDMKLDNCVINNQGIVKLIDFGAAEVFSYPHSKTLIESSGIVGSDPYLAPEVCIFTKYDP 604

Query: 184 SAIDIWSVGVIFAELMLR 201
             +DIWSV ++FA ++L+
Sbjct: 605 RPVDIWSVAILFACMVLK 622

>Scas_689.24
          Length = 645

 Score = 74.3 bits (181), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 54/171 (31%), Positives = 85/171 (49%), Gaps = 15/171 (8%)

Query: 40  TSEFKDGLDMSAIREVKYLQEMQHPNVIELIDIFMAYDNLNL-VLEFLPT-DLEVVIKDK 97
           TSEF  G  +S   + K      HPN++ +ID+ M Y+++ + V+EF    DL  ++  +
Sbjct: 394 TSEFIIGYSLSHHAKDK----TTHPNILRIIDL-MEYNHIFVEVMEFCACGDLYTLLTTQ 448

Query: 98  SILFT---PADIKAWMLMTLRGVYHCHRNFILHRDLKPNNLLFSPDGQIKVADFGLARAI 154
           +   T   P +   +M   L  +   H++ I H DLKP N+LF  DG++KV DFG     
Sbjct: 449 TDGLTKLHPLEADCFMKQLLHAISFMHKHGIAHCDLKPENILFQSDGRLKVCDFGTGNVF 508

Query: 155 PAP---HEILTSNVV-TRWYRAPELLFGAKHYT-SAIDIWSVGVIFAELML 200
                 H    S ++ T  Y  PE     K Y    +D+WS GV++  ++L
Sbjct: 509 QTAWEKHVHFQSGMLGTEPYMPPEEFLPGKEYDPRLVDVWSCGVVYCSMIL 559

>Scas_580.6
          Length = 1015

 Score = 74.3 bits (181), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 50/203 (24%), Positives = 101/203 (49%), Gaps = 5/203 (2%)

Query: 3   VNMEYTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEMQ 62
           VN  + + + +G G + +VY G    T +  AIK +     +D ++    REV++L  ++
Sbjct: 33  VNSMFRRTEVIGRGKFGIVYKGYHVRTKQIYAIKVLNLDSDEDEVE-DVQREVQFLSSLK 91

Query: 63  H-PNVIELIDIFMAYDNLNLVLEFLPT-DLEVVIKDKSILFTPADIKAWMLMTLRGVYHC 120
             PN+      ++   +L +++E+     L  +++   I      I   M   L  + + 
Sbjct: 92  QIPNITRYYGSYLKDTSLWIIMEYCAGGSLRSLLRPGKI--DEKYIGVIMRELLVALKYI 149

Query: 121 HRNFILHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAK 180
           H++ ++HRD+K  N+L + +G +K+ DFG+A  +        +   T ++ APE++    
Sbjct: 150 HKDNVIHRDIKAANVLITNEGSVKLCDFGVAAQLNQSTLRRQTMAGTPYWMAPEVIMEGV 209

Query: 181 HYTSAIDIWSVGVIFAELMLRIP 203
           +Y + +DIWS+G+   E+    P
Sbjct: 210 YYDTKVDIWSLGITAYEIATGNP 232

>AER222C [2724] [Homologous to ScYAR018C (KIN3) - SH]
           (1043479..1044750) [1272 bp, 423 aa]
          Length = 423

 Score = 73.6 bits (179), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 70/270 (25%), Positives = 116/270 (42%), Gaps = 57/270 (21%)

Query: 6   EYTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEMQHPN 65
           E+   +++G G++  V       T + +  KEIK            I E   L  ++H N
Sbjct: 26  EFKVLEEIGRGSFGSVRKVLHVPTSKLMVRKEIKYGHMNSKERQQLIAECTILAGLRHEN 85

Query: 66  VIELIDIFMA---------YDN---LNLVLEFLPT-DLEVVIKDKSIL--FTPA-DIKAW 109
           ++E  +   A         Y N   L L +E+    DL  +IK    +  + P  DI   
Sbjct: 86  IVEFYNWDHASSRTGNSVDYGNGEVLYLYMEYCSCGDLSQMIKHYKGMRKYVPERDIWRI 145

Query: 110 MLMTLRGVYHCHRNF--------------------------ILHRDLKPNNLLFSPDG-- 141
            +  L  +Y CH +                           ++HRDLKP N+  + DG  
Sbjct: 146 AVQLLLALYKCHTSCDLPQLDTIYDKISKSAIESEAGKVTSVIHRDLKPGNIFLTGDGVG 205

Query: 142 ----------QIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKHYTSAIDIWSV 191
                     ++K+ DFGLA+++ +  E  T+ V T +Y +PE+L   + Y+   DIWS+
Sbjct: 206 GRGSVDYSKVEVKLGDFGLAKSLQSAIEFATTYVGTPYYMSPEVLMD-QPYSPLSDIWSL 264

Query: 192 GVIFAELM-LRIPYLPGQNDVDQMEVTFRA 220
           G +  EL  LR+P+ P +N ++   +  RA
Sbjct: 265 GCVIYELCALRVPF-PARNFMELQRMIQRA 293

>Kwal_47.18307
          Length = 621

 Score = 73.9 bits (180), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 63/222 (28%), Positives = 101/222 (45%), Gaps = 28/222 (12%)

Query: 12  KVGEGTYAVVYLGCQHS-TGRKIAIKEIKTSEFKDGLDMSAIRE--VKY----------L 58
           ++G+G+Y+ VY   + S +GR  AIK               IRE  VKY          L
Sbjct: 15  RLGQGSYSTVYRAVERSNSGRNYAIKVCSKKHI--------IREKKVKYVTIEKDLLNML 66

Query: 59  QEMQHPNVIELIDIFMAYDNLNLVLEFLPTDLEVVIKDKSILFTPADIKAWMLMTLRGVY 118
            +  H  +++L   F   +NL  VLE++     + +  +    T    +      +  V 
Sbjct: 67  AKGGHLGIVKLFCTFHDIENLYFVLEYVSGGELLALIQRLGRLTEDLSRHITAQLVDTVD 126

Query: 119 HCHRNFILHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEI-----LTSNVVTRWYRAP 173
           + H   ++HRDLKP N+L S +G++ + DFG A    A  +        S V T  Y +P
Sbjct: 127 YMHSKGVIHRDLKPENVLLSQEGRVVITDFGAA-CTAADRKFENTKRTASFVGTAEYVSP 185

Query: 174 ELLFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDVDQME 215
           ELL  ++   S+ DIW++G I  +L    P   G+N++   E
Sbjct: 186 ELLLHSQCGFSS-DIWALGCIIYQLNQGKPPFRGENELQTFE 226

>KLLA0C07535g 658746..660620 some similarities with sgd|S0005793
           Saccharomyces cerevisiae YOR267c, hypothetical start
          Length = 624

 Score = 73.9 bits (180), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 63/221 (28%), Positives = 105/221 (47%), Gaps = 15/221 (6%)

Query: 5   MEYTKEKKV-GEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIR---EVKYLQE 60
            +Y K  KV G G    V +  + S G   A+K+ ++ +  + +   A +   E      
Sbjct: 213 QKYGKLGKVLGSGAGGSVKVLVRPSDGAMFAVKQFRSRKPNEPIRDYARKCTSEFCVGSM 272

Query: 61  MQHPNVIELIDIFMAYDNLNL--VLEFLPTDLEVVIKDKSILFTPADIKAWMLMTLRGVY 118
           + HPN+IE +DIF          V+E+ P D   V+    +  +  +I       +  V 
Sbjct: 273 LHHPNIIETLDIFSDAKQTQYYQVMEYCPVDFFAVVMSGEM--SRGEINCCFKQLVEAVN 330

Query: 119 HCHRNFILHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHE----ILTSNVVTRWYRAPE 174
           + H     HRDLK +N + + +G +K+ DFG A      +E    +    V +  Y APE
Sbjct: 331 YLHSKGYAHRDLKLDNCVMTKEGILKLIDFGSAFVYKYTYENDTKLAHGIVGSDPYLAPE 390

Query: 175 LLFGAKHYTSA-IDIWSVGVIFAELML-RIPY-LPGQNDVD 212
           +L  +  Y +  +DIWS+G+IF  +ML R P+ +P  +DV+
Sbjct: 391 VLVHSNGYDAPMVDIWSMGIIFCCMMLKRFPWKVPKDSDVN 431

>ADL389W [1352] [Homologous to ScYHR205W (SCH9) - SH]
           complement(27643..29778) [2136 bp, 711 aa]
          Length = 711

 Score = 73.9 bits (180), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 67/229 (29%), Positives = 100/229 (43%), Gaps = 7/229 (3%)

Query: 13  VGEGTYAVVYLGCQHSTGRKIAIKEI-KTSEFKDGLDMSAIREVKYLQEMQH---PNVIE 68
           +G+GT+  VY   +  T R  A+K + K    K       I E   L        P ++ 
Sbjct: 310 LGKGTFGQVYQVRKKDTKRIYAMKVLSKKVIVKKNEIAHTIGERNILVRTASKSCPFIVG 369

Query: 69  LIDIFMAYDNLNLVLEFLPTDLEVVIKDKSILFTPADIKAWMLMTLRGVYHCHRNFILHR 128
           L   F    +L LV +FL          K   FT    K ++   +  + + H N I++R
Sbjct: 370 LKFSFQTPTDLYLVTDFLSGGELFWHLQKEGRFTEERAKFYIAELVLALEYLHDNDIVYR 429

Query: 129 DLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKHYTSAIDI 188
           DLKP N+L   +G I + DFGL++A     +   +   T  Y APELL     YT  +D 
Sbjct: 430 DLKPENILLDANGNIALCDFGLSKADLK--DRTNTFCGTTEYLAPELLLDETGYTKMVDF 487

Query: 189 WSVGVIFAELMLR-IPYLPGQNDVDQMEVTFRALGTPTDRDWPEVSSFM 236
           WS+GV+  E+     P+    N     ++ F  +  P D   PE  SF+
Sbjct: 488 WSLGVLIFEMCCGWSPFFAEDNQKMYQKIAFGKVKFPRDVLSPEGRSFV 536

>Kwal_27.10581
          Length = 1154

 Score = 73.9 bits (180), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 54/205 (26%), Positives = 100/205 (48%), Gaps = 8/205 (3%)

Query: 11   KKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYL----QEMQHPNV 66
            K +G+G +  V L    +  R  AIK +K        D+ + R  K +     + +HP +
Sbjct: 831  KVLGKGNFGKVLLAESKNNERLCAIKVLKKDHIIKNHDIESARAEKKVFLLATKAKHPFL 890

Query: 67   IELIDIFMAYDNLNLVLEFLPT-DLEVVIKDKSILFTPADIKAWMLMTLRGVYHCHRNFI 125
              L   F   + +   +EF+   DL   ++++ +    A  K +    L  + + H N +
Sbjct: 891  TNLYCSFQTENRIYFAMEFIGGGDLMWHVQNQRLSVRRA--KFYAAEVLLALKYFHDNGV 948

Query: 126  LHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKHYTSA 185
            ++RDLK  N+L +P+G IK+AD+GL +         ++   T  + APE+L   + YT A
Sbjct: 949  IYRDLKLENILLTPEGHIKIADYGLCKDEMWYGNKTSTFCGTPEFMAPEIL-KEQEYTKA 1007

Query: 186  IDIWSVGVIFAELMLRIPYLPGQND 210
            +D W+ GV+  +++L      G+++
Sbjct: 1008 VDWWAFGVLLYQMLLCQSPFSGEDE 1032

>Kwal_14.1249
          Length = 344

 Score = 72.8 bits (177), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 70/137 (51%), Gaps = 23/137 (16%)

Query: 119 HCHRNFILHRDLKPNNLLFSPDG-----QIKVADFGLARAIPAPHEILTS---NVVTRWY 170
           + H + I+HRD+K  N++   DG     Q+ + DFG+A       E   S   +V T  Y
Sbjct: 131 NLHEHKIIHRDVKLQNVMVDEDGPHDIPQLVLIDFGIAYDPETSQEAADSKITDVSTSIY 190

Query: 171 RAPELLFGAKHYTSAIDIWSVGVIFAELMLR-------IP--------YLPGQNDVDQME 215
           +APELLF  K+Y+SA DIWS+ V+ ++L          IP         L   +D+  + 
Sbjct: 191 KAPELLFSVKNYSSAADIWSLMVLVSQLFQTESSSDRFIPAFVSDGSEVLEQGSDIRLVS 250

Query: 216 VTFRALGTPTDRDWPEV 232
             F  LG P+ ++WPEV
Sbjct: 251 SIFEKLGIPSLQEWPEV 267

>CAGL0L11550g 1229719..1232937 similar to sp|P38692 Saccharomyces
           cerevisiae YHR102w NRK1 ser/thr protein kinase, start by
           similarity
          Length = 1072

 Score = 73.9 bits (180), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 71/298 (23%), Positives = 136/298 (45%), Gaps = 48/298 (16%)

Query: 3   VNMEYTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEMQ 62
           ++  + + + +G G + +VY G    T +  AIK +     +D ++    RE+++L  ++
Sbjct: 12  ISSTFKRTEVIGRGKFGIVYKGYHVKTKQVYAIKVLNLDSSEDEVE-DVQREIQFLASLK 70

Query: 63  H-PNVIELIDIFMAYDNLNLVLEFLPT-DLEVVIKDKSILFTPADIKAWMLMTLRGVYHC 120
             PN+      ++   +L +++E+     L  +++   I      I   M   L  +   
Sbjct: 71  QIPNITRYYGSYLRGTSLWIIMEYCAGGSLRSLLRPGKI--DEKYIGVIMRELLVALKVI 128

Query: 121 HRNFILHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAK 180
           H++ ++HRD+K  N+L + +GQ+K+ DFG+A  +        +   T ++ APE++    
Sbjct: 129 HKDNVIHRDIKAANVLITNEGQVKLCDFGVAAQLNQTSLRRQTMAGTPYWMAPEVIMEGV 188

Query: 181 HYTSAIDIWSVGVIFAELML-RIPYLPGQNDVDQMEVTFRALGTPTDRDWPEVSSFMTYN 239
           +Y + +DIWS+G+   E+     PY     DV+ +    RA+                  
Sbjct: 189 YYDTKVDIWSLGITAYEIATGNPPYC----DVEAL----RAM------------------ 222

Query: 240 KLQIYPPPSRDELR------KRFIAASEYALDFMCGMLTMNPQKRWTAVQCLESDYFK 291
           +L I   P R E R      K FIA        +C  L  +PQ+R +A + L++ + K
Sbjct: 223 QLIIKSKPPRLEERNYTPQLKEFIA--------LC--LDEDPQERLSAEELLKTKFIK 270

>KLLA0F09020g 836287..839073 weakly similar to sp|P43565
           Saccharomyces cerevisiae YFL033c RIM15 protein kinase
           involved in expression of meiotic genes, start by
           similarity
          Length = 928

 Score = 73.9 bits (180), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 51/151 (33%), Positives = 78/151 (51%), Gaps = 6/151 (3%)

Query: 6   EYTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEMQH-- 63
           +Y   K + +G Y  VYL  +  TG   AIK +K S+      ++ ++  + +  +Q   
Sbjct: 701 DYDVIKPISKGAYGSVYLAKKRVTGEYFAIKVLKKSDMIAKNQVTNVKSERAIMMVQSDK 760

Query: 64  PNVIELIDIFMAYDNLNLVLEFLPT-DLEVVIKDKSILFTPAD-IKAWMLMTLRGVYHCH 121
           P V  L   F   +NL LV+++L   D+  +IK    L  P    K ++   + GV   H
Sbjct: 761 PYVARLYATFQNKENLFLVMQYLSGGDMATLIKMMGNL--PEKWAKQYICEVISGVDDMH 818

Query: 122 RNFILHRDLKPNNLLFSPDGQIKVADFGLAR 152
           +N I+H DLKP+NLL    G IK+ DFGL+R
Sbjct: 819 QNGIIHHDLKPDNLLIDSLGHIKLTDFGLSR 849

>Scas_703.5
          Length = 749

 Score = 73.6 bits (179), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 66/229 (28%), Positives = 100/229 (43%), Gaps = 7/229 (3%)

Query: 13  VGEGTYAVVYLGCQHSTGRKIAIKEI-KTSEFKDGLDMSAIREVKYL---QEMQHPNVIE 68
           +G+GT+  VY   +  T R  A+K + K    K       I E   L        P ++ 
Sbjct: 350 LGKGTFGQVYQVKKKDTKRIYAMKVLSKKVIVKKNEVAHTIGERNILVTTATKASPFIVG 409

Query: 69  LIDIFMAYDNLNLVLEFLPTDLEVVIKDKSILFTPADIKAWMLMTLRGVYHCHRNFILHR 128
           L   F    +L LV +F+          K   FT    K ++   +  + + H N I++R
Sbjct: 410 LKFSFQTPTDLYLVTDFMSGGELFWHLQKEGRFTEERAKFYIAELVLALEYLHDNDIVYR 469

Query: 129 DLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKHYTSAIDI 188
           DLKP N+L   +G I + DFGL++A     +   +   T  Y APELL     YT  +D 
Sbjct: 470 DLKPENILLDANGNIALCDFGLSKA--DLKDRTNTFCGTTEYLAPELLLDEAGYTKMVDF 527

Query: 189 WSVGVIFAELMLR-IPYLPGQNDVDQMEVTFRALGTPTDRDWPEVSSFM 236
           WS+GV+  E+     P+    N     ++ F  +  P D   PE  SF+
Sbjct: 528 WSLGVLIFEMCCGWSPFFAEDNQKMYQKIAFGKVKFPRDVLSPEGRSFV 576

>ACL054W [995] [Homologous to ScYGL180W (APG1) - SH]
           complement(269703..272621) [2919 bp, 972 aa]
          Length = 972

 Score = 73.6 bits (179), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 80/327 (24%), Positives = 132/327 (40%), Gaps = 84/327 (25%)

Query: 3   VNMEYTKEKKVGEGTYAVVYLG-CQHSTGRKIAIKEIKTSEFKDGLDMSAIR-EVKYLQE 60
           V   Y  EK++G G++AVVY G    S+   +AIK +  S+ ++   +  +  E+  L++
Sbjct: 14  VAERYVVEKEIGRGSFAVVYKGHLADSSAGNVAIKAVSRSKLRNKKLLENLEIEIAILKK 73

Query: 61  MQHPNVIELIDIFMAYDNLNLVLEFLP-TDLEVVIKDKSILFTPADIKAWMLMTLRGVY- 118
           ++HP+++ L++      +  L++E+    DL   IK +  L      K  ++ TL   Y 
Sbjct: 74  IKHPHIVGLLECERTGTDFYLMMEYCALGDLTFFIKKRRSLMD----KHPLVRTLFEKYP 129

Query: 119 -----HCHRNFIL---------------------HRDLKPNNLL-------------FSP 139
                H   N +L                     HRD+KP NLL             F  
Sbjct: 130 PPSEHHNGLNRVLVVNYLQQLSSALKFLRSKNLVHRDIKPQNLLLSTPLVDYNDPAEFHA 189

Query: 140 DGQI--------KVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKHYTSAIDIWSV 191
            G +        K+ADFG AR +P    +  +   +  Y APE+L   K Y +  D+WSV
Sbjct: 190 RGFVGIYNLPILKIADFGFARFLPNT-SLAETLCGSPLYMAPEILNYQK-YNAKADLWSV 247

Query: 192 GVIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWPEVSSFMTYNKLQIYPPPSRDE 251
           G +  E+    P     N ++  +   +A                  N +  +P      
Sbjct: 248 GTVLYEMCCGKPPFKASNHLELFQKIKKA------------------NDVIQFP------ 283

Query: 252 LRKRFIAASEYALDFMCGMLTMNPQKR 278
              +  A     +D +CG+LT  P KR
Sbjct: 284 ---KHAALESAMVDLICGLLTFEPAKR 307

>CAGL0F09075g 894761..897001 similar to sp|P11792 Saccharomyces
           cerevisiae YHR205w SCH9 serine/threonine protein kinase,
           start by similarity
          Length = 746

 Score = 73.6 bits (179), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 65/229 (28%), Positives = 100/229 (43%), Gaps = 7/229 (3%)

Query: 13  VGEGTYAVVYLGCQHSTGRKIAIKEI-KTSEFKDGLDMSAIREVKYL---QEMQHPNVIE 68
           +G+GT+  VY   +  T R  A+K + K    K       I E   L        P ++ 
Sbjct: 346 LGKGTFGQVYQVKKKDTKRIYAMKVLSKKVIVKKNEIAHTIGERNILVTTSSKASPFIVG 405

Query: 69  LIDIFMAYDNLNLVLEFLPTDLEVVIKDKSILFTPADIKAWMLMTLRGVYHCHRNFILHR 128
           L   F    +L LV +++          +   FT    K ++   +  + H H N I++R
Sbjct: 406 LKFSFQTPTDLYLVTDYMSGGELFWHLQREGRFTEDRAKFYIAELVLALEHLHDNDIVYR 465

Query: 129 DLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKHYTSAIDI 188
           DLKP N+L   +G I + DFGL++A     +   +   T  Y APELL     YT  +D 
Sbjct: 466 DLKPENILLDANGNIALCDFGLSKA--DLKDRTNTFCGTTEYLAPELLLDESGYTKMVDF 523

Query: 189 WSVGVIFAELMLR-IPYLPGQNDVDQMEVTFRALGTPTDRDWPEVSSFM 236
           WS+GV+  E+     P+    N     ++ F  +  P D   PE  SF+
Sbjct: 524 WSLGVLIFEMCCGWSPFYAEDNQKMYQKIAFGKVKFPRDILSPEGRSFV 572

>KLLA0B12716g 1109939..1112089 similar to sp|P12688 Saccharomyces
           cerevisiae YKL126w YPK1 ser/thr-specific protein kinase,
           start by similarity
          Length = 716

 Score = 73.6 bits (179), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 54/194 (27%), Positives = 92/194 (47%), Gaps = 2/194 (1%)

Query: 11  KKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMS-AIREVKYLQEMQHPNVIEL 69
           K +G+G++  V    +  T +  A+K I+ S      +++  + E   L  + +P ++ L
Sbjct: 386 KVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNPFIVPL 445

Query: 70  IDIFMAYDNLNLVLEFLPTDLEVVIKDKSILFTPADIKAWMLMTLRGVYHCHRNFILHRD 129
              F + + L LVL F+          +   F  +  + +    L  +   H   I++RD
Sbjct: 446 KFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEALHDFDIIYRD 505

Query: 130 LKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKHYTSAIDIW 189
           LKP N+L    G I + DFGL +      E  T+   T  Y APELL G + YT  +D W
Sbjct: 506 LKPENILLDYQGHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLLG-QGYTKVVDWW 564

Query: 190 SVGVIFAELMLRIP 203
           ++GV+  E++  +P
Sbjct: 565 TLGVLLYEMLTGLP 578

>Kwal_33.14192
          Length = 577

 Score = 73.2 bits (178), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 48/150 (32%), Positives = 78/150 (52%), Gaps = 9/150 (6%)

Query: 61  MQHPNVIELIDIFMAYDNLNLVLEFLPTDL-EVVIKDKSILFTPADIKAWMLMTLRGVYH 119
           + H N+IE +D+     N  +V+E+ P D   +V+ D   L +  +I  +      GV +
Sbjct: 277 LHHCNIIETLDMLQEGTNFLVVMEYCPYDFFNLVMSD---LMSKNEISCYFKQICNGVDY 333

Query: 120 CHRNFILHRDLKPNNLLFSPDGQIKVADFGLARAIPAPH--EILTSN--VVTRWYRAPEL 175
            HR  + HRDLK +N + +  G +K+ DFG A     P+  EIL +   V +  Y APEL
Sbjct: 334 LHRMGLAHRDLKLDNCVVTKQGILKLIDFGSAVVFQYPYEKEILRAKGIVGSDPYLAPEL 393

Query: 176 LFGAKHYTSAIDIWSVGVIFAELML-RIPY 204
           L    +    +D+WS+ ++F  + L R P+
Sbjct: 394 LSHPSYDPRPVDVWSIAIMFYCITLKRFPW 423

>Kwal_26.7635
          Length = 691

 Score = 73.2 bits (178), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 51/194 (26%), Positives = 92/194 (47%), Gaps = 2/194 (1%)

Query: 11  KKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLD-MSAIREVKYLQEMQHPNVIEL 69
           K +G+G++  V    +  T +  A+K I+ S      + +  + E   L  +++P ++ L
Sbjct: 362 KVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVLARVENPFIVPL 421

Query: 70  IDIFMAYDNLNLVLEFLPTDLEVVIKDKSILFTPADIKAWMLMTLRGVYHCHRNFILHRD 129
              F + D L +VL F+          +   F+ +  + +    L  +   H   +++RD
Sbjct: 422 KFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLCALETLHNLDVIYRD 481

Query: 130 LKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKHYTSAIDIW 189
           LKP N+L    G I + DFGL +      +   +   T  Y APELL G + Y+  +D W
Sbjct: 482 LKPENILLDHQGHIALCDFGLCKLNMKGQDKTNTFCGTPEYLAPELLLG-QGYSKVVDWW 540

Query: 190 SVGVIFAELMLRIP 203
           ++GV+  E+M  +P
Sbjct: 541 TLGVLLYEMMTGLP 554

>KLLA0B07205g complement(624606..625973) some similarities with
           sp|P05986 Saccharomyces cerevisiae YKL166c TPK3
           cAMP-dependent protein kinase 3, catalytic chain,
           hypothetical start
          Length = 455

 Score = 73.2 bits (178), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 50/190 (26%), Positives = 90/190 (47%), Gaps = 5/190 (2%)

Query: 11  KKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIR-EVKYLQEMQHPNVIEL 69
           + +G G++  V+L   +  GR  A+K +K +       +     E   L  + HP +I +
Sbjct: 149 RTLGTGSFGRVHLVRSNHNGRFYAMKVLKKNTVVKLKQVEHTNDERNMLSIVSHPFIIRM 208

Query: 70  IDIFMAYDNLNLVLEFLPTDLEVVIKDKSILFTPADIKAWMLMTLRGVYHCHRNFILHRD 129
              F     L ++++++       +  KS  F     K +       + + H   I++RD
Sbjct: 209 WGTFQDSQQLFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLHSKGIIYRD 268

Query: 130 LKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKHYTSAIDIW 189
           LKP N+L   +G IK+ DFG A+ +P   ++  +   T  Y APE++   K Y  ++D W
Sbjct: 269 LKPENILLDKNGHIKLTDFGFAKYVP---DVTYTLCGTPDYIAPEVV-STKPYNKSVDWW 324

Query: 190 SVGVIFAELM 199
           S GV+  E++
Sbjct: 325 SFGVLIYEML 334

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.322    0.138    0.422 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 10,188,955
Number of extensions: 423307
Number of successful extensions: 2852
Number of sequences better than 10.0: 642
Number of HSP's gapped: 1762
Number of HSP's successfully gapped: 694
Length of query: 301
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 200
Effective length of database: 13,099,691
Effective search space: 2619938200
Effective search space used: 2619938200
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 61 (28.1 bits)