Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YBR221C (PDB1)36636019030.0
Scas_686.2241636116490.0
CAGL0K06831g35834816190.0
KLLA0F09603g35435216070.0
Kwal_14.178936333516010.0
Sklu_2171.436233315930.0
AAR167C35933015820.0
Sklu_2101.356869710.94
YGR186W (TFG1)735196654.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YBR221C
         (360 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YBR221C (PDB1) [402] chr2 complement(665110..666210) Pyruvate de...   737   0.0  
Scas_686.22                                                           639   0.0  
CAGL0K06831g complement(665672..666748) highly similar to sp|P32...   628   0.0  
KLLA0F09603g complement(882778..883842) highly similar to sp|P32...   623   0.0  
Kwal_14.1789                                                          621   0.0  
Sklu_2171.4 YBR221C, Contig c2171 8787-9875                           618   0.0  
AAR167C [355] [Homologous to ScYBR221C (PDB1) - SH] (642620..643...   613   0.0  
Sklu_2101.3 YMR171C, Contig c2101 5004-6710                            32   0.94 
YGR186W (TFG1) [2137] chr7 (867777..869984) RNA polymerase II tr...    30   4.0  

>YBR221C (PDB1) [402] chr2 complement(665110..666210) Pyruvate
           dehydrogenase complex, E1-beta subunit
           (pyruvate:lipoamide 2-oxidoreductase) [1101 bp, 366 aa]
          Length = 366

 Score =  737 bits (1903), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/360 (100%), Positives = 360/360 (100%)

Query: 1   MFSRLPTSLARNVARRAPTSFVRPSAAAAALRFSSTKTMTVREALNSAMAEELDRDDDVF 60
           MFSRLPTSLARNVARRAPTSFVRPSAAAAALRFSSTKTMTVREALNSAMAEELDRDDDVF
Sbjct: 1   MFSRLPTSLARNVARRAPTSFVRPSAAAAALRFSSTKTMTVREALNSAMAEELDRDDDVF 60

Query: 61  LIGEEVAQYNGAYKVSKGLLDRFGERRVVDTPITEYGFTGLAVGAALKGLKPIVEFMSFN 120
           LIGEEVAQYNGAYKVSKGLLDRFGERRVVDTPITEYGFTGLAVGAALKGLKPIVEFMSFN
Sbjct: 61  LIGEEVAQYNGAYKVSKGLLDRFGERRVVDTPITEYGFTGLAVGAALKGLKPIVEFMSFN 120

Query: 121 FSMQAIDHVVNSAAKTHYMSGGTQKCQMVFRGPNGAAVGVGAQHSQDFSPWYGSIPGLKV 180
           FSMQAIDHVVNSAAKTHYMSGGTQKCQMVFRGPNGAAVGVGAQHSQDFSPWYGSIPGLKV
Sbjct: 121 FSMQAIDHVVNSAAKTHYMSGGTQKCQMVFRGPNGAAVGVGAQHSQDFSPWYGSIPGLKV 180

Query: 181 LVPYSAEDARGLLKAAIRDPNPVVFLENELLYGESFEISEEALSPEFTLPYKAKIEREGT 240
           LVPYSAEDARGLLKAAIRDPNPVVFLENELLYGESFEISEEALSPEFTLPYKAKIEREGT
Sbjct: 181 LVPYSAEDARGLLKAAIRDPNPVVFLENELLYGESFEISEEALSPEFTLPYKAKIEREGT 240

Query: 241 DISIVTYTRNVQFSLEAAEILQKKYGVSAEVINLRSIRPLDTEAIIKTVKKTNHLITVES 300
           DISIVTYTRNVQFSLEAAEILQKKYGVSAEVINLRSIRPLDTEAIIKTVKKTNHLITVES
Sbjct: 241 DISIVTYTRNVQFSLEAAEILQKKYGVSAEVINLRSIRPLDTEAIIKTVKKTNHLITVES 300

Query: 301 TFPSFGVGAEIVAQVMESEAFDYLDAPIQRVTGADVPTPYAKELEDFAFPDTPTIVKAVK 360
           TFPSFGVGAEIVAQVMESEAFDYLDAPIQRVTGADVPTPYAKELEDFAFPDTPTIVKAVK
Sbjct: 301 TFPSFGVGAEIVAQVMESEAFDYLDAPIQRVTGADVPTPYAKELEDFAFPDTPTIVKAVK 360

>Scas_686.22
          Length = 416

 Score =  639 bits (1649), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/361 (86%), Positives = 335/361 (92%), Gaps = 8/361 (2%)

Query: 1   MFSRLP-TSLARNVARRAPTSFVRPSAAAAALRFSSTKTMTVREALNSAMAEELDRDDDV 59
           M  RLP T++ R +A  +P  F        ALR++S+KTMTVREALN+AMAEELDRDDDV
Sbjct: 57  MSFRLPFTNVTRRIASSSPLRF-------QALRYASSKTMTVREALNTAMAEELDRDDDV 109

Query: 60  FLIGEEVAQYNGAYKVSKGLLDRFGERRVVDTPITEYGFTGLAVGAALKGLKPIVEFMSF 119
           F+IGEEVAQYNGAYKV+KGLLDRFGERRVVDTPITE GFTGLAVGAALKGLKPIVEFMSF
Sbjct: 110 FIIGEEVAQYNGAYKVTKGLLDRFGERRVVDTPITEMGFTGLAVGAALKGLKPIVEFMSF 169

Query: 120 NFSMQAIDHVVNSAAKTHYMSGGTQKCQMVFRGPNGAAVGVGAQHSQDFSPWYGSIPGLK 179
           NFSMQAID VVNSAAKTHYMSGGTQKCQ+VFRGPNG+AVGV AQHSQD+S WYGSIPGLK
Sbjct: 170 NFSMQAIDQVVNSAAKTHYMSGGTQKCQIVFRGPNGSAVGVAAQHSQDYSAWYGSIPGLK 229

Query: 180 VLVPYSAEDARGLLKAAIRDPNPVVFLENELLYGESFEISEEALSPEFTLPYKAKIEREG 239
           VLVPYSAEDARGLLKAAIRDPNPVVFLENELLYGESFEIS+EALSP+FTLPYKAK+EREG
Sbjct: 230 VLVPYSAEDARGLLKAAIRDPNPVVFLENELLYGESFEISDEALSPDFTLPYKAKVEREG 289

Query: 240 TDISIVTYTRNVQFSLEAAEILQKKYGVSAEVINLRSIRPLDTEAIIKTVKKTNHLITVE 299
           TDISI+TYTRNVQFSLEAA IL+K+YGVS EVINLRSIRPLD +AI+KTVKKTNHLITVE
Sbjct: 290 TDISIITYTRNVQFSLEAAAILEKQYGVSVEVINLRSIRPLDVDAIVKTVKKTNHLITVE 349

Query: 300 STFPSFGVGAEIVAQVMESEAFDYLDAPIQRVTGADVPTPYAKELEDFAFPDTPTIVKAV 359
           STFPSFGVGAEI+A+VMESEAFDYLDAPIQRVTGADVPTPYAKELEDFAFPD  TIV+AV
Sbjct: 350 STFPSFGVGAEIIARVMESEAFDYLDAPIQRVTGADVPTPYAKELEDFAFPDPDTIVRAV 409

Query: 360 K 360
           K
Sbjct: 410 K 410

>CAGL0K06831g complement(665672..666748) highly similar to sp|P32473
           Saccharomyces cerevisiae YBR221c Pyruvate dehydrogenase,
           hypothetical start
          Length = 358

 Score =  628 bits (1619), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/348 (86%), Positives = 325/348 (93%), Gaps = 3/348 (0%)

Query: 16  RAPTSFVRPSAAAA---ALRFSSTKTMTVREALNSAMAEELDRDDDVFLIGEEVAQYNGA 72
           R P + + P A  A   A+R +STKTMTVREALNSA+AEELDRDDDVF+IGEEVAQYNGA
Sbjct: 5   RTPLTRLTPMARLATRSAVRMASTKTMTVREALNSALAEELDRDDDVFIIGEEVAQYNGA 64

Query: 73  YKVSKGLLDRFGERRVVDTPITEYGFTGLAVGAALKGLKPIVEFMSFNFSMQAIDHVVNS 132
           YKV+KGLLDRFGERRVVDTPITEYGF GLAVGAALKGLKPIVEFMSFNFSMQAIDHVVNS
Sbjct: 65  YKVTKGLLDRFGERRVVDTPITEYGFAGLAVGAALKGLKPIVEFMSFNFSMQAIDHVVNS 124

Query: 133 AAKTHYMSGGTQKCQMVFRGPNGAAVGVGAQHSQDFSPWYGSIPGLKVLVPYSAEDARGL 192
           AAKTHYMSGGTQKCQ+VFRGPNG+AVGV AQHSQD+S WYGSIPGLKVLVPYSAEDARGL
Sbjct: 125 AAKTHYMSGGTQKCQIVFRGPNGSAVGVAAQHSQDYSAWYGSIPGLKVLVPYSAEDARGL 184

Query: 193 LKAAIRDPNPVVFLENELLYGESFEISEEALSPEFTLPYKAKIEREGTDISIVTYTRNVQ 252
           LKAAIRDPNPVVFLENELLYGE FE+SEEALSP+FTLPY AK+E+EG DISI+TYTRN +
Sbjct: 185 LKAAIRDPNPVVFLENELLYGEQFEVSEEALSPDFTLPYTAKVEKEGKDISIITYTRNTE 244

Query: 253 FSLEAAEILQKKYGVSAEVINLRSIRPLDTEAIIKTVKKTNHLITVESTFPSFGVGAEIV 312
           FSL AA+IL++KYGVSAEVINLRSIRPLD +AI+KTVKKTNHLITVESTFPSFGVGAEI+
Sbjct: 245 FSLAAAKILEEKYGVSAEVINLRSIRPLDIDAIVKTVKKTNHLITVESTFPSFGVGAEII 304

Query: 313 AQVMESEAFDYLDAPIQRVTGADVPTPYAKELEDFAFPDTPTIVKAVK 360
           AQVMESEAFDYLDAPIQRVTGADVPTPYAKELEDFAFPD  TIV+A K
Sbjct: 305 AQVMESEAFDYLDAPIQRVTGADVPTPYAKELEDFAFPDPETIVRAAK 352

>KLLA0F09603g complement(882778..883842) highly similar to sp|P32473
           Saccharomyces cerevisiae YBR221c PDB1 pyruvate
           dehydrogenase (lipoamide) beta chain precursor
           singleton, start by similarity
          Length = 354

 Score =  623 bits (1607), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/352 (84%), Positives = 328/352 (93%), Gaps = 6/352 (1%)

Query: 9   LARNVARRAPTSFVRPSAAAAALRFSSTKTMTVREALNSAMAEELDRDDDVFLIGEEVAQ 68
           +  N  +RA  S V+      ++RF+STKTMTVREALNSAMAEE+DRDDDVF+IGEEVAQ
Sbjct: 3   MLSNTFKRAVPSVVQ------SMRFASTKTMTVREALNSAMAEEMDRDDDVFIIGEEVAQ 56

Query: 69  YNGAYKVSKGLLDRFGERRVVDTPITEYGFTGLAVGAALKGLKPIVEFMSFNFSMQAIDH 128
           YNGAYKV+KGLLDRFGERRVVDTPITE GFTGLAVGAALKGLKPIVEFMSFNFSMQA+D 
Sbjct: 57  YNGAYKVTKGLLDRFGERRVVDTPITEMGFTGLAVGAALKGLKPIVEFMSFNFSMQAMDQ 116

Query: 129 VVNSAAKTHYMSGGTQKCQMVFRGPNGAAVGVGAQHSQDFSPWYGSIPGLKVLVPYSAED 188
           V+NSAAKT+YMSGGTQKCQ+VFRGPNG+AVGV AQHSQD+S WYGS+PG+KVLVPYSAED
Sbjct: 117 VINSAAKTYYMSGGTQKCQIVFRGPNGSAVGVAAQHSQDYSAWYGSVPGMKVLVPYSAED 176

Query: 189 ARGLLKAAIRDPNPVVFLENELLYGESFEISEEALSPEFTLPYKAKIEREGTDISIVTYT 248
           ARGLLKAAIRDPNPVVFLENELLYG+SFE+SEE+LS +FTLPYKAK+EREG+DISI++YT
Sbjct: 177 ARGLLKAAIRDPNPVVFLENELLYGQSFEVSEESLSTDFTLPYKAKVEREGSDISIISYT 236

Query: 249 RNVQFSLEAAEILQKKYGVSAEVINLRSIRPLDTEAIIKTVKKTNHLITVESTFPSFGVG 308
           RNVQFSLEAAEIL K+YGVSAEVINLR+IRPLD EAII TVKKTNHLITVESTFP+FGVG
Sbjct: 237 RNVQFSLEAAEILSKQYGVSAEVINLRAIRPLDVEAIINTVKKTNHLITVESTFPAFGVG 296

Query: 309 AEIVAQVMESEAFDYLDAPIQRVTGADVPTPYAKELEDFAFPDTPTIVKAVK 360
           AEI+AQ+MESEAFDYLDAPIQRVTGA+VPTPYAKELEDFAFPD  TIV+A K
Sbjct: 297 AEIIAQIMESEAFDYLDAPIQRVTGAEVPTPYAKELEDFAFPDPDTIVRAAK 348

>Kwal_14.1789
          Length = 363

 Score =  621 bits (1601), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/335 (88%), Positives = 317/335 (94%)

Query: 26  AAAAALRFSSTKTMTVREALNSAMAEELDRDDDVFLIGEEVAQYNGAYKVSKGLLDRFGE 85
           A   + R +STKTMTVR+ALNSAMAEE+DRDDDVF+IGEEVAQYNGAYKV+KGLLDRFGE
Sbjct: 23  AGTLSRRLASTKTMTVRDALNSAMAEEMDRDDDVFIIGEEVAQYNGAYKVTKGLLDRFGE 82

Query: 86  RRVVDTPITEYGFTGLAVGAALKGLKPIVEFMSFNFSMQAIDHVVNSAAKTHYMSGGTQK 145
           RRVVDTPITE GFTGL+VGAALKGLKPIVEFMSFNFSMQAID VVNSAAKT+YMSGGTQK
Sbjct: 83  RRVVDTPITEMGFTGLSVGAALKGLKPIVEFMSFNFSMQAIDQVVNSAAKTYYMSGGTQK 142

Query: 146 CQMVFRGPNGAAVGVGAQHSQDFSPWYGSIPGLKVLVPYSAEDARGLLKAAIRDPNPVVF 205
           CQ+VFRGPNGAAVGVGAQHSQDFS WYGSIPG+KVLVPYSAEDARGLLKAAIRDPNPVVF
Sbjct: 143 CQIVFRGPNGAAVGVGAQHSQDFSAWYGSIPGMKVLVPYSAEDARGLLKAAIRDPNPVVF 202

Query: 206 LENELLYGESFEISEEALSPEFTLPYKAKIEREGTDISIVTYTRNVQFSLEAAEILQKKY 265
           LENELLYGESFE+SEE LS +FTLPY AK+EREGTDISI+TYTRNVQFSL+AAEIL K+Y
Sbjct: 203 LENELLYGESFEVSEECLSTDFTLPYTAKVEREGTDISIITYTRNVQFSLQAAEILDKQY 262

Query: 266 GVSAEVINLRSIRPLDTEAIIKTVKKTNHLITVESTFPSFGVGAEIVAQVMESEAFDYLD 325
           GVSAEVINLRSIRP+D  AIIKTVKKTNHLITVESTFP+FGVG+EIVAQ+MESEAFDYLD
Sbjct: 263 GVSAEVINLRSIRPMDVNAIIKTVKKTNHLITVESTFPNFGVGSEIVAQIMESEAFDYLD 322

Query: 326 APIQRVTGADVPTPYAKELEDFAFPDTPTIVKAVK 360
           AP++RVTGADVPTPYAKELEDFAFPD   IV AVK
Sbjct: 323 APVKRVTGADVPTPYAKELEDFAFPDPDVIVSAVK 357

>Sklu_2171.4 YBR221C, Contig c2171 8787-9875
          Length = 362

 Score =  618 bits (1593), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/333 (87%), Positives = 319/333 (95%), Gaps = 2/333 (0%)

Query: 30  ALRFSSTKT--MTVREALNSAMAEELDRDDDVFLIGEEVAQYNGAYKVSKGLLDRFGERR 87
           A R +STKT  MTVREALNSAMAEELDRDDDVF+IGEEVAQYNGAYKV+KGLLDR+GERR
Sbjct: 24  ATRMASTKTTKMTVREALNSAMAEELDRDDDVFIIGEEVAQYNGAYKVTKGLLDRYGERR 83

Query: 88  VVDTPITEYGFTGLAVGAALKGLKPIVEFMSFNFSMQAIDHVVNSAAKTHYMSGGTQKCQ 147
           VVDTPITE GFTGLAVGAALKGLKP+VEFMSFNFSMQAIDHVVNSAAKT+YMSGGTQKCQ
Sbjct: 84  VVDTPITEMGFTGLAVGAALKGLKPVVEFMSFNFSMQAIDHVVNSAAKTYYMSGGTQKCQ 143

Query: 148 MVFRGPNGAAVGVGAQHSQDFSPWYGSIPGLKVLVPYSAEDARGLLKAAIRDPNPVVFLE 207
           +VFRGPNGAAVGVGAQHSQD++ WYGSIPGLKVL PYSAEDARGLLKAAIRDPNPVVFLE
Sbjct: 144 IVFRGPNGAAVGVGAQHSQDYTAWYGSIPGLKVLSPYSAEDARGLLKAAIRDPNPVVFLE 203

Query: 208 NELLYGESFEISEEALSPEFTLPYKAKIEREGTDISIVTYTRNVQFSLEAAEILQKKYGV 267
           NELLYGESF++SEE LS +FTLPY AK+EREG+DISIVTYTRNVQFSL+AAEIL+K++GV
Sbjct: 204 NELLYGESFDVSEEVLSTDFTLPYTAKVEREGSDISIVTYTRNVQFSLQAAEILEKQHGV 263

Query: 268 SAEVINLRSIRPLDTEAIIKTVKKTNHLITVESTFPSFGVGAEIVAQVMESEAFDYLDAP 327
           S EV+NLRSIRPLD +AIIKTVKKTNHLITVESTFP+FGVG+EI+AQ+MESEAFDYLDAP
Sbjct: 264 SVEVVNLRSIRPLDVDAIIKTVKKTNHLITVESTFPAFGVGSEIIAQIMESEAFDYLDAP 323

Query: 328 IQRVTGADVPTPYAKELEDFAFPDTPTIVKAVK 360
           +QRVTGADVPTPYAKELEDFAFPD  TIV+AVK
Sbjct: 324 VQRVTGADVPTPYAKELEDFAFPDPDTIVRAVK 356

>AAR167C [355] [Homologous to ScYBR221C (PDB1) - SH]
           (642620..643699) [1080 bp, 359 aa]
          Length = 359

 Score =  613 bits (1582), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/330 (86%), Positives = 315/330 (95%)

Query: 31  LRFSSTKTMTVREALNSAMAEELDRDDDVFLIGEEVAQYNGAYKVSKGLLDRFGERRVVD 90
           +RF+S+K+MTVR+ALNSAMAEE+DRDDDVF+IGEEVAQYNGAYKV+KGLLDRFGERRVVD
Sbjct: 24  MRFASSKSMTVRDALNSAMAEEMDRDDDVFIIGEEVAQYNGAYKVTKGLLDRFGERRVVD 83

Query: 91  TPITEYGFTGLAVGAALKGLKPIVEFMSFNFSMQAIDHVVNSAAKTHYMSGGTQKCQMVF 150
           TPITE GF GLAVGAALKGLKPIVEFMSFNFSMQAIDHVVNSAAKT+YMSGG Q CQ+VF
Sbjct: 84  TPITEMGFAGLAVGAALKGLKPIVEFMSFNFSMQAIDHVVNSAAKTYYMSGGVQTCQIVF 143

Query: 151 RGPNGAAVGVGAQHSQDFSPWYGSIPGLKVLVPYSAEDARGLLKAAIRDPNPVVFLENEL 210
           RGPNGAAVGV AQHSQD++ WYGSIPGLKVL PYSAEDARGLLKAAIRDPNPVVFLENEL
Sbjct: 144 RGPNGAAVGVAAQHSQDYTAWYGSIPGLKVLCPYSAEDARGLLKAAIRDPNPVVFLENEL 203

Query: 211 LYGESFEISEEALSPEFTLPYKAKIEREGTDISIVTYTRNVQFSLEAAEILQKKYGVSAE 270
           LYGESFE+SEE LSP+FTLPY +K+EREGTDISI+TY+RNVQFSL AAEIL K+YGVSAE
Sbjct: 204 LYGESFEVSEEVLSPDFTLPYTSKVEREGTDISIITYSRNVQFSLAAAEILDKQYGVSAE 263

Query: 271 VINLRSIRPLDTEAIIKTVKKTNHLITVESTFPSFGVGAEIVAQVMESEAFDYLDAPIQR 330
           VIN+RSIRPLD +AIIKTVKKTNHLITVE+TFP+FGVG+EI+AQ+MESEAFD+LDAP+QR
Sbjct: 264 VINMRSIRPLDIDAIIKTVKKTNHLITVEATFPAFGVGSEIIAQIMESEAFDHLDAPVQR 323

Query: 331 VTGADVPTPYAKELEDFAFPDTPTIVKAVK 360
           VTGADVPTPYAKELEDFAFPD  TIV+A K
Sbjct: 324 VTGADVPTPYAKELEDFAFPDPDTIVRAAK 353

>Sklu_2101.3 YMR171C, Contig c2101 5004-6710
          Length = 568

 Score = 32.0 bits (71), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 18/69 (26%), Positives = 35/69 (50%), Gaps = 8/69 (11%)

Query: 180 VLVPYSAEDARGLLKAAIRDPNPVVFLENELLYGESFEISEEALSPEFTLPYKAKIEREG 239
           +L+P+ +ED++G+L   I D   + F+E E ++   F+       P+  LP    +    
Sbjct: 194 LLIPHRSEDSQGMLDPIIND-QTIRFIEEEGVHAWEFQ-------PDPNLPNDTILIENK 245

Query: 240 TDISIVTYT 248
           T+I+ + Y 
Sbjct: 246 TEITFLNYN 254

>YGR186W (TFG1) [2137] chr7 (867777..869984) RNA polymerase II
           transcription initiation factor TFIIF (factor g), 105
           kDa subunit, component of RNA polymerase holoenzyme
           complex [2208 bp, 735 aa]
          Length = 735

 Score = 29.6 bits (65), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 51/196 (26%), Positives = 80/196 (40%), Gaps = 58/196 (29%)

Query: 186 AEDARGLLKAAIRDPN----------PVVFLENELLYGESFEISEEALSP--EFTLPYKA 233
           A+  R  +K    DPN          P   LEN   +   F+ S++ ++P  +F LP   
Sbjct: 81  ADAGRSNVKVKDEDPNEYNEFPLRAIPKEDLENMRTHLLKFQ-SKKKINPVTDFHLP--V 137

Query: 234 KIEREGTDISIVTYTRNVQFSLEAAEILQKK-----YGVSAE----VINLRSIRPLDTEA 284
           ++ R+ T        RN+QF L  AEI+Q++     Y   AE      N   +    T +
Sbjct: 138 RLHRKDT--------RNLQFQLTRAEIVQRQKEISEYKKKAEQERSTPNSGGMNKSGTVS 189

Query: 285 IIKTVKKTNHLITVESTFPSFGVGAEIVAQVMESEAFDYLDAPIQRVTGADVPTPYAKEL 344
           +  TVK  +   TV+S              V +    + +++ I  VTG+ VP       
Sbjct: 190 LNNTVKDGSQTPTVDS--------------VTKDNTANGVNSSIPTVTGSSVP------- 228

Query: 345 EDFAFPDTPTIVKAVK 360
                P +PT V AV+
Sbjct: 229 -----PASPTTVSAVE 239

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.133    0.373 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 10,745,086
Number of extensions: 435781
Number of successful extensions: 1184
Number of sequences better than 10.0: 12
Number of HSP's gapped: 1197
Number of HSP's successfully gapped: 12
Length of query: 360
Length of database: 16,596,109
Length adjustment: 103
Effective length of query: 257
Effective length of database: 13,030,455
Effective search space: 3348826935
Effective search space used: 3348826935
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 62 (28.5 bits)