Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YDL106C (PHO2)55955021340.0
Scas_613.114933718681e-110
Sklu_2101.44913638511e-108
AFL202C4813438061e-101
CAGL0L07436g5153848031e-100
KLLA0D10043g4883387991e-100
Kwal_23.34944663397668e-96
KLLA0B01584g464581513e-10
Kwal_47.18450370721389e-09
YML027W (YOX1)385661236e-07
YDR451C (YHP1)353521084e-05
Sklu_797.1386571085e-05
AER314W431711085e-05
KLLA0C03135g228641031e-04
KLLA0B14553g228641031e-04
AFR643C10265942e-04
CAGL0G07249g345891013e-04
ADL394C10265933e-04
Scas_641.12413571013e-04
Kwal_33.129919150880.001
AER456W5761830.002
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YDL106C
         (550 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YDL106C (PHO2) [763] chr4 complement(270222..271901) Homeodomain...   826   0.0  
Scas_613.11                                                           338   e-110
Sklu_2101.4 YDL106C, Contig c2101 7279-8754 reverse complement        332   e-108
AFL202C [2993] [Homologous to ScYDL106C (PHO2) - SH] (56150..575...   315   e-101
CAGL0L07436g 818510..820057 similar to sp|P07269 Saccharomyces c...   313   e-100
KLLA0D10043g 849549..851015 some similarities with sp|P07269 Sac...   312   e-100
Kwal_23.3494                                                          299   8e-96
KLLA0B01584g complement(125027..126421) weakly similar to sp|P34...    63   3e-10
Kwal_47.18450                                                          58   9e-09
YML027W (YOX1) [3938] chr13 (221406..222563) Protein involved in...    52   6e-07
YDR451C (YHP1) [1270] chr4 complement(1361108..1362169) Protein ...    46   4e-05
Sklu_797.1 YML027W, Contig c797 554-1714 reverse complement            46   5e-05
AER314W [2815] [Homologous to ScYML027W (YOX1) - SH; ScYDR451C (...    46   5e-05
KLLA0C03135g complement(279869..280555) gi|10643642|gb|AAG21094....    44   1e-04
KLLA0B14553g complement(1278622..1279308) sp|Q9HG12 Kluyveromyce...    44   1e-04
AFR643C [3835] [Homologous to ScYCR097W (HMRA1) - SH] (1607899.....    41   2e-04
CAGL0G07249g complement(688189..689226) similar to sp|P34161 Sac...    44   3e-04
ADL394C [1347] [Homologous to ScYCR097W (HMRA1) - NSH] (18058..1...    40   3e-04
Scas_641.12                                                            44   3e-04
Kwal_33.12991                                                          39   0.001
AER456W [2956] [Homologous to ScYCR097W (HMRA1) - NSH] complemen...    37   0.002

>YDL106C (PHO2) [763] chr4 complement(270222..271901) Homeodomain
           protein required for expression of phosphate pathway and
           other genes [1680 bp, 559 aa]
          Length = 559

 Score =  826 bits (2134), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 427/550 (77%), Positives = 427/550 (77%)

Query: 1   MMEEFSYDHDFNTHFATDLDYLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNLEHDHDQ 60
           MMEEFSYDHDFNTHFATDLDYL                              NLEHDHDQ
Sbjct: 1   MMEEFSYDHDFNTHFATDLDYLQHDQQQQQQQQHDQQHNQQQQPQPQPIQTQNLEHDHDQ 60

Query: 61  HTXXXXXXXXXXXXGPQRPKRTRAKGEALDVLKRKFEINPTPSLVERKKISDLIGMPEKN 120
           HT            GPQRPKRTRAKGEALDVLKRKFEINPTPSLVERKKISDLIGMPEKN
Sbjct: 61  HTNDMSASSNASDSGPQRPKRTRAKGEALDVLKRKFEINPTPSLVERKKISDLIGMPEKN 120

Query: 121 VRIWFQNRRAKLRKKQHGSNKDTIPSSQSRDIANDYDRGSTDNNLVTTTSTSSIFHDEDL 180
           VRIWFQNRRAKLRKKQHGSNKDTIPSSQSRDIANDYDRGSTDNNLVTTTSTSSIFHDEDL
Sbjct: 121 VRIWFQNRRAKLRKKQHGSNKDTIPSSQSRDIANDYDRGSTDNNLVTTTSTSSIFHDEDL 180

Query: 181 TFFDRIPLNSNNNYYFFDICSITVGSWNRMKSGALQRRNFQSIKELRNLSPIKINNIMSN 240
           TFFDRIPLNSNNNYYFFDICSITVGSWNRMKSGALQRRNFQSIKELRNLSPIKINNIMSN
Sbjct: 181 TFFDRIPLNSNNNYYFFDICSITVGSWNRMKSGALQRRNFQSIKELRNLSPIKINNIMSN 240

Query: 241 ATDLMVLISKKNSEINYFFSAMANNTKILFRIFFPLSSVTNCSLTLETXXXXXXXXXXXX 300
           ATDLMVLISKKNSEINYFFSAMANNTKILFRIFFPLSSVTNCSLTLET            
Sbjct: 241 ATDLMVLISKKNSEINYFFSAMANNTKILFRIFFPLSSVTNCSLTLETDDDIINSNNTSD 300

Query: 301 XXXXXXXXXXXXXXXXXXXXXXXXXXXRNAKDNFGELKLTVTRSPTFAVYFLNNAPDEDP 360
                                      RNAKDNFGELKLTVTRSPTFAVYFLNNAPDEDP
Sbjct: 301 KNNSNTNNDDDNDDNSNEDNDNSSEDKRNAKDNFGELKLTVTRSPTFAVYFLNNAPDEDP 360

Query: 361 NLNNQWSICDDFSEGRQVNDAFVGGSNIPHTLKGLQKSLRFMNSLILDYKSSNEILPTIN 420
           NLNNQWSICDDFSEGRQVNDAFVGGSNIPHTLKGLQKSLRFMNSLILDYKSSNEILPTIN
Sbjct: 361 NLNNQWSICDDFSEGRQVNDAFVGGSNIPHTLKGLQKSLRFMNSLILDYKSSNEILPTIN 420

Query: 421 TAIPTAAVPQQNIAPPFLNTNSSATDSNPNTNXXXXXXXXXXXXXXXXXXXXXXXXXXXX 480
           TAIPTAAVPQQNIAPPFLNTNSSATDSNPNTN                            
Sbjct: 421 TAIPTAAVPQQNIAPPFLNTNSSATDSNPNTNLEDSLFFDHDLLSSSITNTNNGQGSNNG 480

Query: 481 RQASKDDTLNLLDTTVXXXXXXXXXXXXXXLAQEHLSNDADIVANPNDHLLSLPTDSELP 540
           RQASKDDTLNLLDTTV              LAQEHLSNDADIVANPNDHLLSLPTDSELP
Sbjct: 481 RQASKDDTLNLLDTTVNSNNNHNANNEENHLAQEHLSNDADIVANPNDHLLSLPTDSELP 540

Query: 541 NTPDFLKNTN 550
           NTPDFLKNTN
Sbjct: 541 NTPDFLKNTN 550

>Scas_613.11
          Length = 493

 Score =  338 bits (868), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 181/371 (48%), Positives = 237/371 (63%), Gaps = 41/371 (11%)

Query: 78  RPKRTRAKGEALDVLKRKFEINPTPSLVERKKISDLIGMPEKNVRIWFQNRRAKLRKKQH 137
           + +R RAKGE L++LK  FE+NP PS  ERKKIS+L+GMPEK+VRIWFQNRRAK++K  +
Sbjct: 94  KSRRKRAKGEELNILKSHFELNPNPSNEERKKISNLVGMPEKSVRIWFQNRRAKVKKHNN 153

Query: 138 GSNKDTIPSSQSRDIANDYDRGSTDNNLVTTTSTSSIFHDEDLTFFDRIPLNSNNNYYFF 197
             N++      + +  ND    +TD+N              +  FFDRIP+  N NY F 
Sbjct: 154 LKNRNNANMDSNDEDFNDETSPNTDSN--------------NAKFFDRIPVRINKNYNFI 199

Query: 198 DICSITVGSWNRMKSGALQRRNFQSIKELRNLSPIKINNIMSNATDLMVLISKKNSEINY 257
           D+CSITVGSWNR K G+L   +   +++L NLSP+ +NNIMSN+TDL+VL SKKN EINY
Sbjct: 200 DVCSITVGSWNRKKYGSLLPEDLPIVEKLSNLSPVSMNNIMSNSTDLIVLTSKKNDEINY 259

Query: 258 FFSAMANNTKILFRIFFPLSSVTNCSLTLETXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 317
           FFSAMAN+TKILFRIFFP+SSV NCSL+LET                             
Sbjct: 260 FFSAMANDTKILFRIFFPISSVKNCSLSLETDDDIITNNNVTNSS--------------- 304

Query: 318 XXXXXXXXXXRNAKDNFGELKLTVTRSPTFAVYFLNNAPDEDPNLNNQWSICDDFSEGRQ 377
                      +  +  GELKL +T+ PTFAVYF+ +  +E     NQWSIC+DFSEG+Q
Sbjct: 305 -----------DTSERLGELKLILTKPPTFAVYFIKSDENETVPSINQWSICEDFSEGKQ 353

Query: 378 VNDAFVGGSNIPHTLKGLQKSLRFMNSLILDYKSSNEILPTINTAIPTAAVPQQNIAPPF 437
           V DAF+GGSN+PH L GLQ SL+F+NS IL+YKS+NEILP     +P+  +   ++  P 
Sbjct: 354 VTDAFIGGSNLPHVLSGLQDSLKFLNSHILEYKSTNEILPPSTITVPSHQLQSHDLMTP- 412

Query: 438 LNTNSSATDSN 448
           +  +SS+T +N
Sbjct: 413 MQYSSSSTGTN 423

>Sklu_2101.4 YDL106C, Contig c2101 7279-8754 reverse complement
          Length = 491

 Score =  332 bits (851), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 184/363 (50%), Positives = 227/363 (62%), Gaps = 54/363 (14%)

Query: 75  GPQRPKRTRAKGEALDVLKRKFEINPTPSLVERKKISDLIGMPEKNVRIWFQNRRAKLRK 134
           G  + KRTRA GEAL +LKR+F++NP P+   RK+ISD+  +PEKNVRIWFQNRRAK RK
Sbjct: 69  GKPKTKRTRATGEALAILKREFDVNPNPNAQNRKRISDMTNLPEKNVRIWFQNRRAKFRK 128

Query: 135 KQHGSNKDTIPSSQSRDIANDYDRGSTDNNLVTTTSTSSIFHDEDLTF-FDRIPLNSNNN 193
                 ++  PS+              D N + + S         LT  FDRIPLN NNN
Sbjct: 129 ---SGRQNPRPSA-------------LDMNGIGSLS---------LTVDFDRIPLNINNN 163

Query: 194 YYFFDICSITVGSWNRMKSGALQRRNFQSIKELRNLSPIKINNIMSNATDLMVLISKKNS 253
           YYF D+ S+TVGSW R+KSG L + +  +IK+L NLSPI IN+IMSN+TDLMVLISKKN 
Sbjct: 164 YYFLDVSSLTVGSWKRLKSGNLDKESLPNIKDLSNLSPISINDIMSNSTDLMVLISKKNF 223

Query: 254 EINYFFSAMANNTKILFRIFFPLSSVTNCSLTLETXXXXXXXXXXXXXXXXXXXXXXXXX 313
           EINYFFSA+ANNTKILFRIFFP++SV NCSL+ E                          
Sbjct: 224 EINYFFSAIANNTKILFRIFFPINSVVNCSLSFEA------------------------- 258

Query: 314 XXXXXXXXXXXXXXRNAKDNFGELKLTVTRSPTFAVYFLNNAPDEDPNLNNQWSICDDFS 373
                         ++  +   ELKLTV++SP FAVYF +     +   +NQWSIC+DFS
Sbjct: 259 DSIRKENEDQDEQDQDPSEKTCELKLTVSKSPKFAVYFSDAV---EHFTSNQWSICEDFS 315

Query: 374 EGRQVNDAFVGGSNIPHTLKGLQKSLRFMNSLILDYKSSNEILPTINTAIPTAAVPQQNI 433
           EGRQV+DAFVGGSN+PH L GL+ SL+FMNSLILDY S+N+I+P      P A   Q  I
Sbjct: 316 EGRQVSDAFVGGSNLPHVLNGLEDSLKFMNSLILDYNSTNQIIPPPTVTQPHAVSQQSMI 375

Query: 434 APP 436
             P
Sbjct: 376 LQP 378

>AFL202C [2993] [Homologous to ScYDL106C (PHO2) - SH] (56150..57595)
           [1446 bp, 481 aa]
          Length = 481

 Score =  315 bits (806), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 171/343 (49%), Positives = 210/343 (61%), Gaps = 47/343 (13%)

Query: 75  GPQRPKRTRAKGEALDVLKRKFEINPTPSLVERKKISDLIGMPEKNVRIWFQNRRAKLRK 134
           G  + KRTRA GEAL++LK++F+INP P+   RK+IS+  G+PEKNVRIWFQNRRAK RK
Sbjct: 58  GKPKSKRTRATGEALELLKKEFDINPNPNAQNRKRISEQTGLPEKNVRIWFQNRRAKYRK 117

Query: 135 KQHGSNKDTIPSSQSRDIANDYDRGSTDNNLVTTTSTSSIFHDEDLTFFDRIPLNSNNNY 194
                N+ T                +TD N   + S +          +D+IPLN N+NY
Sbjct: 118 SDRTFNQRT---------------AATDMNTFGSISVT--------VEYDKIPLNINDNY 154

Query: 195 YFFDICSITVGSWNRMKSGALQRRNFQSIKELRNLSPIKINNIMSNATDLMVLISKKNSE 254
           YF D  S+TVGSW R+KSG L R +  +IK L NLSP  IN IMSNATDLMVLISKKN E
Sbjct: 155 YFIDANSLTVGSWKRLKSGNLHRESLSNIKYLSNLSPTSINMIMSNATDLMVLISKKNFE 214

Query: 255 INYFFSAMANNTKILFRIFFPLSSVTNCSLTLETXXXXXXXXXXXXXXXXXXXXXXXXXX 314
           +NYFFSA+ANNTKILFRIFFP++SV NCSL L                            
Sbjct: 215 VNYFFSAIANNTKILFRIFFPINSVLNCSLLLHAEGGKKDEDDANNVVQETTAP------ 268

Query: 315 XXXXXXXXXXXXXRNAKDNFGELKLTVTRSPTFAVYFLNNAPDEDPNLNNQWSICDDFSE 374
                          A +   ELKL V++ P FAVYF   +   D   +NQWSIC+DFSE
Sbjct: 269 ---------------AAEQVCELKLNVSKPPNFAVYF---SDMNDELTSNQWSICEDFSE 310

Query: 375 GRQVNDAFVGGSNIPHTLKGLQKSLRFMNSLILDYKSSNEILP 417
           GRQV+DA+VGGSN PH L GL+ SL+FM+SLILDY S+  ++P
Sbjct: 311 GRQVSDAYVGGSNFPHVLTGLEASLKFMSSLILDYNSTTHVVP 353

>CAGL0L07436g 818510..820057 similar to sp|P07269 Saccharomyces
           cerevisiae YDL106c GRF10 homeodomain protein,
           hypothetical start
          Length = 515

 Score =  313 bits (803), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 178/384 (46%), Positives = 229/384 (59%), Gaps = 57/384 (14%)

Query: 75  GPQRPKRTRAKGEALDVLKRKFEINPTPSLVERKKISDLIGMPEKNVRIWFQNRRAKLRK 134
           G  + KRTRAKGE+LD+LK  F++NP PSL ER +IS+L GMPEKNVRIWFQNRRAK+RK
Sbjct: 3   GHTKSKRTRAKGESLDILKSSFQLNPNPSLQERNRISELTGMPEKNVRIWFQNRRAKVRK 62

Query: 135 K-QHGSNKDTIPSSQSRDIAND----------------YDRGSTDNNLVTTTSTSSIFHD 177
           K +   +K  +   +SR ++                    R        T T+  +    
Sbjct: 63  KGKLDGDKPKLHDGESRVVSGTGAGAGTATAGPGAGAGVTRTQGTATRTTATTDVTTVDT 122

Query: 178 EDLTFFDRIPLNSNNNYYFFDICSITVGSWNRMKSGALQRRNFQSIKELRNLSPIKINNI 237
               +FD++PLN NNNYYF D+ SITVGSWNRMKSG+L   +   +K+L NLSP+ +N +
Sbjct: 123 SGPPYFDKLPLNINNNYYFIDVFSITVGSWNRMKSGSLTANSLPVVKDLPNLSPVSMNQL 182

Query: 238 MSNATDLMVLISKKNSEINYFFSAMANNTKILFRIFFPLSSVTNCSLTLETXXXXXXXXX 297
           MS+ATDLMV+ISKKN EINYFFSAMANNTKILFRIFF +++V +CSL+ +          
Sbjct: 183 MSDATDLMVVISKKNFEINYFFSAMANNTKILFRIFFRINTVASCSLSFDKTDEEINNRT 242

Query: 298 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRNAKDNFGELKLTVTRSPTFAVYFLNNAPD 357
                                          +  +   ELKL V + P FAVYFLN   +
Sbjct: 243 -------------------------------DPANKQAELKLKVNKPPKFAVYFLNQPEN 271

Query: 358 EDPNLNNQWSICDDFSEGRQVNDAFVGGSNIPHTLKGLQKSLRFMNSLILDYKSSNEILP 417
              N  NQW +C+DFSEG+QVNDAFVGGSN+PH LKGL+ SL+ +NSLILDY S+N+ + 
Sbjct: 272 ---NNTNQWCLCEDFSEGKQVNDAFVGGSNVPHVLKGLESSLKILNSLILDYISTNDTIT 328

Query: 418 TINTAIPTAAV------PQQNIAP 435
           +     P   V      PQ + AP
Sbjct: 329 SAPLPPPPTNVGSDILHPQMHPAP 352

>KLLA0D10043g 849549..851015 some similarities with sp|P07269
           Saccharomyces cerevisiae YDL106c GRF10 homeodomain
           protein singleton, hypothetical start
          Length = 488

 Score =  312 bits (799), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 170/338 (50%), Positives = 210/338 (62%), Gaps = 48/338 (14%)

Query: 81  RTRAKGEALDVLKRKFEINPTPSLVERKKISDLIGMPEKNVRIWFQNRRAKLRKKQHGSN 140
           RTRA GEAL++LKR+F++NP+P+   RK+IS++ G+PEKNVRIWFQNRR+K RK     N
Sbjct: 101 RTRATGEALEILKREFQLNPSPNAQNRKRISEMTGLPEKNVRIWFQNRRSKYRKSDKRMN 160

Query: 141 KDTIPSSQSRDIANDYDRGSTDNNLVTTTSTSSIFHDEDLTFFDRIPLNSNNNYYFFDIC 200
                             G+TDN    TT  SS         FD+IPL  N++YYF DI 
Sbjct: 161 GP----------------GATDN----TTLVSSFE-------FDKIPLAINSSYYFIDIS 193

Query: 201 SITVGSWNRMKSGALQRRNFQSIKELRNLSPIKINNIMSNATDLMVLISKKNSEINYFFS 260
           S+TVGSW R+KSG L+  +   I++L NLSPI IN IM+NATDLMVLISKKN EINYFFS
Sbjct: 194 SLTVGSWKRLKSGNLRSDSLPQIQKLSNLSPISINTIMANATDLMVLISKKNFEINYFFS 253

Query: 261 AMANNTKILFRIFFPLSSVTNCSLTLETXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 320
           A+ANNTKILFRIFFP+++V NCSL+L+                                 
Sbjct: 254 AIANNTKILFRIFFPINTVVNCSLSLDNTESLKGDAKNSNSPSSLDGNNDTNSSK----- 308

Query: 321 XXXXXXXRNAKDNFGELKLTVTRSPTFAVYFLNNAPDEDPNLNNQWSICDDFSEGRQVND 380
                          EL+L++++SP FAVYF     D     +NQWSIC+DFSEGRQVND
Sbjct: 309 -------------LAELRLSLSKSPKFAVYFSETIDDAS---SNQWSICEDFSEGRQVND 352

Query: 381 AFVGGSNIPHTLKGLQKSLRFMNSLILDYKSSNEILPT 418
           AF+GGSNIPH L GL +SL+FMNSLILD  S+    PT
Sbjct: 353 AFIGGSNIPHVLTGLDESLKFMNSLILDMNSTEHFPPT 390

>Kwal_23.3494
          Length = 466

 Score =  299 bits (766), Expect = 8e-96,   Method: Compositional matrix adjust.
 Identities = 162/339 (47%), Positives = 210/339 (61%), Gaps = 57/339 (16%)

Query: 78  RPKRTRAKGEALDVLKRKFEINPTPSLVERKKISDLIGMPEKNVRIWFQNRRAKLRKKQH 137
           R KRTRA GEAL+VLKR+F+ NP P+   RK+IS+L G+PEKNVRIWFQNRRAK RK   
Sbjct: 54  RTKRTRATGEALNVLKREFDQNPNPNAQNRKRISELTGLPEKNVRIWFQNRRAKHRKSDR 113

Query: 138 GSNKDTIPSSQSRDIANDYDRGSTDNNLVTTTSTSSIFHDEDLTFFDRIPLNSNNNYYFF 197
           G  +     S + D+A +               T +I        FDRIPL+SN+NY F 
Sbjct: 114 GGTR----GSATTDVAGE--------------PTGAI----PALDFDRIPLDSNSNYCFI 151

Query: 198 DICSITVGSWNRMKSGALQRRNFQSIKELRNLSPIKINNIMSNATDLMVLISKKNSEINY 257
           D+ S+TVGSW R+KSG L++ +  +++ L NLSP+ IN IM+NATDLMVLISKKN EINY
Sbjct: 152 DVKSLTVGSWKRLKSGNLKQDDLPTVQRLSNLSPVSINEIMANATDLMVLISKKNHEINY 211

Query: 258 FFSAMANNTKILFRIFFPLSSVTNCSLTLETXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 317
           FFSA+ANNTKILFRIFFP+++  +C+L+  T                             
Sbjct: 212 FFSAIANNTKILFRIFFPITTTVDCALSATTDGAESVRS--------------------- 250

Query: 318 XXXXXXXXXXRNAKDNFGELKLTVTRSPTFAVYFLNNAPDEDPNLNNQWSICDDFSEGRQ 377
                      +A +   EL+L ++++PTFAVYF + A   D   +NQWSIC+DFSE RQ
Sbjct: 251 -----------DAHNKLCELRLNLSKAPTFAVYFSDGA---DQFSSNQWSICEDFSEERQ 296

Query: 378 VNDAFVGGSNIPHTLKGLQKSLRFMNSLILDYKSSNEIL 416
           V++AF+GG NIPH L GL+ SL FM S I D+ S   +L
Sbjct: 297 VSEAFIGGLNIPHILTGLESSLSFMCSSIQDHNSGAHVL 335

>KLLA0B01584g complement(125027..126421) weakly similar to sp|P34161
           Saccharomyces cerevisiae YML027w YOX1 homoeodomain
           protein, start by similarity
          Length = 464

 Score = 62.8 bits (151), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 37/58 (63%)

Query: 78  RPKRTRAKGEALDVLKRKFEINPTPSLVERKKISDLIGMPEKNVRIWFQNRRAKLRKK 135
           R KR R      D+LK++FE+NP PS   R ++S +  M EK V++WFQNRR   RKK
Sbjct: 210 RRKRRRTSKNESDILKKEFEVNPAPSKERRSELSIICNMSEKAVQVWFQNRRQNFRKK 267

>Kwal_47.18450
          Length = 370

 Score = 57.8 bits (138), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 27/72 (37%), Positives = 44/72 (61%)

Query: 78  RPKRTRAKGEALDVLKRKFEINPTPSLVERKKISDLIGMPEKNVRIWFQNRRAKLRKKQH 137
           R KR R     L++L+ +FE+ PTP   +R ++S+   M EK ++IWFQN+R  ++++Q 
Sbjct: 160 RRKRRRTSKHELNILQSEFELCPTPDKFKRIELSERCCMSEKAIQIWFQNKRQSVKRQQK 219

Query: 138 GSNKDTIPSSQS 149
                T+PS  S
Sbjct: 220 AVTDTTLPSDNS 231

>YML027W (YOX1) [3938] chr13 (221406..222563) Protein involved in
           transcriptional derepression during the M/G1 phase of
           the cell cycle along with Yhp1p, contains homeodomain
           [1158 bp, 385 aa]
          Length = 385

 Score = 52.0 bits (123), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 42/66 (63%)

Query: 78  RPKRTRAKGEALDVLKRKFEINPTPSLVERKKISDLIGMPEKNVRIWFQNRRAKLRKKQH 137
           R KR R   + L +L+ +FE  P PS  +R ++++   M EK V+IWFQN+R  +++++ 
Sbjct: 177 RRKRRRTSSQELSILQAEFEKCPAPSKEKRIELAESCHMTEKAVQIWFQNKRQAVKRQRI 236

Query: 138 GSNKDT 143
            ++K T
Sbjct: 237 ATSKST 242

>YDR451C (YHP1) [1270] chr4 complement(1361108..1362169) Protein
           involved in transcriptional derepression during the M/G1
           phase of the cell cycle along with Yox1p, contains a
           homeodomain [1062 bp, 353 aa]
          Length = 353

 Score = 46.2 bits (108), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 34/52 (65%)

Query: 89  LDVLKRKFEINPTPSLVERKKISDLIGMPEKNVRIWFQNRRAKLRKKQHGSN 140
           L +L+  F+  PTP+  +R ++S+   M EK+V+IWFQN+R   +K ++  N
Sbjct: 185 LGILQTAFDECPTPNKAKRIELSEQCNMSEKSVQIWFQNKRQAAKKHKNSGN 236

>Sklu_797.1 YML027W, Contig c797 554-1714 reverse complement
          Length = 386

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 34/57 (59%)

Query: 78  RPKRTRAKGEALDVLKRKFEINPTPSLVERKKISDLIGMPEKNVRIWFQNRRAKLRK 134
           R KR R     L++L+ +FE   TP   +R +++    M EK V+IWFQN+R  ++K
Sbjct: 170 RRKRRRTSKNELNILQAEFEACSTPDKQKRIELAQRCSMSEKAVQIWFQNKRQSVKK 226

>AER314W [2815] [Homologous to ScYML027W (YOX1) - SH; ScYDR451C
           (YHP1) - SH] complement(1218410..1219705) [1296 bp, 431
           aa]
          Length = 431

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 78  RPKRTRAKGEALDVLKRKFEINPTPSLVERKKISDLIGMPEKNVRIWFQNRRAKLRKKQH 137
           R KR R     L +L+++F+   TPS  +R +++    M EK V+IWFQN+R  ++KK+ 
Sbjct: 198 RRKRRRTSKHELTILQQEFDQCRTPSKEKRIELATRCNMTEKAVQIWFQNKRQSMKKKRK 257

Query: 138 GSN-KDTIPSS 147
             +  D +PS+
Sbjct: 258 ERDFADRLPST 268

>KLLA0C03135g complement(279869..280555)
           gi|10643642|gb|AAG21094.1|AF195067_2 Kluyveromyces
           lactis a1p, start by similarity
          Length = 228

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 37/64 (57%), Gaps = 2/64 (3%)

Query: 80  KRTRAKGEALDVLKRKFEINPTPSLVERKKISDLIGMPEKNVRIWFQNRRAKLRKKQHGS 139
           KR+  K E+  +L++ F++   P+  ER  I+  + +    VRIWF N+R  +R K+H +
Sbjct: 158 KRSFIKHESRGILEKIFKVKQCPNTSERLYIAQKLDLTPSQVRIWFTNKR--MRAKKHTT 215

Query: 140 NKDT 143
            K T
Sbjct: 216 GKGT 219

>KLLA0B14553g complement(1278622..1279308) sp|Q9HG12 Kluyveromyces
           lactis A1p, start by similarity
          Length = 228

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 37/64 (57%), Gaps = 2/64 (3%)

Query: 80  KRTRAKGEALDVLKRKFEINPTPSLVERKKISDLIGMPEKNVRIWFQNRRAKLRKKQHGS 139
           KR+  K E+  +L++ F++   P+  ER  I+  + +    VRIWF N+R  +R K+H +
Sbjct: 158 KRSFIKHESRGILEKIFKVKQCPNTSERLYIAQKLDLTPSQVRIWFTNKR--MRAKKHTT 215

Query: 140 NKDT 143
            K T
Sbjct: 216 GKGT 219

>AFR643C [3835] [Homologous to ScYCR097W (HMRA1) - SH]
           (1607899..1608207) [309 bp, 102 aa]
          Length = 102

 Score = 40.8 bits (94), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 21/65 (32%), Positives = 35/65 (53%), Gaps = 2/65 (3%)

Query: 75  GPQRPKRTRAKGEALDVLKRKFEINPTPSLVERKKISDLIGMPEKNVRIWFQNRRAKLRK 134
           G ++ +RT    E  + L+  FE    P+  ER+ I++  G+    +RIWF N+R  +R 
Sbjct: 38  GDKQRRRTVLPKETKEFLESVFERKRWPNAKERRAIAEKCGLTPIQIRIWFTNKR--MRS 95

Query: 135 KQHGS 139
           K  G+
Sbjct: 96  KTRGA 100

>CAGL0G07249g complement(688189..689226) similar to sp|P34161
           Saccharomyces cerevisiae YML027w YOX1 homoeodomain
           protein, start by similarity
          Length = 345

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 45/89 (50%), Gaps = 10/89 (11%)

Query: 78  RPKRTRAKGEALDVLKRKFEINPTPSLVERKKISDLIGMPEKNVRIWFQNRRAKL----- 132
           R KR R   + L++L+ +F+   TP    R  ++    M EK V++WFQN+R  +     
Sbjct: 155 RRKRRRTSSQELNILQAEFQRCSTPDKQTRINLAQRCNMTEKAVQVWFQNKRQAMKRHKV 214

Query: 133 ----RKKQHGSNKDTIPSSQSRDIANDYD 157
               R + +GS   T P + SR  + D++
Sbjct: 215 IADNRSRSNGSTTSTTPLA-SRTPSEDFN 242

>ADL394C [1347] [Homologous to ScYCR097W (HMRA1) - NSH]
           (18058..18366) [309 bp, 102 aa]
          Length = 102

 Score = 40.4 bits (93), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 21/65 (32%), Positives = 34/65 (52%), Gaps = 2/65 (3%)

Query: 75  GPQRPKRTRAKGEALDVLKRKFEINPTPSLVERKKISDLIGMPEKNVRIWFQNRRAKLRK 134
           G  + +RT    E  + L+  FE    P+  ER+ I++  G+    +RIWF N+R  +R 
Sbjct: 38  GDNQRRRTVLPKEPKEFLESVFERKRCPNAKERRAIAEKCGLTPIQIRIWFTNKR--MRS 95

Query: 135 KQHGS 139
           K  G+
Sbjct: 96  KTRGA 100

>Scas_641.12
          Length = 413

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 33/57 (57%)

Query: 78  RPKRTRAKGEALDVLKRKFEINPTPSLVERKKISDLIGMPEKNVRIWFQNRRAKLRK 134
           R KR R     L +L+ +FE   TPS   R +++    M +K V+IWFQN+R  +++
Sbjct: 184 RRKRRRTSSHELSILQAEFEKCSTPSKQVRLELAKRCSMTDKAVQIWFQNKRQSMKR 240

>Kwal_33.12991
          Length = 91

 Score = 38.5 bits (88), Expect = 0.001,   Method: Composition-based stats.
 Identities = 19/50 (38%), Positives = 27/50 (54%)

Query: 80  KRTRAKGEALDVLKRKFEINPTPSLVERKKISDLIGMPEKNVRIWFQNRR 129
           +RT    +    L+  FE   +P+  ERK I+D  G+    VR+WF NRR
Sbjct: 40  RRTLFSKDTRLFLESVFEKKKSPNSRERKAIADKCGLTPVQVRVWFTNRR 89

>AER456W [2956] [Homologous to ScYCR097W (HMRA1) - NSH]
           complement(1512285..1512285,1512359..1512531) [174 bp,
           57 aa]
          Length = 57

 Score = 36.6 bits (83), Expect = 0.002,   Method: Composition-based stats.
 Identities = 20/61 (32%), Positives = 32/61 (52%), Gaps = 8/61 (13%)

Query: 79  PKRTRAKGEALDVLKRKFEINPTPSLVERKKISDLIGMPEKNVRIWFQNRRAKLRKKQHG 138
           PK T+      + L+  FE    P+  ER+ I++  G+    +RIWF N+R  +R K  G
Sbjct: 3   PKETK------EFLESVFERKRCPNAKERRAIAEKCGLTPIQIRIWFTNKR--MRSKTRG 54

Query: 139 S 139
           +
Sbjct: 55  A 55

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.131    0.378 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 15,787,918
Number of extensions: 648162
Number of successful extensions: 2265
Number of sequences better than 10.0: 39
Number of HSP's gapped: 2325
Number of HSP's successfully gapped: 46
Length of query: 550
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 443
Effective length of database: 12,891,983
Effective search space: 5711148469
Effective search space used: 5711148469
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 64 (29.3 bits)