Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YDL107W (MSS2)35134618360.0
Sklu_1484.13763467494e-97
CAGL0H10296g3733647391e-95
Kwal_23.34753823336956e-89
KLLA0E14784g3793476931e-88
ADL282W3723486269e-79
Scas_613.123483545641e-69
Scas_720.5239178770.12
Scas_704.3224773720.42
CAGL0I05874g24774691.0
ABL065W921103663.3
KLLA0C10857g45394645.1
Scas_706.21130488637.1
KLLA0E20361g69351637.6
Scas_701.825075628.6
YNL121C (TOM70)61731629.1
YDR113C (PDS1)37366629.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YDL107W
         (346 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YDL107W (MSS2) [762] chr4 (268921..269976) Protein involved in t...   711   0.0  
Sklu_1484.1 YDL107W, Contig c1484 197-1327 reverse complement         293   4e-97
CAGL0H10296g complement(1004900..1006021) similar to sp|P40990 S...   289   1e-95
Kwal_23.3475                                                          272   6e-89
KLLA0E14784g complement(1321041..1322180) similar to sp|P40990 S...   271   1e-88
ADL282W [1459] [Homologous to ScYDL107W (MSS2) - SH] complement(...   245   9e-79
Scas_613.12                                                           221   1e-69
Scas_720.52                                                            34   0.12 
Scas_704.32                                                            32   0.42 
CAGL0I05874g complement(558102..558845) highly similar to sp|P41...    31   1.0  
ABL065W [527] [Homologous to ScYBR079C (RPG1) - SH] complement(2...    30   3.3  
KLLA0C10857g 934234..935595 some similarities with sp|P28625 Sac...    29   5.1  
Scas_706.21                                                            29   7.1  
KLLA0E20361g 1801106..1803187 some similarities with sp|P34226 S...    29   7.6  
Scas_701.8                                                             28   8.6  
YNL121C (TOM70) [4474] chr14 complement(398684..400537) Mitochon...    28   9.1  
YDR113C (PDS1) [961] chr4 complement(680490..681611) Protein tha...    28   9.1  

>YDL107W (MSS2) [762] chr4 (268921..269976) Protein involved in
           translocation of the Cox2p C-terminal end across the
           mitochondrial inner membrane [1056 bp, 351 aa]
          Length = 351

 Score =  711 bits (1836), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/346 (100%), Positives = 346/346 (100%)

Query: 1   MQRFVSKFVSTPPVPKKFQEIFPKKRTVNKILFQLDTRLTYHEMYPIFLQVSQNTNEENI 60
           MQRFVSKFVSTPPVPKKFQEIFPKKRTVNKILFQLDTRLTYHEMYPIFLQVSQNTNEENI
Sbjct: 1   MQRFVSKFVSTPPVPKKFQEIFPKKRTVNKILFQLDTRLTYHEMYPIFLQVSQNTNEENI 60

Query: 61  PWRKKYPYIRSSDIMQMRNVLITLRTQNKFVHKDLLAMEDKLLNIAAELGNNDAISILSF 120
           PWRKKYPYIRSSDIMQMRNVLITLRTQNKFVHKDLLAMEDKLLNIAAELGNNDAISILSF
Sbjct: 61  PWRKKYPYIRSSDIMQMRNVLITLRTQNKFVHKDLLAMEDKLLNIAAELGNNDAISILSF 120

Query: 121 NVIHEYKKENVKSSYEKDIETANEFIKKLYARNHHLTVKLIGDLFFENKTYDKAEKYYQE 180
           NVIHEYKKENVKSSYEKDIETANEFIKKLYARNHHLTVKLIGDLFFENKTYDKAEKYYQE
Sbjct: 121 NVIHEYKKENVKSSYEKDIETANEFIKKLYARNHHLTVKLIGDLFFENKTYDKAEKYYQE 180

Query: 181 FLKLENSTKLAGEVHGKLGEIQIKQVNGFLKAEKSWLSCIELLEIERSSRWYFLLARLYM 240
           FLKLENSTKLAGEVHGKLGEIQIKQVNGFLKAEKSWLSCIELLEIERSSRWYFLLARLYM
Sbjct: 181 FLKLENSTKLAGEVHGKLGEIQIKQVNGFLKAEKSWLSCIELLEIERSSRWYFLLARLYM 240

Query: 241 SSEPMKAKALLENCASIGFKECFKTLGFLELNYFNNYERAKEWFKTGMEIMDLECFFGFF 300
           SSEPMKAKALLENCASIGFKECFKTLGFLELNYFNNYERAKEWFKTGMEIMDLECFFGFF
Sbjct: 241 SSEPMKAKALLENCASIGFKECFKTLGFLELNYFNNYERAKEWFKTGMEIMDLECFFGFF 300

Query: 301 DCCVKEENFKGARDCLESVKKLGNDKDKKTMINVFLESRKDSIKLL 346
           DCCVKEENFKGARDCLESVKKLGNDKDKKTMINVFLESRKDSIKLL
Sbjct: 301 DCCVKEENFKGARDCLESVKKLGNDKDKKTMINVFLESRKDSIKLL 346

>Sklu_1484.1 YDL107W, Contig c1484 197-1327 reverse complement
          Length = 376

 Score =  293 bits (749), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 159/346 (45%), Positives = 238/346 (68%), Gaps = 11/346 (3%)

Query: 2   QRFVSKFVSTPPVPKKFQEIFPKKRTVNKILFQLDTRLTYHEMYPIFLQVSQNTNEENIP 61
           +R +S   S  P    F ++FP+K+ VNK+LF+LD+RLT+ ++YP++  +  NT ++   
Sbjct: 10  KRLISHNASRRP---PFYDVFPQKKLVNKLLFELDSRLTFPKLYPLYESL-YNTMDDAQS 65

Query: 62  WRKKYPYIRSSDIMQMRNVLITLRTQNKFVHKDLLAMEDKLLNIAAELGNNDAISILSFN 121
             K    + +SDIM M+ VL  LR + K ++K+LLA+E+++LN AAE+GNNDAIS+L+F+
Sbjct: 66  QVKVPTSVTASDIMVMKKVLEKLRHRTKSINKNLLALENEILNKAAEMGNNDAISLLAFD 125

Query: 122 VIHEYKKENVKSSYEKDIETANEFIKKLYARNHHLTVKLIGDLFFENKTYDKAEKYYQEF 181
            +    K++  +S+E DI  A   IK+LY   H LTVKL GDL F+N     AEKYY++F
Sbjct: 126 TL----KDSDSNSHE-DIAYAKTLIKELYQLRHPLTVKLTGDLTFKNNDLINAEKYYKDF 180

Query: 182 LKLENSTKLAGEVHGKLGEIQIKQVNGFLKAEKSWLSCIELLEIERSSRWYFLLARLYMS 241
           L LE+ T LAGEV+G+LG+I  ++ N F KAE  +L  I+L  +E S   YF L ++YM+
Sbjct: 181 LALEDDTFLAGEVYGQLGQISFRKPNLF-KAEDYFLKSIKLCPLEYSVHSYFYLGQMYMN 239

Query: 242 SEPMKAKALLENCASIGFKECFKTLGFLELNYFNNYERAKEWFKTGMEIMDLECFFGFFD 301
           S+P+KA+ALLE+ A+ GFKE FK LGFLE+NYF +Y +A+EWFK GME+ ++ECF G+FD
Sbjct: 240 SQPLKARALLESTATQGFKESFKILGFLEMNYFEDYSKAQEWFKLGMELFEMECFVGYFD 299

Query: 302 CCVKEENFKGARDCLESVKK-LGNDKDKKTMINVFLESRKDSIKLL 346
           CCVK E +  A+ C  S+   L ++ + + + + F+ +RKD ++ L
Sbjct: 300 CCVKLEEWVNAKRCFNSMTTLLQSNTNYEPVYSNFVTTRKDKLEKL 345

>CAGL0H10296g complement(1004900..1006021) similar to sp|P40990
           Saccharomyces cerevisiae YDL107w MSS2 ser/thr protein
           kinase, hypothetical start
          Length = 373

 Score =  289 bits (739), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 159/364 (43%), Positives = 231/364 (63%), Gaps = 27/364 (7%)

Query: 4   FVSKFVSTPP-------VPKKFQEIFPKKRTVNKILFQLDTRLTYHEMYPIFLQVSQNTN 56
           FVS+F+   P       V KKF E FPKK+T+NK+LF L++RLTY ++YPI++ +     
Sbjct: 3   FVSQFLKKKPDVLGTLEVSKKFMEHFPKKKTINKLLFDLNSRLTYKKLYPIYVGLYHGVP 62

Query: 57  EENIPWRKKY-PYIRSSDIMQMRNVLITLRTQNKFVHKDLLAMEDKLLNIAAELGNNDAI 115
              +P ++K    ++ SD++ MRNVL  +R + ++   D+L +EDKLL +AAELGNNDAI
Sbjct: 63  ---VPQQQKLLDGVKGSDLIVMRNVLEKVRNRTRYARPDMLKLEDKLLELAAELGNNDAI 119

Query: 116 SILSFNVIHEYKKENVKS-SYEKDIETANEFIKKLYARNHHLTVKLIGDLFFENKTYDKA 174
           +ILSF  I E    N  + +  +++  A +  K LY  NH L +KL+GDL  E   +++A
Sbjct: 120 AILSFRSIRENMGTNSAAEANNEEVTIAKKLFKDLYNINHLLAIKLLGDLALEANNWEEA 179

Query: 175 EKYYQEFLK---------LENSTKLAGEVHGKLGEIQIKQVNGFLKAEKSWLSCIELLEI 225
             +Y +++          L  +  L GEV+GKLGEI+   +    KAE+ W  C+EL  +
Sbjct: 180 LTFYNKYINIAVKDNGHLLTGNDDLTGEVYGKLGEIEFTYLANMTKAEEYWQKCLELTSV 239

Query: 226 ERSSRWYFLLARLYMSSEPMKAKALLENCASIGFKECFKTLGFLELNYFNNYERAKEWFK 285
           E S RWYFL A++YMSSEP+K++ LLE  AS GFKE   +LGFLE+NYF +Y RAKEWFK
Sbjct: 240 EDSVRWYFLAAQIYMSSEPLKSRILLEKAASQGFKESLTSLGFLEMNYFRDYGRAKEWFK 299

Query: 286 TGMEIMDLECFFGFFDCCVKEENFKGARDCLESVKKL------GNDKDKKTMINVFLESR 339
            GME+ +L+ + GFFDCCVK E++  A  CL+S++K+      G+D   K  ++ F+ SR
Sbjct: 300 LGMEVFELQSYIGFFDCCVKNEDWIAALKCLKSIEKIGTMESFGSDNTNKATVSNFMNSR 359

Query: 340 KDSI 343
            + I
Sbjct: 360 AEFI 363

>Kwal_23.3475
          Length = 382

 Score =  272 bits (695), Expect = 6e-89,   Method: Compositional matrix adjust.
 Identities = 139/333 (41%), Positives = 220/333 (66%), Gaps = 12/333 (3%)

Query: 12  PPVPKKFQEIFPKKRTVNKILFQLDTRLTYHEMYPIFLQVSQNTNEENIPWRKKYPYIRS 71
           PP    F E+FP+K+ VNKILFQLD++LT+ ++YP+F  +  N    + P        ++
Sbjct: 27  PP----FYEVFPQKKMVNKILFQLDSKLTFPKLYPVFESLYDNAGNRD-PSELIPTSFKA 81

Query: 72  SDIMQMRNVLITLRTQNKFVHKDLLAMEDKLLNIAAELGNNDAISILSFNVIHEYKKENV 131
           SD+M M+ VL  +R + K  +K+L+ +E++LL  AAE+G+NDAI++L+F+ +     +N 
Sbjct: 82  SDVMIMKKVLEKIRHRTKSTNKNLIGLENELLETAAEMGDNDAIALLAFSFL-----KNP 136

Query: 132 KSSYEKDIETANEFIKKLYARNHHLTVKLIGDLFFENKTYDKAEKYYQEFLKLENSTKLA 191
                +D+  A   IK+LY   H LT+KL  DL  ++  ++ AE+YY  FL+LE+ T  A
Sbjct: 137 GKHAPEDVLHAKNLIKELYQLQHPLTIKLTADLAVKSNHFEDAERYYLHFLELESETPRA 196

Query: 192 GEVHGKLGEIQIKQVNGFLKAEKSWLSCIELLEIERSSRWYFLLARLYMSSEPMKAKALL 251
           GEV+G+LG I  ++ N   +AE+ +LS I L  +E  +  Y+ LA+LYM SEP+KA++L+
Sbjct: 197 GEVYGQLGLIYFRRPN-LKEAERCFLSSIRLCPLEAVTHSYYHLAQLYMDSEPLKARSLM 255

Query: 252 ENCASIGFKECFKTLGFLELNYFNNYERAKEWFKTGMEIMDLECFFGFFDCCVKEENFKG 311
           E+ AS GF+E F+ LGFLE+NYF++Y +A +WF+ GME+   EC+ G+FDC +K ++ K 
Sbjct: 256 ESAASEGFRESFQLLGFLEMNYFHDYAKALQWFRLGMELYQFECYIGYFDCSIKMQDLKK 315

Query: 312 ARDCLESVKKLGNDKDK-KTMINVFLESRKDSI 343
           AR+CL S++KL    D   +    F++SR+++I
Sbjct: 316 ARNCLTSLQKLSKTNDLFASAFKSFVDSRQETI 348

>KLLA0E14784g complement(1321041..1322180) similar to sp|P40990
           Saccharomyces cerevisiae YDL107w MSS2 ser/thr protein
           kinase singleton, start by similarity
          Length = 379

 Score =  271 bits (693), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 147/347 (42%), Positives = 225/347 (64%), Gaps = 18/347 (5%)

Query: 2   QRFVSKFVSTPPVPKKFQEIFPKKRTVNKILFQLDTRLTYHEMYPIFLQVSQN---TNEE 58
           +R +S   +  P      EIFP+K+ V++ILF+LD+RL Y+++YP++ ++ +     N+ 
Sbjct: 13  RRLISSLANKRP---PLHEIFPQKKMVSRILFELDSRLAYNKLYPMYEKLYEGLDTGNDV 69

Query: 59  NIPWRKKYPYIRSSDIMQMRNVLITLRTQNKFVHKDLLAMEDKLLNIAAELGNNDAISIL 118
           +IP       I+  D+M M+ VL  +R + K ++K+LLA+E+ LL+ AAE+G+NDAIS+L
Sbjct: 70  DIPNS-----IKGKDLMIMKKVLEKVRHKTKAINKNLLALENVLLDRAAEIGDNDAISLL 124

Query: 119 SFNVIHEYKKENVKSSYEKDIETANEFIKKLYARNHHLTVKLIGDLFFENKTYDKAEKYY 178
            F+V+     ++  S+ E D+  A + IK LY  NH LTVKL  D+  +N     AE YY
Sbjct: 125 CFDVL-----KDPDSNTEDDVSHAKKLIKNLYQMNHPLTVKLTADIALKNHDDATAEVYY 179

Query: 179 QEFLKLENSTKLAGEVHGKLGEIQIKQVNGFLKAEKSWLSCIELLEIERSSRWYFLLARL 238
            +FL L+N T LAGEV+G+LG+I  ++ N  ++AEK +L  I+L  I+ S R YFLL ++
Sbjct: 180 MKFLDLQNDTFLAGEVYGQLGQIHFRKPN-LIEAEKCFLKSIKLCPIDYSVRSYFLLGQM 238

Query: 239 YMSSEPMKAKALLENCASIGFKECFKTLGFLELNYFNNYERAKEWFKTGMEIMDLECFFG 298
           Y++++  KA+ L+E+ A+ GFKE F+TLG LE+NYF NY +A+EWFK GME+ D ECF G
Sbjct: 239 YVNNDIFKARYLIESSATQGFKESFRTLGLLEMNYFKNYPKAQEWFKLGMELYDTECFVG 298

Query: 299 FFDCCVKEENFKGARDCLESVKKLG-NDKDKKTMINVFLESRKDSIK 344
           +FDC +K      A+ C ES++KL  N++D   +   F   R   I+
Sbjct: 299 YFDCTMKNNELLLAKRCYESMEKLAENNQDVNRLFEDFSSHRASDIQ 345

>ADL282W [1459] [Homologous to ScYDL107W (MSS2) - SH]
           complement(206313..207431) [1119 bp, 372 aa]
          Length = 372

 Score =  245 bits (626), Expect = 9e-79,   Method: Compositional matrix adjust.
 Identities = 140/348 (40%), Positives = 212/348 (60%), Gaps = 23/348 (6%)

Query: 7   KFVST---PPVPKKFQEIFPKKRTVNKILFQLDTRLTYHEMYPIFLQV----SQNTNEEN 59
           +F+ST   PP+ K    IFP K+ VN++LF LD+RLT+ ++ P++ QV      +T +  
Sbjct: 17  RFLSTNNRPPLHK----IFPSKKLVNRMLFDLDSRLTFRKLLPVYEQVYTQLDSSTGDLV 72

Query: 60  IPWRKKYPYIRSSDIMQMRNVLITLRTQNKFVHKDLLAMEDKLLNIAAELGNNDAISILS 119
           +P       +R+ D+M M+ VL   R + K  ++ LLA+E++LL +AA++G+ DA ++L+
Sbjct: 73  VPRG-----VRAHDVMIMKKVLEKTRRRTKSSNRHLLALENELLYMAAQMGHKDAAALLA 127

Query: 120 FNVIHEYKKENVKSSYEKDIETANEFIKKLYARNHHLTVKLIGDLFFENKTYDKAEKYYQ 179
           F+ +      N  S    D+E A   +K  Y   H LT+KL GDL   N     AE+YY 
Sbjct: 128 FDTLC-----NPASQTAADMEYAKLMVKDFYRSGHPLTLKLTGDLSLANGDNTTAEEYYM 182

Query: 180 EFLKLENSTKLAGEVHGKLGEIQIKQVNGFLKAEKSWLSCIELLEIERSSRWYFLLARLY 239
           +FLK E  T LAGEV+G+LG I   + + F +AE+ +L  I+L  +E S + YF L +LY
Sbjct: 183 KFLKKEADTFLAGEVYGQLGRISFLRSH-FAQAEERFLQAIKLTPLEYSVQSYFYLGQLY 241

Query: 240 MSSEPMKAKALLENCASIGFKECFKTLGFLELNYFNNYERAKEWFKTGMEIMDLECFFGF 299
           M+S+P+KA++LLE+ AS GFKE FKTLG LE+NYF +  +A+EWFK GME+ +LEC  G 
Sbjct: 242 MNSDPLKARSLLESAASQGFKESFKTLGHLEMNYFCDLTKAREWFKLGMELGELECMIGC 301

Query: 300 FDCCVKEENFKGARDCLESVKKLG-NDKDKKTMINVFLESRKDSIKLL 346
           FDC +   +   A    +S++ L   DK  + +   F + R + + LL
Sbjct: 302 FDCAITLGDLALAHRASKSLEALAKTDKIYQALYTQFADYRHEKLSLL 349

>Scas_613.12
          Length = 348

 Score =  221 bits (564), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 127/354 (35%), Positives = 211/354 (59%), Gaps = 26/354 (7%)

Query: 1   MQRFVSKFVSTPPVP--KKFQEIFPKKRTVNKILFQLDTRLTYHEMYPIFLQVSQNTNEE 58
           M R + + ++T      + F EIFP+KR +N+ILF+LD+  TY  +YP F         E
Sbjct: 1   MNRVIIRRIATKSTSTLRPFHEIFPRKRLINRILFELDSNDTYKTLYPNF---------E 51

Query: 59  NIPWRKKYP-YIRSSDIMQMRNVLITLRTQNKFVHKDLLAMEDKLLNIAAELGNNDAISI 117
            +  + + P  +    ++ M  VL+ +  Q K +++ L+ M  +LL +AA  G NDAIS 
Sbjct: 52  TLYLKHELPSTVSGPQLLLMDRVLLEVSKQQKMINEVLMKMRGELLELAAGKGENDAIST 111

Query: 118 LSFNVIHEYKKENVKSSYEKDIETANEFIKKLYARNHHLTVKLIGDLFFENKTYDKAEKY 177
           + +N++   K ++     + D E A+  I +L    + LT K +GDL       ++A+ +
Sbjct: 112 VCYNILSSPKDDS-----KGDAEDASRLIGELVKAGNVLTFKHLGDLSRLKGDINEAKLW 166

Query: 178 YQEFLKL--ENSTKLA-----GEVHGKLGEIQIKQVNGFLKAEKSWLSCIELLEIERSSR 230
           Y +F++   ++ T+++     G+V  +LGEI+  Q +  L AEK WL  I   ++E S +
Sbjct: 167 YDKFMECVDQDETRVSDVSIIGQVLERLGEIEFNQ-SRVLGAEKYWLDAIARSKLEDSVK 225

Query: 231 WYFLLARLYMSSEPMKAKALLENCASIGFKECFKTLGFLELNYFNNYERAKEWFKTGMEI 290
            YF L+++Y++SEP+K++ LLENCA+ GF+E FK LG+LELNYF N  +A EWF+ GME+
Sbjct: 226 SYFYLSKVYLNSEPLKSRVLLENCATQGFRESFKELGYLELNYFKNLVKANEWFRLGMEL 285

Query: 291 MDLECFFGFFDCCVKEENFKGARDCLESVKKLGN-DKDKKTMINVFLESRKDSI 343
            ++ECFFGFFD C + + +K    CL+S++   N ++  K M++ F+  R++ I
Sbjct: 286 FEIECFFGFFDSCYQLKEYKSCSKCLKSLETFKNINESYKNMVSEFVSHRENKI 339

>Scas_720.52
          Length = 391

 Score = 34.3 bits (77), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 36/78 (46%), Gaps = 11/78 (14%)

Query: 228 SSRWYFLLARLYMSSEPMKAKALLENCASIGF----KECFKT----LGFLELNYFNNYER 279
           SSRWY  L   Y+  EP K   + E   SI      ++C+      +G LE +  N+Y  
Sbjct: 166 SSRWYEYLLPTYVLKEPRKDVLMNEGVTSIDLVYYNEDCYSVPDLRIGKLE-SVLNHYLG 224

Query: 280 AKEW--FKTGMEIMDLEC 295
            K +  F TG E MD  C
Sbjct: 225 TKRFHNFTTGKETMDSSC 242

>Scas_704.32
          Length = 247

 Score = 32.3 bits (72), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 34/73 (46%), Gaps = 6/73 (8%)

Query: 169 KTYDKAEKYYQEFLKLENSTKLAGEVHGKLGE------IQIKQVNGFLKAEKSWLSCIEL 222
           +TYD  EK+  ++   E  T+L GE+  K G+        +K  N F K  K   +    
Sbjct: 54  RTYDAIEKFAPDWADREYVTQLEGEIPTKFGQHALEVPGAVKLCNEFNKLPKERWAVATS 113

Query: 223 LEIERSSRWYFLL 235
              E +S+W+ LL
Sbjct: 114 GTFEMASKWFELL 126

>CAGL0I05874g complement(558102..558845) highly similar to sp|P41277
           Saccharomyces cerevisiae YIL053w RHR2 or sp|P40106
           Saccharomyces cerevisiae YER062c GPP2, hypothetical
           start
          Length = 247

 Score = 31.2 bits (69), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 33/74 (44%), Gaps = 6/74 (8%)

Query: 169 KTYDKAEKYYQEFLKLENSTKLAGEVHGKLGEIQI------KQVNGFLKAEKSWLSCIEL 222
           +TYD   K+  +F   E  TKL GE+  K G+  I      K  N F +  K   +    
Sbjct: 54  RTYDAIAKFAPDFADEETVTKLEGEIPDKYGKEAIEVAGAVKLCNSFNELPKEKWAVATS 113

Query: 223 LEIERSSRWYFLLA 236
              E +S+W+ +L 
Sbjct: 114 GTREMASKWFAVLG 127

>ABL065W [527] [Homologous to ScYBR079C (RPG1) - SH]
           complement(278504..281269) [2766 bp, 921 aa]
          Length = 921

 Score = 30.0 bits (66), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 24/103 (23%), Positives = 46/103 (44%), Gaps = 12/103 (11%)

Query: 119 SFNVIHEYKKENVKSSYEKDIETANEFIKKLYARNHHLTVKLIGDLFFENKTYDKAEKYY 178
           S+N + +   E  K  +E+++   +  +K +Y    H   K+I            A+K  
Sbjct: 731 SYNKLKQMMVEKAKKDHEENLRIHDRLVK-IYPSYLHFREKVIA-----------AQKSQ 778

Query: 179 QEFLKLENSTKLAGEVHGKLGEIQIKQVNGFLKAEKSWLSCIE 221
            E L+ EN+ KL    + +L E++ ++ N  +   K  L+  E
Sbjct: 779 IEALRAENAAKLEAAKNARLQEVRQQRYNELIARRKEELAAKE 821

>KLLA0C10857g 934234..935595 some similarities with sp|P28625
           Saccharomyces cerevisiae YMR152w YIM1 mitochondrial
           inner membrane protease, hypothetical start
          Length = 453

 Score = 29.3 bits (64), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 41/94 (43%), Gaps = 10/94 (10%)

Query: 163 DLFFENKTYDKAEKYYQEFLKLENSTKLAGEVHGKLGEIQI---KQVNGFLKAEKSWLSC 219
           DL F+   Y+    +  ++LK +N       + G + + Q    KQ  GF+     W S 
Sbjct: 330 DLIFDCAGYNDLIPHINDYLKPKNQNSQYINITGTV-KYQFDPKKQTKGFI-----WKSL 383

Query: 220 IELLEIERSSRWYFLLARLYMSSEPMKAKALLEN 253
           + +    RS  ++FLL R   S  P K K  L N
Sbjct: 384 LGMCRFHRSFNYHFLLMRTERSIGP-KFKEFLSN 416

>Scas_706.21
          Length = 1304

 Score = 28.9 bits (63), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 46/88 (52%), Gaps = 13/88 (14%)

Query: 125  EYKKENVKSSYEKDIETANEFIKKLYARNHHL---------TVKLIGDLFFENKTYDKAE 175
            E K+ ++ S  +K  +++NE  K+   +N HL         T   I  L  +N   ++ +
Sbjct: 994  EVKQNHLNSKKDKLKDSSNE--KRNLEQNIHLANLRAKLKETENDISRLDIQNAEAER-D 1050

Query: 176  KYYQEFLKLENS-TKLAGEVHGKLGEIQ 202
            KY QE L+L N   KL+ E  GKLGEI+
Sbjct: 1051 KYQQESLRLRNLFEKLSAENAGKLGEIK 1078

>KLLA0E20361g 1801106..1803187 some similarities with sp|P34226
           Saccharomyces cerevisiae YBL061c SKT5 protoplast
           regeneration and killer toxin resistance protein,
           hypothetical start
          Length = 693

 Score = 28.9 bits (63), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 26/51 (50%)

Query: 89  KFVHKDLLAMEDKLLNIAAELGNNDAISILSFNVIHEYKKENVKSSYEKDI 139
           +F   + L  ++    I+  LGN+ A S+LS     E  K+NVK S   D+
Sbjct: 146 RFTSTNELVADESHKRISTYLGNDSAASLLSRQKTIEMYKQNVKKSKNPDV 196

>Scas_701.8
          Length = 250

 Score = 28.5 bits (62), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 35/75 (46%), Gaps = 10/75 (13%)

Query: 169 KTYDKAEKYYQEFLKLENSTKLAGEVHGKLGEIQIKQVNGFLK--------AEKSWLSCI 220
           +TYD   K+  +F   E  +KL GE+  K GE  I +V G +K         ++ W    
Sbjct: 57  RTYDAIAKFAPDFADEELVSKLEGEIPEKYGEHSI-EVPGAVKLCNDLNKLPKEKWAVAT 115

Query: 221 ELLEIERSSRWYFLL 235
                E +++W+ LL
Sbjct: 116 SGTR-EMATKWFDLL 129

>YNL121C (TOM70) [4474] chr14 complement(398684..400537)
           Mitochondrial specialized import receptor of the outer
           membrane, has tetratricopeptide (TPR) repeats [1854 bp,
           617 aa]
          Length = 617

 Score = 28.5 bits (62), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 19/31 (61%)

Query: 154 HHLTVKLIGDLFFENKTYDKAEKYYQEFLKL 184
           + L +K  G+ FF NK YD A KYY   L+L
Sbjct: 98  YALALKDKGNQFFRNKKYDDAIKYYNWALEL 128

>YDR113C (PDS1) [961] chr4 complement(680490..681611) Protein that
           regulates sister chromatid separation in mitosis,
           involved in mitotic DNA damage checkpoint [1122 bp, 373
           aa]
          Length = 373

 Score = 28.5 bits (62), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 34/66 (51%), Gaps = 2/66 (3%)

Query: 47  IFLQVSQNTNEENIPWRKKYPYIRSSDIMQMRNVLITLRTQNKFVHKDLLAMEDKLLNIA 106
           IF + S  + + ++P  +    IR +D  Q+R +    R++++  H DLL+   KL    
Sbjct: 100 IFPETSNQSKDADLPQLQNTLSIRKND--QLRKLSQISRSRSRANHNDLLSNSRKLQKYG 157

Query: 107 AELGNN 112
           + LG N
Sbjct: 158 SVLGYN 163

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.321    0.136    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 11,544,837
Number of extensions: 511916
Number of successful extensions: 1939
Number of sequences better than 10.0: 61
Number of HSP's gapped: 1953
Number of HSP's successfully gapped: 62
Length of query: 346
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 244
Effective length of database: 13,065,073
Effective search space: 3187877812
Effective search space used: 3187877812
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 62 (28.5 bits)