Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YBR218C (PYC2)1180115959430.0
YGL062W (PYC1)1178115756100.0
Scas_686.171176115453420.0
CAGL0F06941g1180115552900.0
Kwal_14.18031174115452320.0
Scas_563.121216116351940.0
CAGL0K06787g1175116051840.0
KLLA0C05764g1173115651660.0
AAR162C1171115450630.0
Sklu_1458.11132111650150.0
CAGL0M05533g18344567733e-84
YBR208C (DUR1,2)18354717262e-78
Sklu_2124.118304597068e-76
ADR051C18194617013e-75
KLLA0E08107g18294596891e-73
Scas_721.4018344496773e-72
Kwal_27.1195118694596739e-72
CAGL0L10780g22335345303e-54
Scas_720.7422315185277e-54
KLLA0F06072g22315615232e-53
AAR071W22315685161e-52
YNR016C (ACC1)22335185044e-51
Kwal_23.615722305384848e-49
YMR207C (HFA1)21234364812e-48
Sklu_2331.122203301153e-05
ABR157W11132201143e-05
Kwal_33.1406122213301127e-05
CAGL0L05676g22113321101e-04
Scas_582.4*21932071054e-04
ACR263C22403321045e-04
Kwal_55.1978311212161036e-04
YJL130C (URA2)2214329990.002
KLLA0E23782g393218940.005
Sklu_2413.41122216920.014
Sklu_2431.2394120880.028
KLLA0F03190g1117221890.030
ADR107W442288870.037
Kwal_27.12090394218870.040
KLLA0F05489g44175850.060
Scas_701.3543075840.084
Kwal_56.2440144175840.099
KLLA0E15444g2228166850.10
YDL131W (LYS21)44075830.11
CAGL0J09240g43794830.13
CAGL0J06402g43175820.14
Scas_704.343875820.15
YDL182W (LYS20)42875820.16
YJR109C (CPA2)1118174810.23
CAGL0C04917g1113178810.29
Scas_691.191117221790.44
KLLA0D03146g38470731.7
YHR216W (IMD2)523131722.8
Kwal_47.19231795127723.1
YML056C (IMD4)52481713.4
CAGL0K10780g52781688.1
Scas_712.17793101689.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YBR218C
         (1159 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YBR218C (PYC2) [399] chr2 complement(658664..662206) Pyruvate ca...  2293   0.0  
YGL062W (PYC1) [1917] chr7 (385197..388733) Pyruvate carboxylase...  2165   0.0  
Scas_686.17                                                          2062   0.0  
CAGL0F06941g 679960..683502 highly similar to sp|P11154 Saccharo...  2042   0.0  
Kwal_14.1803                                                         2019   0.0  
Scas_563.12                                                          2005   0.0  
CAGL0K06787g complement(659290..662817) highly similar to sp|P32...  2001   0.0  
KLLA0C05764g complement(512470..515991) highly similar to sp|P32...  1994   0.0  
AAR162C [350] [Homologous to ScYGL062W (PYC1) - SH; ScYBR218C (P...  1954   0.0  
Sklu_1458.1 YGL062W, Contig c1458 155-3553 reverse complement        1936   0.0  
CAGL0M05533g complement(588667..594171) similar to sp|P32528 Sac...   302   3e-84
YBR208C (DUR1,2) [390] chr2 complement(636660..642167) Urea amid...   284   2e-78
Sklu_2124.1 YBR208C, Contig c2124 43-5535 reverse complement          276   8e-76
ADR051C [1792] [Homologous to ScYBR208C (DUR12) - SH] (796213..8...   274   3e-75
KLLA0E08107g 730334..735823 highly similar to sp|P32528 Saccharo...   270   1e-73
Scas_721.40                                                           265   3e-72
Kwal_27.11951                                                         263   9e-72
CAGL0L10780g complement(1149588..1156289) highly similar to sp|Q...   208   3e-54
Scas_720.74                                                           207   7e-54
KLLA0F06072g 583276..589971 highly similar to sp|Q00955 Saccharo...   206   2e-53
AAR071W [257] [Homologous to ScYNR016C (ACC1) - SH; ScYMR207C (H...   203   1e-52
YNR016C (ACC1) [4599] chr14 complement(654672..661373) Acetyl-Co...   198   4e-51
Kwal_23.6157                                                          191   8e-49
YMR207C (HFA1) [4163] chr13 complement(677192..683563) Protein w...   189   2e-48
Sklu_2331.1 YJL130C, Contig c2331 2029-8691                            49   3e-05
ABR157W [750] [Homologous to ScYJR109C (CPA2) - SH] complement(6...    49   3e-05
Kwal_33.14061                                                          48   7e-05
CAGL0L05676g 619734..626369 highly similar to sp|P07259 Saccharo...    47   1e-04
Scas_582.4*                                                            45   4e-04
ACR263C [1310] [Homologous to ScYJL130C (URA2) - SH] (827830..83...    45   5e-04
Kwal_55.19783                                                          44   6e-04
YJL130C (URA2) [2788] chr10 complement(165641..172285) Multifunc...    43   0.002
KLLA0E23782g complement(2105401..2106582) highly similar to sp|Q...    41   0.005
Sklu_2413.4 YJR109C, Contig c2413 10886-14254                          40   0.014
Sklu_2431.2 YDL131W, Contig c2431 3030-4214                            39   0.028
KLLA0F03190g complement(296883..300236) highly similar to sp|P03...    39   0.030
ADR107W [1848] [Homologous to ScYDL131W (LYS21) - SH; ScYDL182W ...    38   0.037
Kwal_27.12090                                                          38   0.040
KLLA0F05489g 541146..542471 highly similar to sp|Q12122 Saccharo...    37   0.060
Scas_701.35                                                            37   0.084
Kwal_56.24401                                                          37   0.099
KLLA0E15444g 1370741..1377427 highly similar to sp|P07259 Saccha...    37   0.10 
YDL131W (LYS21) [738] chr4 (227393..228715) Homocitrate synthase...    37   0.11 
CAGL0J09240g 911669..912982 highly similar to sp|Q12122 Saccharo...    37   0.13 
CAGL0J06402g complement(608851..610146) highly similar to sp|Q12...    36   0.14 
Scas_704.3                                                             36   0.15 
YDL182W (LYS20) [690] chr4 (133438..134724) Homocitrate synthase...    36   0.16 
YJR109C (CPA2) [3001] chr10 complement(629500..632856) Carbamoyl...    36   0.23 
CAGL0C04917g 457506..460847 highly similar to sp|P03965 Saccharo...    36   0.29 
Scas_691.19                                                            35   0.44 
KLLA0D03146g complement(263816..264970) similar to sp|P53164 Sac...    33   1.7  
YHR216W (IMD2) [2500] chr8 (554394..555965) Inosine-5'-monophosp...    32   2.8  
Kwal_47.19231                                                          32   3.1  
YML056C (IMD4) [3914] chr13 complement(162194..163308,163717..16...    32   3.4  
CAGL0K10780g join(1047904..1047925,1049093..1049539,1050106..105...    31   8.1  
Scas_712.17                                                            31   9.2  

>YBR218C (PYC2) [399] chr2 complement(658664..662206) Pyruvate
            carboxylase 2 [3543 bp, 1180 aa]
          Length = 1180

 Score = 2293 bits (5943), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1112/1159 (95%), Positives = 1112/1159 (95%)

Query: 1    MSSSKKLAGLRDNFSLLGEKNKILVANRGEIPIRIFRSAHELSMRTIAIYSHEDRLSMHR 60
            MSSSKKLAGLRDNFSLLGEKNKILVANRGEIPIRIFRSAHELSMRTIAIYSHEDRLSMHR
Sbjct: 1    MSSSKKLAGLRDNFSLLGEKNKILVANRGEIPIRIFRSAHELSMRTIAIYSHEDRLSMHR 60

Query: 61   LKADEAYVIGEEGQYTPVGAYLAMDEIIEIAKKHKVDFIHPGYGFLSENSEFADKVVKAG 120
            LKADEAYVIGEEGQYTPVGAYLAMDEIIEIAKKHKVDFIHPGYGFLSENSEFADKVVKAG
Sbjct: 61   LKADEAYVIGEEGQYTPVGAYLAMDEIIEIAKKHKVDFIHPGYGFLSENSEFADKVVKAG 120

Query: 121  ITWIGPPAEVIDSVGDKVSARHLAARANVPTVPGTPGPIETVQEALDFVNEYGYPVIIKA 180
            ITWIGPPAEVIDSVGDKVSARHLAARANVPTVPGTPGPIETVQEALDFVNEYGYPVIIKA
Sbjct: 121  ITWIGPPAEVIDSVGDKVSARHLAARANVPTVPGTPGPIETVQEALDFVNEYGYPVIIKA 180

Query: 181  AFXXXXXXXXXXXXXXXXADAFQRATSEARTAFGNGTCFVERFLDKPKHIEVQLLADNHG 240
            AF                ADAFQRATSEARTAFGNGTCFVERFLDKPKHIEVQLLADNHG
Sbjct: 181  AFGGGGRGMRVVREGDDVADAFQRATSEARTAFGNGTCFVERFLDKPKHIEVQLLADNHG 240

Query: 241  NVVHLFERDCSVQRRHQKVVEVAPAKTLPREVRDAILTDAVKLAKVCGYRNAGTAEFLVD 300
            NVVHLFERDCSVQRRHQKVVEVAPAKTLPREVRDAILTDAVKLAKVCGYRNAGTAEFLVD
Sbjct: 241  NVVHLFERDCSVQRRHQKVVEVAPAKTLPREVRDAILTDAVKLAKVCGYRNAGTAEFLVD 300

Query: 301  NQNRHYFIEINPRIQVEHTITEEITGIDIVSAQIQIXXXXXXXXXXXXXDKITTRGFSIQ 360
            NQNRHYFIEINPRIQVEHTITEEITGIDIVSAQIQI             DKITTRGFSIQ
Sbjct: 301  NQNRHYFIEINPRIQVEHTITEEITGIDIVSAQIQIAAGATLTQLGLLQDKITTRGFSIQ 360

Query: 361  CRITTEDPSKNFQPDTGRLEVYRSAGGNGVRLDGGNAYAGATISPHYDSMLVKCSCSGST 420
            CRITTEDPSKNFQPDTGRLEVYRSAGGNGVRLDGGNAYAGATISPHYDSMLVKCSCSGST
Sbjct: 361  CRITTEDPSKNFQPDTGRLEVYRSAGGNGVRLDGGNAYAGATISPHYDSMLVKCSCSGST 420

Query: 421  YEIVRRKMIRALIEFRIRGVKTNIPFLLTLLTNPVFIEGTYWTTFIDDTPQLFQMVSSQN 480
            YEIVRRKMIRALIEFRIRGVKTNIPFLLTLLTNPVFIEGTYWTTFIDDTPQLFQMVSSQN
Sbjct: 421  YEIVRRKMIRALIEFRIRGVKTNIPFLLTLLTNPVFIEGTYWTTFIDDTPQLFQMVSSQN 480

Query: 481  RAQKLLHYLADLAVNGSSIKGQIGLPKLKSNPSVPHLHDAQGNVINVTKSAPPSGWRQVL 540
            RAQKLLHYLADLAVNGSSIKGQIGLPKLKSNPSVPHLHDAQGNVINVTKSAPPSGWRQVL
Sbjct: 481  RAQKLLHYLADLAVNGSSIKGQIGLPKLKSNPSVPHLHDAQGNVINVTKSAPPSGWRQVL 540

Query: 541  LEKGPSEFAKQVRQFNGTLLMDTTWRDAHQSLLATRVRTHDLATIAPTTAHALAGAFALE 600
            LEKGPSEFAKQVRQFNGTLLMDTTWRDAHQSLLATRVRTHDLATIAPTTAHALAGAFALE
Sbjct: 541  LEKGPSEFAKQVRQFNGTLLMDTTWRDAHQSLLATRVRTHDLATIAPTTAHALAGAFALE 600

Query: 601  CWGGATFDVAMRFLHEDPWERLRKLRSLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQ 660
            CWGGATFDVAMRFLHEDPWERLRKLRSLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQ
Sbjct: 601  CWGGATFDVAMRFLHEDPWERLRKLRSLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQ 660

Query: 661  AKDNGVDIFRVFDALNDLEQLXXXXXXXXXXXXXXXXXXCYSGDMLQPGKKYNLDYYLEV 720
            AKDNGVDIFRVFDALNDLEQL                  CYSGDMLQPGKKYNLDYYLEV
Sbjct: 661  AKDNGVDIFRVFDALNDLEQLKVGVNAVKKAGGVVEATVCYSGDMLQPGKKYNLDYYLEV 720

Query: 721  VEKIVQMGTHILGIKDMAGTMKPAAAKLLIGSLRTRYPDLPIHVHSHDSAGTAVASMTAC 780
            VEKIVQMGTHILGIKDMAGTMKPAAAKLLIGSLRTRYPDLPIHVHSHDSAGTAVASMTAC
Sbjct: 721  VEKIVQMGTHILGIKDMAGTMKPAAAKLLIGSLRTRYPDLPIHVHSHDSAGTAVASMTAC 780

Query: 781  ALAGADVVDVAINSMSGLTSQPSINALLASLEGNIDTGINVEHVRELDAYWAEMRLLYSC 840
            ALAGADVVDVAINSMSGLTSQPSINALLASLEGNIDTGINVEHVRELDAYWAEMRLLYSC
Sbjct: 781  ALAGADVVDVAINSMSGLTSQPSINALLASLEGNIDTGINVEHVRELDAYWAEMRLLYSC 840

Query: 841  FEADLKGPDPEVYQHEIPGGQLTNLLFQAQQLGLGEQWAETKRAYREANYLLGDIVKVTP 900
            FEADLKGPDPEVYQHEIPGGQLTNLLFQAQQLGLGEQWAETKRAYREANYLLGDIVKVTP
Sbjct: 841  FEADLKGPDPEVYQHEIPGGQLTNLLFQAQQLGLGEQWAETKRAYREANYLLGDIVKVTP 900

Query: 901  TSKVVGDLAQFMVSNKLTSDDIRRLANSLDFPDSVMDFFEGLIGQPYGGFPEPLRSDVLR 960
            TSKVVGDLAQFMVSNKLTSDDIRRLANSLDFPDSVMDFFEGLIGQPYGGFPEPLRSDVLR
Sbjct: 901  TSKVVGDLAQFMVSNKLTSDDIRRLANSLDFPDSVMDFFEGLIGQPYGGFPEPLRSDVLR 960

Query: 961  NKRRKLTCRPGLELEPFDLEKIREDLQNRFGDIDECDVASYNMYPRVYEDFQKIRETYGD 1020
            NKRRKLTCRPGLELEPFDLEKIREDLQNRFGDIDECDVASYNMYPRVYEDFQKIRETYGD
Sbjct: 961  NKRRKLTCRPGLELEPFDLEKIREDLQNRFGDIDECDVASYNMYPRVYEDFQKIRETYGD 1020

Query: 1021 LSVLPTKNFLAPAEPDEEIEVTIEQGKTLIIKLQAVGDLNKKTGQREVYFELNGELRKIR 1080
            LSVLPTKNFLAPAEPDEEIEVTIEQGKTLIIKLQAVGDLNKKTGQREVYFELNGELRKIR
Sbjct: 1021 LSVLPTKNFLAPAEPDEEIEVTIEQGKTLIIKLQAVGDLNKKTGQREVYFELNGELRKIR 1080

Query: 1081 VADKSQNIQSVAKPKADVHDTHQIGAPMAGVIIEVKVHKGSLVKKGESIAVLSAMKMEMV 1140
            VADKSQNIQSVAKPKADVHDTHQIGAPMAGVIIEVKVHKGSLVKKGESIAVLSAMKMEMV
Sbjct: 1081 VADKSQNIQSVAKPKADVHDTHQIGAPMAGVIIEVKVHKGSLVKKGESIAVLSAMKMEMV 1140

Query: 1141 VSSPADGQVKDVFIKDGES 1159
            VSSPADGQVKDVFIKDGES
Sbjct: 1141 VSSPADGQVKDVFIKDGES 1159

>YGL062W (PYC1) [1917] chr7 (385197..388733) Pyruvate carboxylase 1,
            catalyzes conversion of pyruvate to oxaloacetate in the
            gluconeogenesis pathway [3537 bp, 1178 aa]
          Length = 1178

 Score = 2165 bits (5610), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1039/1157 (89%), Positives = 1086/1157 (93%)

Query: 3    SSKKLAGLRDNFSLLGEKNKILVANRGEIPIRIFRSAHELSMRTIAIYSHEDRLSMHRLK 62
            S +K AGLRDNF+LLGEKNKILVANRGEIPIRIFR+AHELSM+T+AIYSHEDRLS H+ K
Sbjct: 2    SQRKFAGLRDNFNLLGEKNKILVANRGEIPIRIFRTAHELSMQTVAIYSHEDRLSTHKQK 61

Query: 63   ADEAYVIGEEGQYTPVGAYLAMDEIIEIAKKHKVDFIHPGYGFLSENSEFADKVVKAGIT 122
            ADEAYVIGE GQYTPVGAYLA+DEII IA+KH+VDFIHPGYGFLSENSEFADKVVKAGIT
Sbjct: 62   ADEAYVIGEVGQYTPVGAYLAIDEIISIAQKHQVDFIHPGYGFLSENSEFADKVVKAGIT 121

Query: 123  WIGPPAEVIDSVGDKVSARHLAARANVPTVPGTPGPIETVQEALDFVNEYGYPVIIKAAF 182
            WIGPPAEVIDSVGDKVSAR+LAA+ANVPTVPGTPGPIETV+EALDFVNEYGYPVIIKAAF
Sbjct: 122  WIGPPAEVIDSVGDKVSARNLAAKANVPTVPGTPGPIETVEEALDFVNEYGYPVIIKAAF 181

Query: 183  XXXXXXXXXXXXXXXXADAFQRATSEARTAFGNGTCFVERFLDKPKHIEVQLLADNHGNV 242
                            ADAFQRATSEARTAFGNGTCFVERFLDKPKHIEVQLLADNHGNV
Sbjct: 182  GGGGRGMRVVREGDDVADAFQRATSEARTAFGNGTCFVERFLDKPKHIEVQLLADNHGNV 241

Query: 243  VHLFERDCSVQRRHQKVVEVAPAKTLPREVRDAILTDAVKLAKVCGYRNAGTAEFLVDNQ 302
            VHLFERDCSVQRRHQKVVEVAPAKTLPREVRDAILTDAVKLAK CGYRNAGTAEFLVDNQ
Sbjct: 242  VHLFERDCSVQRRHQKVVEVAPAKTLPREVRDAILTDAVKLAKECGYRNAGTAEFLVDNQ 301

Query: 303  NRHYFIEINPRIQVEHTITEEITGIDIVSAQIQIXXXXXXXXXXXXXDKITTRGFSIQCR 362
            NRHYFIEINPRIQVEHTITEEITGIDIV+AQIQI             DKITTRGF+IQCR
Sbjct: 302  NRHYFIEINPRIQVEHTITEEITGIDIVAAQIQIAAGASLPQLGLFQDKITTRGFAIQCR 361

Query: 363  ITTEDPSKNFQPDTGRLEVYRSAGGNGVRLDGGNAYAGATISPHYDSMLVKCSCSGSTYE 422
            ITTEDP+KNFQPDTGR+EVYRSAGGNGVRLDGGNAYAG  ISPHYDSMLVKCSCSGSTYE
Sbjct: 362  ITTEDPAKNFQPDTGRIEVYRSAGGNGVRLDGGNAYAGTIISPHYDSMLVKCSCSGSTYE 421

Query: 423  IVRRKMIRALIEFRIRGVKTNIPFLLTLLTNPVFIEGTYWTTFIDDTPQLFQMVSSQNRA 482
            IVRRKMIRALIEFRIRGVKTNIPFLLTLLTNPVFIEGTYWTTFIDDTPQLFQMVSSQNRA
Sbjct: 422  IVRRKMIRALIEFRIRGVKTNIPFLLTLLTNPVFIEGTYWTTFIDDTPQLFQMVSSQNRA 481

Query: 483  QKLLHYLADLAVNGSSIKGQIGLPKLKSNPSVPHLHDAQGNVINVTKSAPPSGWRQVLLE 542
            QKLLHYLAD+AVNGSSIKGQIGLPKLKSNPSVPHLHDAQGNVINVTKSAPPSGWRQVLLE
Sbjct: 482  QKLLHYLADVAVNGSSIKGQIGLPKLKSNPSVPHLHDAQGNVINVTKSAPPSGWRQVLLE 541

Query: 543  KGPSEFAKQVRQFNGTLLMDTTWRDAHQSLLATRVRTHDLATIAPTTAHALAGAFALECW 602
            KGP+EFA+QVRQFNGTLLMDTTWRDAHQSLLATRVRTHDLATIAPTTAHALAG FALECW
Sbjct: 542  KGPAEFARQVRQFNGTLLMDTTWRDAHQSLLATRVRTHDLATIAPTTAHALAGRFALECW 601

Query: 603  GGATFDVAMRFLHEDPWERLRKLRSLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAK 662
            GGATFDVAMRFLHEDPWERLRKLRSLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAK
Sbjct: 602  GGATFDVAMRFLHEDPWERLRKLRSLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAK 661

Query: 663  DNGVDIFRVFDALNDLEQLXXXXXXXXXXXXXXXXXXCYSGDMLQPGKKYNLDYYLEVVE 722
            DNGVDIFRVFDALNDLEQL                  C+SGDMLQPGKKYNLDYYLE+ E
Sbjct: 662  DNGVDIFRVFDALNDLEQLKVGVDAVKKAGGVVEATVCFSGDMLQPGKKYNLDYYLEIAE 721

Query: 723  KIVQMGTHILGIKDMAGTMKPAAAKLLIGSLRTRYPDLPIHVHSHDSAGTAVASMTACAL 782
            KIVQMGTHILGIKDMAGTMKPAAAKLLIGSLR +YPDLPIHVH+HDSAGTAVASMTACAL
Sbjct: 722  KIVQMGTHILGIKDMAGTMKPAAAKLLIGSLRAKYPDLPIHVHTHDSAGTAVASMTACAL 781

Query: 783  AGADVVDVAINSMSGLTSQPSINALLASLEGNIDTGINVEHVRELDAYWAEMRLLYSCFE 842
            AGADVVDVAINSMSGLTSQPSINALLASLEGNIDTGINVEHVRELDAYWAEMRLLYSCFE
Sbjct: 782  AGADVVDVAINSMSGLTSQPSINALLASLEGNIDTGINVEHVRELDAYWAEMRLLYSCFE 841

Query: 843  ADLKGPDPEVYQHEIPGGQLTNLLFQAQQLGLGEQWAETKRAYREANYLLGDIVKVTPTS 902
            ADLKGPDPEVYQHEIPGGQLTNLLFQAQQLGLGEQWAETKRAYREANYLLGDIVKVTPTS
Sbjct: 842  ADLKGPDPEVYQHEIPGGQLTNLLFQAQQLGLGEQWAETKRAYREANYLLGDIVKVTPTS 901

Query: 903  KVVGDLAQFMVSNKLTSDDIRRLANSLDFPDSVMDFFEGLIGQPYGGFPEPLRSDVLRNK 962
            KVVGDLAQFMVSNKLTSDD+RRLANSLDFPDSVMDFFEGLIGQPYGGFPEP RSDVLRNK
Sbjct: 902  KVVGDLAQFMVSNKLTSDDVRRLANSLDFPDSVMDFFEGLIGQPYGGFPEPFRSDVLRNK 961

Query: 963  RRKLTCRPGLELEPFDLEKIREDLQNRFGDIDECDVASYNMYPRVYEDFQKIRETYGDLS 1022
            RRKLTCRPGLELEPFDLEKIREDLQNRFGD+DECDVASYNMYPRVYEDFQK+RETYGDLS
Sbjct: 962  RRKLTCRPGLELEPFDLEKIREDLQNRFGDVDECDVASYNMYPRVYEDFQKMRETYGDLS 1021

Query: 1023 VLPTKNFLAPAEPDEEIEVTIEQGKTLIIKLQAVGDLNKKTGQREVYFELNGELRKIRVA 1082
            VLPT++FL+P E DEEIEV IEQGKTLIIKLQAVGDLNKKTG+REVYF+LNGE+RKIRVA
Sbjct: 1022 VLPTRSFLSPLETDEEIEVVIEQGKTLIIKLQAVGDLNKKTGEREVYFDLNGEMRKIRVA 1081

Query: 1083 DKSQNIQSVAKPKADVHDTHQIGAPMAGVIIEVKVHKGSLVKKGESIAVLSAMKMEMVVS 1142
            D+SQ +++V K KAD+HD   IGAPMAGVI+EVKVHKGSL+KKG+ +AVLSAMKMEM++S
Sbjct: 1082 DRSQKVETVTKSKADMHDPLHIGAPMAGVIVEVKVHKGSLIKKGQPVAVLSAMKMEMIIS 1141

Query: 1143 SPADGQVKDVFIKDGES 1159
            SP+DGQVK+VF+ DGE+
Sbjct: 1142 SPSDGQVKEVFVSDGEN 1158

>Scas_686.17
          Length = 1176

 Score = 2062 bits (5342), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 985/1154 (85%), Positives = 1057/1154 (91%), Gaps = 1/1154 (0%)

Query: 6    KLAGLRDNFSLLGEKNKILVANRGEIPIRIFRSAHELSMRTIAIYSHEDRLSMHRLKADE 65
            KL+GLRDNFSLLGEKNKILVANRGEIPIRIFRSAHELSMRT+AIYSHEDRLS HRLKADE
Sbjct: 5    KLSGLRDNFSLLGEKNKILVANRGEIPIRIFRSAHELSMRTVAIYSHEDRLSTHRLKADE 64

Query: 66   AYVIGEEGQYTPVGAYLAMDEIIEIAKKHKVDFIHPGYGFLSENSEFADKVVKAGITWIG 125
            +YVIGEEGQ+TPVGAYLA+DEII IAKKHKVDFIHPGYGFLSENSEFADKV KAGITWIG
Sbjct: 65   SYVIGEEGQFTPVGAYLAIDEIINIAKKHKVDFIHPGYGFLSENSEFADKVAKAGITWIG 124

Query: 126  PPAEVIDSVGDKVSARHLAARANVPTVPGTPGPIETVQEALDFVNEYGYPVIIKAAFXXX 185
            PPAEVIDSVGDKVSAR+LAARA+VPTVPGTPGPI++V+EA DFV +YGYPVIIKAAF   
Sbjct: 125  PPAEVIDSVGDKVSARYLAARADVPTVPGTPGPIKSVKEAEDFVAQYGYPVIIKAAFGGG 184

Query: 186  XXXXXXXXXXXXXADAFQRATSEARTAFGNGTCFVERFLDKPKHIEVQLLADNHGNVVHL 245
                          DAFQRA+SEA TAFG+GTCFVERFLD PKHIEVQLL DN+GNVVHL
Sbjct: 185  GRGMRVVREGEDINDAFQRASSEALTAFGDGTCFVERFLDHPKHIEVQLLGDNYGNVVHL 244

Query: 246  FERDCSVQRRHQKVVEVAPAKTLPREVRDAILTDAVKLAKVCGYRNAGTAEFLVDNQNRH 305
            FERDCSVQRRHQKVVEVAPAK +PREVRDAILTDAVKLAK CGYRNAGTAEFLVDNQNRH
Sbjct: 245  FERDCSVQRRHQKVVEVAPAKNIPREVRDAILTDAVKLAKECGYRNAGTAEFLVDNQNRH 304

Query: 306  YFIEINPRIQVEHTITEEITGIDIVSAQIQIXXXXXXXXXXXXXDKITTRGFSIQCRITT 365
            YFIEINPRIQVEHTITEEITGID+V+AQIQI             D+ITTRGF+IQCRITT
Sbjct: 305  YFIEINPRIQVEHTITEEITGIDLVAAQIQIAAGASLAQLGLLQDRITTRGFAIQCRITT 364

Query: 366  EDPSKNFQPDTGRLEVYRSAGGNGVRLDGGNAYAGATISPHYDSMLVKCSCSGSTYEIVR 425
            EDP+KNFQPDTGRLEVYRSAGGNGVRLDGGNAYAGA ISPHYDSMLVKCSCSGSTYEIVR
Sbjct: 365  EDPAKNFQPDTGRLEVYRSAGGNGVRLDGGNAYAGAVISPHYDSMLVKCSCSGSTYEIVR 424

Query: 426  RKMIRALIEFRIRGVKTNIPFLLTLLTNPVFIEGTYWTTFIDDTPQLFQMVSSQNRAQKL 485
            RKMIRALIEFRIRGVKTNIPFLLTLLT+PVFI G YWTTFIDDTPQLF+MVSSQNRAQKL
Sbjct: 425  RKMIRALIEFRIRGVKTNIPFLLTLLTHPVFISGDYWTTFIDDTPQLFKMVSSQNRAQKL 484

Query: 486  LHYLADLAVNGSSIKGQIGLPKLKSNPSVPHLHDAQGNVINVTKSAPPSGWRQVLLEKGP 545
            LHYLADLAVNGSSIKGQIGLPKLK NP VPHLHDA+GNVINV  + P +GWR+VLLE+GP
Sbjct: 485  LHYLADLAVNGSSIKGQIGLPKLKKNPDVPHLHDAEGNVINVA-TPPTAGWRKVLLEQGP 543

Query: 546  SEFAKQVRQFNGTLLMDTTWRDAHQSLLATRVRTHDLATIAPTTAHALAGAFALECWGGA 605
            +EFAKQVR F GTLLMDTTWRDAHQSLLATRVRTHDLATIAPTTAHAL+GAFALECWGGA
Sbjct: 544  AEFAKQVRNFQGTLLMDTTWRDAHQSLLATRVRTHDLATIAPTTAHALSGAFALECWGGA 603

Query: 606  TFDVAMRFLHEDPWERLRKLRSLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKDNG 665
            TFDVAMRFLHEDPW RLR LR LVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKDNG
Sbjct: 604  TFDVAMRFLHEDPWARLRTLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKDNG 663

Query: 666  VDIFRVFDALNDLEQLXXXXXXXXXXXXXXXXXXCYSGDMLQPGKKYNLDYYLEVVEKIV 725
            VDIFRVFDALNDL+QL                  CYSGDMLQPGKKYNLDYYLEV EKIV
Sbjct: 664  VDIFRVFDALNDLDQLKVGVDAVKKAGGVVEATVCYSGDMLQPGKKYNLDYYLEVTEKIV 723

Query: 726  QMGTHILGIKDMAGTMKPAAAKLLIGSLRTRYPDLPIHVHSHDSAGTAVASMTACALAGA 785
            QMGTHILGIKDMAGTMKPAAA+LLIGS+R +YPDLPIHVH+HDSAGTAV+SMT  AL+GA
Sbjct: 724  QMGTHILGIKDMAGTMKPAAARLLIGSIRAKYPDLPIHVHTHDSAGTAVSSMTVAALSGA 783

Query: 786  DVVDVAINSMSGLTSQPSINALLASLEGNIDTGINVEHVRELDAYWAEMRLLYSCFEADL 845
            DVVDVAINSMSGLTSQPSINALLASL+G IDTGINV++VRELDAYWAEMRLLYSCFEADL
Sbjct: 784  DVVDVAINSMSGLTSQPSINALLASLDGQIDTGINVQNVRELDAYWAEMRLLYSCFEADL 843

Query: 846  KGPDPEVYQHEIPGGQLTNLLFQAQQLGLGEQWAETKRAYREANYLLGDIVKVTPTSKVV 905
            KGPD EVYQHEIPGGQLTNLLFQAQQ GLGEQWAETKRAYREANYLLGDIVKVTPTSKVV
Sbjct: 844  KGPDAEVYQHEIPGGQLTNLLFQAQQQGLGEQWAETKRAYREANYLLGDIVKVTPTSKVV 903

Query: 906  GDLAQFMVSNKLTSDDIRRLANSLDFPDSVMDFFEGLIGQPYGGFPEPLRSDVLRNKRRK 965
            GDLAQFMV+NK  SDDI+RLAN+LDFPDS+MDFFEGLIGQPYGGFPEPLRSD+LRNKRRK
Sbjct: 904  GDLAQFMVTNKFNSDDIKRLANTLDFPDSIMDFFEGLIGQPYGGFPEPLRSDILRNKRRK 963

Query: 966  LTCRPGLELEPFDLEKIREDLQNRFGDIDECDVASYNMYPRVYEDFQKIRETYGDLSVLP 1025
            LT RPGLEL PF+++ IREDL+ RFGDIDECD+ASYNMYP+VYEDFQKI+E YGDLSVLP
Sbjct: 964  LTTRPGLELAPFNMQDIREDLETRFGDIDECDIASYNMYPKVYEDFQKIKEKYGDLSVLP 1023

Query: 1026 TKNFLAPAEPDEEIEVTIEQGKTLIIKLQAVGDLNKKTGQREVYFELNGELRKIRVADKS 1085
            TK+FL+P + DEEIEVTIEQGKTLI+KLQA+GDLNK TG REVYF+LNGELRKIRV D+S
Sbjct: 1024 TKSFLSPLDVDEEIEVTIEQGKTLIVKLQAIGDLNKATGVREVYFDLNGELRKIRVVDRS 1083

Query: 1086 QNIQSVAKPKADVHDTHQIGAPMAGVIIEVKVHKGSLVKKGESIAVLSAMKMEMVVSSPA 1145
            Q ++++AKPKAD HD +QIGAPMAGV++EVKVHKGSLVKKGE++AVLSAMKMEMV+SSPA
Sbjct: 1084 QKVETIAKPKADAHDPYQIGAPMAGVVVEVKVHKGSLVKKGEAVAVLSAMKMEMVISSPA 1143

Query: 1146 DGQVKDVFIKDGES 1159
            DGQVK+V + +G +
Sbjct: 1144 DGQVKEVLVSNGNA 1157

>CAGL0F06941g 679960..683502 highly similar to sp|P11154 Saccharomyces
            cerevisiae YGL062w PYC1 pyruvate carboxylase or sp|P32327
            Saccharomyces cerevisiae YBR218c PYC2, hypothetical start
          Length = 1180

 Score = 2042 bits (5290), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 979/1155 (84%), Positives = 1048/1155 (90%)

Query: 5    KKLAGLRDNFSLLGEKNKILVANRGEIPIRIFRSAHELSMRTIAIYSHEDRLSMHRLKAD 64
            KKLAGLR NF++LGEK+KILVANRGEIPIRIFR+AHELSMRT+AIYSHEDRLS HRLKAD
Sbjct: 8    KKLAGLRANFNILGEKDKILVANRGEIPIRIFRTAHELSMRTVAIYSHEDRLSTHRLKAD 67

Query: 65   EAYVIGEEGQYTPVGAYLAMDEIIEIAKKHKVDFIHPGYGFLSENSEFADKVVKAGITWI 124
            EAYVIGEEGQYTPVGAYLA+DEII+IAKKH VDFIHPGYGFLSENSEFADKV KAGITWI
Sbjct: 68   EAYVIGEEGQYTPVGAYLAIDEIIDIAKKHGVDFIHPGYGFLSENSEFADKVQKAGITWI 127

Query: 125  GPPAEVIDSVGDKVSARHLAARANVPTVPGTPGPIETVQEALDFVNEYGYPVIIKAAFXX 184
            GPP EVI+SVGDKVSAR+LAA+A VPTVPGTPGPI+TV+EA  FV EYGYPVIIKAA+  
Sbjct: 128  GPPPEVIESVGDKVSARNLAAKAKVPTVPGTPGPIKTVEEAEAFVAEYGYPVIIKAAYGG 187

Query: 185  XXXXXXXXXXXXXXADAFQRATSEARTAFGNGTCFVERFLDKPKHIEVQLLADNHGNVVH 244
                           DAFQRATSEA+TAFGNGTCFVERFLDKPKHIEVQLLADNHGNV+H
Sbjct: 188  GGRGMRVVREGEDIGDAFQRATSEAKTAFGNGTCFVERFLDKPKHIEVQLLADNHGNVIH 247

Query: 245  LFERDCSVQRRHQKVVEVAPAKTLPREVRDAILTDAVKLAKVCGYRNAGTAEFLVDNQNR 304
            LFERDCSVQRRHQKVVEVAPAKTLPR+VRDAILTDAVKLAK  GYRNAGTAEFLVDNQNR
Sbjct: 248  LFERDCSVQRRHQKVVEVAPAKTLPRDVRDAILTDAVKLAKEAGYRNAGTAEFLVDNQNR 307

Query: 305  HYFIEINPRIQVEHTITEEITGIDIVSAQIQIXXXXXXXXXXXXXDKITTRGFSIQCRIT 364
            HYFIEINPRIQVEHTITEEITGIDIV+AQIQI             D+ITTRGF+IQCRIT
Sbjct: 308  HYFIEINPRIQVEHTITEEITGIDIVAAQIQIAAGASLTELGLLQDRITTRGFAIQCRIT 367

Query: 365  TEDPSKNFQPDTGRLEVYRSAGGNGVRLDGGNAYAGATISPHYDSMLVKCSCSGSTYEIV 424
            TEDP+KNFQPDTGR+EVY S GGNGVRLDGGNAYAGA ISPHYDSMLVKCSCSGSTYEIV
Sbjct: 368  TEDPAKNFQPDTGRIEVYGSTGGNGVRLDGGNAYAGAVISPHYDSMLVKCSCSGSTYEIV 427

Query: 425  RRKMIRALIEFRIRGVKTNIPFLLTLLTNPVFIEGTYWTTFIDDTPQLFQMVSSQNRAQK 484
            RRK+IRALIEFRIRGVKTNIPFLLTLLT+PVFI G YWTTFIDDTPQLF MVSSQNRAQK
Sbjct: 428  RRKIIRALIEFRIRGVKTNIPFLLTLLTHPVFISGQYWTTFIDDTPQLFHMVSSQNRAQK 487

Query: 485  LLHYLADLAVNGSSIKGQIGLPKLKSNPSVPHLHDAQGNVINVTKSAPPSGWRQVLLEKG 544
            LLHYLADLAVNGSSIKGQIGLPKL + P++PHLHD +G +I+VTK APP GWRQVLLEKG
Sbjct: 488  LLHYLADLAVNGSSIKGQIGLPKLSTKPNIPHLHDEKGEIISVTKVAPPDGWRQVLLEKG 547

Query: 545  PSEFAKQVRQFNGTLLMDTTWRDAHQSLLATRVRTHDLATIAPTTAHALAGAFALECWGG 604
            P  FAK VR F GTLLMDTTWRDAHQSLLATRVRTHDLA IAPTTAHALAGAFALECWGG
Sbjct: 548  PEGFAKAVRAFKGTLLMDTTWRDAHQSLLATRVRTHDLAAIAPTTAHALAGAFALECWGG 607

Query: 605  ATFDVAMRFLHEDPWERLRKLRSLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKDN 664
            ATFDVAMRFLHEDPWERLR LR LVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKDN
Sbjct: 608  ATFDVAMRFLHEDPWERLRVLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKDN 667

Query: 665  GVDIFRVFDALNDLEQLXXXXXXXXXXXXXXXXXXCYSGDMLQPGKKYNLDYYLEVVEKI 724
            GVDIFRVFDALNDLEQL                  CYSGDMLQPGKKYNLDYYLEV +KI
Sbjct: 668  GVDIFRVFDALNDLEQLKVGVDAVKKAGGVVEATVCYSGDMLQPGKKYNLDYYLEVTDKI 727

Query: 725  VQMGTHILGIKDMAGTMKPAAAKLLIGSLRTRYPDLPIHVHSHDSAGTAVASMTACALAG 784
            V+MGTH+LGIKDMAGT+KP AAKLLIGS+R +YPDLPIHVHSHDSAGTAVASM ACA AG
Sbjct: 728  VEMGTHVLGIKDMAGTLKPTAAKLLIGSIRAKYPDLPIHVHSHDSAGTAVASMAACAFAG 787

Query: 785  ADVVDVAINSMSGLTSQPSINALLASLEGNIDTGINVEHVRELDAYWAEMRLLYSCFEAD 844
            ADVVDVAINSMSG+TSQ SINALLASL+G IDTG+NV+H RELDAYWAEMRLLYSCFEAD
Sbjct: 788  ADVVDVAINSMSGMTSQASINALLASLDGEIDTGVNVKHARELDAYWAEMRLLYSCFEAD 847

Query: 845  LKGPDPEVYQHEIPGGQLTNLLFQAQQLGLGEQWAETKRAYREANYLLGDIVKVTPTSKV 904
            LKGPDPEVY HEIPGGQLTNLLFQAQQLGLGE+W ETKRAY+EAN+LLGDIVKVTPTSKV
Sbjct: 848  LKGPDPEVYDHEIPGGQLTNLLFQAQQLGLGEKWIETKRAYKEANHLLGDIVKVTPTSKV 907

Query: 905  VGDLAQFMVSNKLTSDDIRRLANSLDFPDSVMDFFEGLIGQPYGGFPEPLRSDVLRNKRR 964
            VGDLAQFMV+N+LTS+D++RLANSLDFPDSVMDFFEGL+GQPYGGFPEPLRSD+LRNKRR
Sbjct: 908  VGDLAQFMVTNQLTSEDVKRLANSLDFPDSVMDFFEGLMGQPYGGFPEPLRSDILRNKRR 967

Query: 965  KLTCRPGLELEPFDLEKIREDLQNRFGDIDECDVASYNMYPRVYEDFQKIRETYGDLSVL 1024
            KLT RPGLELEPFDLE IREDL+NRFG+IDECDVASYNMYP+VYEDFQK++E YGDLSVL
Sbjct: 968  KLTVRPGLELEPFDLESIREDLENRFGEIDECDVASYNMYPKVYEDFQKMKELYGDLSVL 1027

Query: 1025 PTKNFLAPAEPDEEIEVTIEQGKTLIIKLQAVGDLNKKTGQREVYFELNGELRKIRVADK 1084
            PTKNFLAP    E+IEV +EQGKTLIIKLQAVGDLNK+TG R+VYFELNGE+RKIRV D+
Sbjct: 1028 PTKNFLAPPSIGEDIEVHLEQGKTLIIKLQAVGDLNKETGMRDVYFELNGEMRKIRVPDR 1087

Query: 1085 SQNIQSVAKPKADVHDTHQIGAPMAGVIIEVKVHKGSLVKKGESIAVLSAMKMEMVVSSP 1144
            SQ ++ V+KPKAD HD  QIGAPMAGVI+EVKVHKGSLVKKG+ +A+LSAMKMEMVVSS 
Sbjct: 1088 SQKVEKVSKPKADNHDPFQIGAPMAGVIVEVKVHKGSLVKKGQPVAILSAMKMEMVVSSQ 1147

Query: 1145 ADGQVKDVFIKDGES 1159
            ADGQVKDVF+KD E+
Sbjct: 1148 ADGQVKDVFVKDAEN 1162

>Kwal_14.1803
          Length = 1174

 Score = 2019 bits (5232), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 964/1154 (83%), Positives = 1053/1154 (91%)

Query: 6    KLAGLRDNFSLLGEKNKILVANRGEIPIRIFRSAHELSMRTIAIYSHEDRLSMHRLKADE 65
            KLAGLRD+ +LLGEKNKILVANRGEIPIRIFRSAHELSM+T+AIYSHEDRLSMHRLKADE
Sbjct: 3    KLAGLRDSSNLLGEKNKILVANRGEIPIRIFRSAHELSMKTVAIYSHEDRLSMHRLKADE 62

Query: 66   AYVIGEEGQYTPVGAYLAMDEIIEIAKKHKVDFIHPGYGFLSENSEFADKVVKAGITWIG 125
            AY+IG++G+YTPVGAYLA+DEI+EIAK+H VDFIHPGYGFLSENSEFA KV +AGITWIG
Sbjct: 63   AYMIGKQGKYTPVGAYLAIDEILEIAKEHNVDFIHPGYGFLSENSEFARKVEEAGITWIG 122

Query: 126  PPAEVIDSVGDKVSARHLAARANVPTVPGTPGPIETVQEALDFVNEYGYPVIIKAAFXXX 185
            P AEVIDSVGDKVSAR+LAA+ANVP VPGTPGPI++V+EA  FV EYGYPVIIKAAF   
Sbjct: 123  PSAEVIDSVGDKVSARNLAAKANVPVVPGTPGPIDSVEEAQAFVAEYGYPVIIKAAFGGG 182

Query: 186  XXXXXXXXXXXXXADAFQRATSEARTAFGNGTCFVERFLDKPKHIEVQLLADNHGNVVHL 245
                         ADAFQRATSEA+T+FGNGTCF+ERFL+KPKHIEVQLLAD +GNVVHL
Sbjct: 183  GRGMRVVREGDDIADAFQRATSEAKTSFGNGTCFIERFLNKPKHIEVQLLADGYGNVVHL 242

Query: 246  FERDCSVQRRHQKVVEVAPAKTLPREVRDAILTDAVKLAKVCGYRNAGTAEFLVDNQNRH 305
            FERDCSVQRRHQKVVEVAPAKTLP++VRDAILTDAVKLA V  Y+NAGTAEFLVD+QNRH
Sbjct: 243  FERDCSVQRRHQKVVEVAPAKTLPKDVRDAILTDAVKLASVANYKNAGTAEFLVDDQNRH 302

Query: 306  YFIEINPRIQVEHTITEEITGIDIVSAQIQIXXXXXXXXXXXXXDKITTRGFSIQCRITT 365
            YFIEINPRIQVEHTITEEITGIDIV+AQIQI             D+ITTRGF+IQCRITT
Sbjct: 303  YFIEINPRIQVEHTITEEITGIDIVAAQIQIAAGASLQQLGLLQDRITTRGFAIQCRITT 362

Query: 366  EDPSKNFQPDTGRLEVYRSAGGNGVRLDGGNAYAGATISPHYDSMLVKCSCSGSTYEIVR 425
            EDP+KNFQPDTGR+EVYRSAGGNGVRLDGGNAYAG+ ISPHYDSMLVKCSCSGSTYEIVR
Sbjct: 363  EDPAKNFQPDTGRIEVYRSAGGNGVRLDGGNAYAGSIISPHYDSMLVKCSCSGSTYEIVR 422

Query: 426  RKMIRALIEFRIRGVKTNIPFLLTLLTNPVFIEGTYWTTFIDDTPQLFQMVSSQNRAQKL 485
            RKM+RALIEFRIRGVKTNIPFLLTLLTNPVFI+GTYWTTFIDDTP+LF+MVSSQNRAQKL
Sbjct: 423  RKMLRALIEFRIRGVKTNIPFLLTLLTNPVFIDGTYWTTFIDDTPELFKMVSSQNRAQKL 482

Query: 486  LHYLADLAVNGSSIKGQIGLPKLKSNPSVPHLHDAQGNVINVTKSAPPSGWRQVLLEKGP 545
            LHYLADLAVNGSSIKGQ+GLPKL + P+VP +HDAQGNVI+V  +APPSGWRQVLLEKGP
Sbjct: 483  LHYLADLAVNGSSIKGQMGLPKLHTQPTVPPIHDAQGNVIDVLTTAPPSGWRQVLLEKGP 542

Query: 546  SEFAKQVRQFNGTLLMDTTWRDAHQSLLATRVRTHDLATIAPTTAHALAGAFALECWGGA 605
            +EFAK VR+ NGTLLMDTTWRDAHQSLLATRVRT+DLA IAPTTAHAL+GAFALECWGGA
Sbjct: 543  AEFAKAVRENNGTLLMDTTWRDAHQSLLATRVRTYDLAAIAPTTAHALSGAFALECWGGA 602

Query: 606  TFDVAMRFLHEDPWERLRKLRSLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKDNG 665
            TFDVAMRFLHEDPWERLR LR LVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAK+NG
Sbjct: 603  TFDVAMRFLHEDPWERLRVLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKENG 662

Query: 666  VDIFRVFDALNDLEQLXXXXXXXXXXXXXXXXXXCYSGDMLQPGKKYNLDYYLEVVEKIV 725
            VDIFRVFDALNDLEQL                  CYSGDMLQ GKKYNLDYYLE+ +KIV
Sbjct: 663  VDIFRVFDALNDLEQLKVGVDAVKKAKGVVEATICYSGDMLQSGKKYNLDYYLEITDKIV 722

Query: 726  QMGTHILGIKDMAGTMKPAAAKLLIGSLRTRYPDLPIHVHSHDSAGTAVASMTACALAGA 785
             MGTHILGIKDMAGT+KP+AAKLLIGS+R +YPDLPIHVH+HDSAGTAVASM ACA AGA
Sbjct: 723  AMGTHILGIKDMAGTLKPSAAKLLIGSIRAKYPDLPIHVHTHDSAGTAVASMAACAFAGA 782

Query: 786  DVVDVAINSMSGLTSQPSINALLASLEGNIDTGINVEHVRELDAYWAEMRLLYSCFEADL 845
            DVVDVA NSMSGLTSQPSINALLASL+G I+T INV  VRELDAYWA+MRLLYSCFEADL
Sbjct: 783  DVVDVATNSMSGLTSQPSINALLASLDGEIETNINVNMVRELDAYWAQMRLLYSCFEADL 842

Query: 846  KGPDPEVYQHEIPGGQLTNLLFQAQQLGLGEQWAETKRAYREANYLLGDIVKVTPTSKVV 905
            KGPDPEVYQHEIPGGQLTNLLFQAQQLGLGE+W+ETKRAYREANYLLGD+VKVTPTSKVV
Sbjct: 843  KGPDPEVYQHEIPGGQLTNLLFQAQQLGLGEKWSETKRAYREANYLLGDLVKVTPTSKVV 902

Query: 906  GDLAQFMVSNKLTSDDIRRLANSLDFPDSVMDFFEGLIGQPYGGFPEPLRSDVLRNKRRK 965
            GDLAQFMVSNKL+SDD+RRLA+SLDFPDSVMDFFEGLIGQPYGGFPEPLRSDVL+NKRRK
Sbjct: 903  GDLAQFMVSNKLSSDDVRRLASSLDFPDSVMDFFEGLIGQPYGGFPEPLRSDVLKNKRRK 962

Query: 966  LTCRPGLELEPFDLEKIREDLQNRFGDIDECDVASYNMYPRVYEDFQKIRETYGDLSVLP 1025
            LTCRPGLE+ PFDL KI+EDLQ+RFGDI+ECDVASYNMYP+VYEDF+KIRETYGDLSVLP
Sbjct: 963  LTCRPGLEMAPFDLAKIKEDLQDRFGDIEECDVASYNMYPKVYEDFRKIRETYGDLSVLP 1022

Query: 1026 TKNFLAPAEPDEEIEVTIEQGKTLIIKLQAVGDLNKKTGQREVYFELNGELRKIRVADKS 1085
            TKNFL+P    EEI VTIE+GKTLIIK QA+G+LNK+TG REVYF+LNGELRK+ V DKS
Sbjct: 1023 TKNFLSPPTVGEEIVVTIEKGKTLIIKPQAIGELNKETGLREVYFDLNGELRKVAVVDKS 1082

Query: 1086 QNIQSVAKPKADVHDTHQIGAPMAGVIIEVKVHKGSLVKKGESIAVLSAMKMEMVVSSPA 1145
            Q +  ++KPKAD HD++QIGAPMAGVIIEVKVH GSLVK+G+ +AVLSAMKMEMV+SSP 
Sbjct: 1083 QKVDLISKPKADAHDSYQIGAPMAGVIIEVKVHTGSLVKQGQPVAVLSAMKMEMVISSPI 1142

Query: 1146 DGQVKDVFIKDGES 1159
            DGQVK+V +KDGE+
Sbjct: 1143 DGQVKEVLVKDGEN 1156

>Scas_563.12
          Length = 1216

 Score = 2005 bits (5194), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 963/1163 (82%), Positives = 1044/1163 (89%), Gaps = 4/1163 (0%)

Query: 1    MSSSKKLAGLRDNFSLLGEKNK----ILVANRGEIPIRIFRSAHELSMRTIAIYSHEDRL 56
            M+ +KKL G RDNF+LLG +N+    I+V +    P+  FRSAHELSM+T+AIYSHEDRL
Sbjct: 37   MAINKKLNGPRDNFNLLGTRNRFLSPIVVKSPSYPPVCNFRSAHELSMQTVAIYSHEDRL 96

Query: 57   SMHRLKADEAYVIGEEGQYTPVGAYLAMDEIIEIAKKHKVDFIHPGYGFLSENSEFADKV 116
            S HRLKADE+YVIGE  Q+TPVGAYLA+DEII IAK+H VD+IHPGYGFLSENSEFADKV
Sbjct: 97   STHRLKADESYVIGEPHQFTPVGAYLAIDEIINIAKRHGVDYIHPGYGFLSENSEFADKV 156

Query: 117  VKAGITWIGPPAEVIDSVGDKVSARHLAARANVPTVPGTPGPIETVQEALDFVNEYGYPV 176
             KAGITWIGPPA VIDSVGDKVSAR+LA +ANVPTVPGTPGPI TVQ+A DFVNEYGYPV
Sbjct: 157  AKAGITWIGPPASVIDSVGDKVSARNLATKANVPTVPGTPGPIRTVQDAQDFVNEYGYPV 216

Query: 177  IIKAAFXXXXXXXXXXXXXXXXADAFQRATSEARTAFGNGTCFVERFLDKPKHIEVQLLA 236
            IIKAAF                ADAFQRA+SEA TAFG+GTCFVERFL+KPKHIEVQLLA
Sbjct: 217  IIKAAFGGGGRGMRVVNEGDDLADAFQRASSEALTAFGDGTCFVERFLNKPKHIEVQLLA 276

Query: 237  DNHGNVVHLFERDCSVQRRHQKVVEVAPAKTLPREVRDAILTDAVKLAKVCGYRNAGTAE 296
            D HGNV+HLFERDCSVQRRHQKVVEVAPAKTLPREVRDAILTDAVKLAK CGY+NAGTAE
Sbjct: 277  DTHGNVIHLFERDCSVQRRHQKVVEVAPAKTLPREVRDAILTDAVKLAKECGYQNAGTAE 336

Query: 297  FLVDNQNRHYFIEINPRIQVEHTITEEITGIDIVSAQIQIXXXXXXXXXXXXXDKITTRG 356
            FLVD+QNRHYFIEINPRIQVEHTITEEITGIDIV+AQIQI             DKITTRG
Sbjct: 337  FLVDDQNRHYFIEINPRIQVEHTITEEITGIDIVAAQIQIAAGASLEQLGLLQDKITTRG 396

Query: 357  FSIQCRITTEDPSKNFQPDTGRLEVYRSAGGNGVRLDGGNAYAGATISPHYDSMLVKCSC 416
            F+IQCRITTEDP+KNFQPDTGRLEVY SAGGNGVRLDGGNAYAGA ISPHYDSMLVKCSC
Sbjct: 397  FAIQCRITTEDPAKNFQPDTGRLEVYDSAGGNGVRLDGGNAYAGAIISPHYDSMLVKCSC 456

Query: 417  SGSTYEIVRRKMIRALIEFRIRGVKTNIPFLLTLLTNPVFIEGTYWTTFIDDTPQLFQMV 476
            SGSTYE+VRRKMIRALIEFRIRGVKTNIPFLLTLLT+PVFI G YWTTFIDDTPQLF+MV
Sbjct: 457  SGSTYEVVRRKMIRALIEFRIRGVKTNIPFLLTLLTHPVFIAGDYWTTFIDDTPQLFKMV 516

Query: 477  SSQNRAQKLLHYLADLAVNGSSIKGQIGLPKLKSNPSVPHLHDAQGNVINVTKSAPPSGW 536
            SSQNRAQKLLHYLADLAVNGSSIKGQ+G+P+LK  P +PH+HDAQGNVI+VT   PP+GW
Sbjct: 517  SSQNRAQKLLHYLADLAVNGSSIKGQVGIPQLKKVPDIPHIHDAQGNVIDVTNVPPPAGW 576

Query: 537  RQVLLEKGPSEFAKQVRQFNGTLLMDTTWRDAHQSLLATRVRTHDLATIAPTTAHALAGA 596
            RQVLLE+GP EFAKQVRQF GTLLMDTTWRDAHQSLLATRVRTHDLA IAPTTAHALA A
Sbjct: 577  RQVLLEQGPEEFAKQVRQFQGTLLMDTTWRDAHQSLLATRVRTHDLAKIAPTTAHALASA 636

Query: 597  FALECWGGATFDVAMRFLHEDPWERLRKLRSLVPNIPFQMLLRGANGVAYSSLPDNAIDH 656
            FALECWGGATFDVAMRFLHEDPW+RLR LR LVPNIPFQMLLRGANGVAYSSLPDNAIDH
Sbjct: 637  FALECWGGATFDVAMRFLHEDPWKRLRTLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDH 696

Query: 657  FVKQAKDNGVDIFRVFDALNDLEQLXXXXXXXXXXXXXXXXXXCYSGDMLQPGKKYNLDY 716
            FVKQAKDNGVDIFRVFDALNDL+QL                  CYSGDMLQPGKKYNLDY
Sbjct: 697  FVKQAKDNGVDIFRVFDALNDLDQLKVGVDAVKKAGGVVEATVCYSGDMLQPGKKYNLDY 756

Query: 717  YLEVVEKIVQMGTHILGIKDMAGTMKPAAAKLLIGSLRTRYPDLPIHVHSHDSAGTAVAS 776
            YLEV EKIVQMGTHILGIKDMAGTMKPAAA+LLIGS+R +YPDLPIHVH+HDSAGTAVAS
Sbjct: 757  YLEVTEKIVQMGTHILGIKDMAGTMKPAAARLLIGSIRAKYPDLPIHVHTHDSAGTAVAS 816

Query: 777  MTACALAGADVVDVAINSMSGLTSQPSINALLASLEGNIDTGINVEHVRELDAYWAEMRL 836
            M+A A AGADV+DVA NSMSGLTSQPSINALLASL+G I+T INV+HVRELDAYWAEMRL
Sbjct: 817  MSAAAYAGADVIDVATNSMSGLTSQPSINALLASLDGEINTSINVQHVRELDAYWAEMRL 876

Query: 837  LYSCFEADLKGPDPEVYQHEIPGGQLTNLLFQAQQLGLGEQWAETKRAYREANYLLGDIV 896
            LYSCF ADLKGPDPEVY+HEIPGGQLTNLLFQAQQLGLGEQW ETKRAY+EAN LLGDIV
Sbjct: 877  LYSCFGADLKGPDPEVYEHEIPGGQLTNLLFQAQQLGLGEQWTETKRAYKEANMLLGDIV 936

Query: 897  KVTPTSKVVGDLAQFMVSNKLTSDDIRRLANSLDFPDSVMDFFEGLIGQPYGGFPEPLRS 956
            KVTPTSKVVGDLAQFMVSNKLTS+D++RLANSLDFPDSVMDFFEGL+GQPYGGFPEPLRS
Sbjct: 937  KVTPTSKVVGDLAQFMVSNKLTSEDVKRLANSLDFPDSVMDFFEGLMGQPYGGFPEPLRS 996

Query: 957  DVLRNKRRKLTCRPGLELEPFDLEKIREDLQNRFGDIDECDVASYNMYPRVYEDFQKIRE 1016
            D+LRNKRRKLTCRPGLEL PF+L  I+EDLQ RFGDI+ECD+ASYNMYP+VYEDFQK++E
Sbjct: 997  DILRNKRRKLTCRPGLELVPFELNNIKEDLQTRFGDINECDIASYNMYPKVYEDFQKMKE 1056

Query: 1017 TYGDLSVLPTKNFLAPAEPDEEIEVTIEQGKTLIIKLQAVGDLNKKTGQREVYFELNGEL 1076
             YGDLSVLPTK+FLAPAE  EEI VTI+QGKTLIIKLQA+GDLNK+TG+REV+FELNGE+
Sbjct: 1057 KYGDLSVLPTKSFLAPAEIGEEILVTIQQGKTLIIKLQAIGDLNKETGKREVFFELNGEM 1116

Query: 1077 RKIRVADKSQNIQSVAKPKADVHDTHQIGAPMAGVIIEVKVHKGSLVKKGESIAVLSAMK 1136
            RKI V DKSQ +++VAKPKAD HD  QIGAPMAGVI+EVKVHKGSLVKKGE++AVLSAMK
Sbjct: 1117 RKISVTDKSQKVETVAKPKADTHDPFQIGAPMAGVIVEVKVHKGSLVKKGEAVAVLSAMK 1176

Query: 1137 MEMVVSSPADGQVKDVFIKDGES 1159
            MEMV+SSPADG VK+V + + E+
Sbjct: 1177 MEMVISSPADGLVKEVLVNESEN 1199

>CAGL0K06787g complement(659290..662817) highly similar to sp|P32327
            Saccharomyces cerevisiae YBR218c PYC2 Pyruvate
            carboxylase 2, start by similarity
          Length = 1175

 Score = 2001 bits (5184), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 967/1160 (83%), Positives = 1036/1160 (89%), Gaps = 3/1160 (0%)

Query: 1    MSSSKKLAGLRDNFSLLGEKNKILVANRGEIPIRIFRSAHELSMRTIAIYSHEDRLSMHR 60
            M+++K L GLRDNFSLLGEKNKILVANRGEIPIRIFRSAHELSMRT+AIYSHEDRLS HR
Sbjct: 1    MATNKMLTGLRDNFSLLGEKNKILVANRGEIPIRIFRSAHELSMRTVAIYSHEDRLSTHR 60

Query: 61   LKADEAYVIGEEGQYTPVGAYLAMDEIIEIAKKHKVDFIHPGYGFLSENSEFADKVVKAG 120
            LKADEAYVIG+EG+YTPVGAYLA+DEII+IAKKH VDFIHPGYGFLSEN+EFADKV KAG
Sbjct: 61   LKADEAYVIGKEGEYTPVGAYLAIDEIIDIAKKHGVDFIHPGYGFLSENAEFADKVQKAG 120

Query: 121  ITWIGPPAEVIDSVGDKVSARHLAARANVPTVPGTPGPIETVQEALDFVNEYGYPVIIKA 180
            ITWIGPP EVI+SVGDKVSAR+LAA+ANVPTVPGTPGPIETV+EA DFVN+YGYPVIIKA
Sbjct: 121  ITWIGPPPEVIESVGDKVSARNLAAKANVPTVPGTPGPIETVEEAQDFVNKYGYPVIIKA 180

Query: 181  AFXXXXXXXXXXXXXXXXADAFQRATSEARTAFGNGTCFVERFLDKPKHIEVQLLADNHG 240
            A+                ADAFQRA SEA TAFGNGTCFVERFLDKPKHIEVQLLADNHG
Sbjct: 181  AYGGGGRGMRVVREGDDVADAFQRAKSEAITAFGNGTCFVERFLDKPKHIEVQLLADNHG 240

Query: 241  NVVHLFERDCSVQRRHQKVVEVAPAKTLPREVRDAILTDAVKLAKVCGYRNAGTAEFLVD 300
            NVVHLFERDCSVQRRHQKVVEVAPAKTLPREVRD+ILTDAV+LAK  GYRNAGTAEFLVD
Sbjct: 241  NVVHLFERDCSVQRRHQKVVEVAPAKTLPREVRDSILTDAVRLAKEAGYRNAGTAEFLVD 300

Query: 301  NQNRHYFIEINPRIQVEHTITEEITGIDIVSAQIQIXXXXXXXXXXXXXDKITTRGFSIQ 360
            NQNRHYFIEINPRIQVEHTITEEITGID+VSAQIQI             D+ITTRGF+IQ
Sbjct: 301  NQNRHYFIEINPRIQVEHTITEEITGIDLVSAQIQIAAGASLPQLGLLQDRITTRGFAIQ 360

Query: 361  CRITTEDPSKNFQPDTGRLEVYRSAGGNGVRLDGGNAYAGATISPHYDSMLVKCSCSGST 420
            CRITTEDP+KNFQPDTGRLEVYRSAGGNGVRLDGG AYAGA ISPHYDSMLVKCSCSGST
Sbjct: 361  CRITTEDPAKNFQPDTGRLEVYRSAGGNGVRLDGGTAYAGAVISPHYDSMLVKCSCSGST 420

Query: 421  YEIVRRKMIRALIEFRIRGVKTNIPFLLTLLTNPVFIEGTYWTTFIDDTPQLFQMVSSQN 480
            YEIVRRKM+RALIEFRIRGVKTNIPFLLTLLT+PVFI G YWTTFIDDTPQLF MVSS+N
Sbjct: 421  YEIVRRKMLRALIEFRIRGVKTNIPFLLTLLTHPVFISGDYWTTFIDDTPQLFHMVSSRN 480

Query: 481  RAQKLLHYLADLAVNGSSIKGQIGLPKLKSNPSVPHLHDAQGNVINVTKSAPPS-GWRQV 539
            RAQKLLHYLADLAVNGSSIKGQIG PKLK++P +P LHD  G+ ++V  S PP  GWR +
Sbjct: 481  RAQKLLHYLADLAVNGSSIKGQIGEPKLKTHPQIPRLHDEDGSPVDV--SVPPQKGWRYL 538

Query: 540  LLEKGPSEFAKQVRQFNGTLLMDTTWRDAHQSLLATRVRTHDLATIAPTTAHALAGAFAL 599
            L  +GP  FAK VR   GTL+MDTTWRDAHQSLLATRVRT+DLA IA TTAHA AGAFAL
Sbjct: 539  LQSEGPEAFAKAVRHNQGTLVMDTTWRDAHQSLLATRVRTYDLAAIAQTTAHAFAGAFAL 598

Query: 600  ECWGGATFDVAMRFLHEDPWERLRKLRSLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVK 659
            ECWGGATFDVAMRFLHEDPWERLR LR LVPNIPFQMLLRGANGVAYSSLPDNAIDHFVK
Sbjct: 599  ECWGGATFDVAMRFLHEDPWERLRILRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVK 658

Query: 660  QAKDNGVDIFRVFDALNDLEQLXXXXXXXXXXXXXXXXXXCYSGDMLQPGKKYNLDYYLE 719
            QAKDNGVDIFRVFDALNDLEQL                  CYSGDMLQPGKKYNLDYYL+
Sbjct: 659  QAKDNGVDIFRVFDALNDLEQLKVGVDAVKKAGGVVEATVCYSGDMLQPGKKYNLDYYLD 718

Query: 720  VVEKIVQMGTHILGIKDMAGTMKPAAAKLLIGSLRTRYPDLPIHVHSHDSAGTAVASMTA 779
            V EKIV MGTHILGIKDMAGTMKPAAAKLLIG++R ++PDLPIHVHSHDSAGTAVASM A
Sbjct: 719  VTEKIVAMGTHILGIKDMAGTMKPAAAKLLIGAIRAKFPDLPIHVHSHDSAGTAVASMAA 778

Query: 780  CALAGADVVDVAINSMSGLTSQPSINALLASLEGNIDTGINVEHVRELDAYWAEMRLLYS 839
            CALAGADVVDVAINSMSGLTSQ S+NA+LASL+G IDTGINV+HV ELDAYWAEMRLLYS
Sbjct: 779  CALAGADVVDVAINSMSGLTSQASVNAVLASLDGQIDTGINVKHVCELDAYWAEMRLLYS 838

Query: 840  CFEADLKGPDPEVYQHEIPGGQLTNLLFQAQQLGLGEQWAETKRAYREANYLLGDIVKVT 899
            CFEADLKGPDPEVY HEIPGGQLTNLLFQAQQLGLGE+W ETK+AY++AN LLGDIVKVT
Sbjct: 839  CFEADLKGPDPEVYDHEIPGGQLTNLLFQAQQLGLGEKWIETKKAYKQANQLLGDIVKVT 898

Query: 900  PTSKVVGDLAQFMVSNKLTSDDIRRLANSLDFPDSVMDFFEGLIGQPYGGFPEPLRSDVL 959
            PTSKVVGDLAQFMVSN+LT DDIRRLANSLDFPDSVMDFFEGL+GQPYGGFPEPLR+D+L
Sbjct: 899  PTSKVVGDLAQFMVSNQLTPDDIRRLANSLDFPDSVMDFFEGLMGQPYGGFPEPLRTDIL 958

Query: 960  RNKRRKLTCRPGLELEPFDLEKIREDLQNRFGDIDECDVASYNMYPRVYEDFQKIRETYG 1019
            +NKRRKL  RPGLEL PFDL KIREDL+ RFGDI+ECDVASYNMYP+VYEDFQKI E YG
Sbjct: 959  KNKRRKLNRRPGLELAPFDLAKIREDLEARFGDINECDVASYNMYPKVYEDFQKILEEYG 1018

Query: 1020 DLSVLPTKNFLAPAEPDEEIEVTIEQGKTLIIKLQAVGDLNKKTGQREVYFELNGELRKI 1079
            DLSVLPT+NFLA     EEIEV IEQGKTLIIKLQAVGDLN++TG REVYFELNGE RKI
Sbjct: 1019 DLSVLPTRNFLAKPRVGEEIEVHIEQGKTLIIKLQAVGDLNEETGIREVYFELNGETRKI 1078

Query: 1080 RVADKSQNIQSVAKPKADVHDTHQIGAPMAGVIIEVKVHKGSLVKKGESIAVLSAMKMEM 1139
            R+ADKSQ +Q++AKPKAD HD  QIGAPMAGVI+EVKVHKGS VKKG+ +AVLSAMKMEM
Sbjct: 1079 RIADKSQVVQTIAKPKADGHDPLQIGAPMAGVIVEVKVHKGSQVKKGQPVAVLSAMKMEM 1138

Query: 1140 VVSSPADGQVKDVFIKDGES 1159
            V+SS  +G VKDV +KDGE+
Sbjct: 1139 VISSTGEGLVKDVLVKDGEN 1158

>KLLA0C05764g complement(512470..515991) highly similar to sp|P32327
            Saccharomyces cerevisiae YBR218c PYC2 pyruvate
            carboxylase 2, start by similarity
          Length = 1173

 Score = 1994 bits (5166), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 950/1156 (82%), Positives = 1042/1156 (90%), Gaps = 1/1156 (0%)

Query: 4    SKKLAGLRDNFSLLGEKNKILVANRGEIPIRIFRSAHELSMRTIAIYSHEDRLSMHRLKA 63
            S +LAGLRDN +L+GEKNK+LVANRGEIPIRIFR+AHELSM+T+AIYSHEDRLSMHRLKA
Sbjct: 2    SSQLAGLRDNSNLMGEKNKLLVANRGEIPIRIFRTAHELSMKTVAIYSHEDRLSMHRLKA 61

Query: 64   DEAYVIGEEGQYTPVGAYLAMDEIIEIAKKHKVDFIHPGYGFLSENSEFADKVVKAGITW 123
            DEAYVIGE+G+YTPVGAYLA+DEII IAK H V+FIHPGYGFLSENSEFA+KV  +GITW
Sbjct: 62   DEAYVIGEQGKYTPVGAYLAIDEIINIAKSHGVNFIHPGYGFLSENSEFAEKVAASGITW 121

Query: 124  IGPPAEVIDSVGDKVSARHLAARANVPTVPGTPGPIETVQEALDFVNEYGYPVIIKAAFX 183
            +GPPA VIDSVGDKVSAR+LA +ANVP VPGTPGPIETV+EA  FV++YG+PVIIKAAF 
Sbjct: 122  VGPPAAVIDSVGDKVSARNLAEKANVPVVPGTPGPIETVEEAQAFVDKYGFPVIIKAAFG 181

Query: 184  XXXXXXXXXXXXXXXADAFQRATSEARTAFGNGTCFVERFLDKPKHIEVQLLADNHGNVV 243
                           +DAFQRA SEA TAFGNGTCF+ERFLDKPKHIEVQLLADN+GNVV
Sbjct: 182  GGGRGMRVVREGDDISDAFQRAKSEAITAFGNGTCFIERFLDKPKHIEVQLLADNYGNVV 241

Query: 244  HLFERDCSVQRRHQKVVEVAPAKTLPREVRDAILTDAVKLAKVCGYRNAGTAEFLVDNQN 303
            HLFERDCSVQRRHQKVVEVAPAKTLP EVRDAILTDAVKLAK  GYRNAGTAEFLVDNQN
Sbjct: 242  HLFERDCSVQRRHQKVVEVAPAKTLPEEVRDAILTDAVKLAKEAGYRNAGTAEFLVDNQN 301

Query: 304  RHYFIEINPRIQVEHTITEEITGIDIVSAQIQIXXXXXXXXXXXXXDKITTRGFSIQCRI 363
            RHYFIEINPRIQVEHTITEEITGIDIV+AQIQI             DKITTRGF+IQCRI
Sbjct: 302  RHYFIEINPRIQVEHTITEEITGIDIVAAQIQIAAGATLEQLGLMQDKITTRGFAIQCRI 361

Query: 364  TTEDPSKNFQPDTGRLEVYRSAGGNGVRLDGGNAYAGATISPHYDSMLVKCSCSGSTYEI 423
            TTEDPSKNFQPDTGR++VYRSAGGNGVRLDGGNA+AG+ ISPHYDSMLVKCSCSGSTYEI
Sbjct: 362  TTEDPSKNFQPDTGRIDVYRSAGGNGVRLDGGNAFAGSVISPHYDSMLVKCSCSGSTYEI 421

Query: 424  VRRKMIRALIEFRIRGVKTNIPFLLTLLTNPVFIEGTYWTTFIDDTPQLFQMVSSQNRAQ 483
            VRRKM+RALIEFRIRGVKTNIPFLLTLLT+PVF  G YWTTFIDDTPQLF+MVSSQNRAQ
Sbjct: 422  VRRKMLRALIEFRIRGVKTNIPFLLTLLTHPVFKSGEYWTTFIDDTPQLFEMVSSQNRAQ 481

Query: 484  KLLHYLADLAVNGSSIKGQIGLPKLKSNPSVPHLHDAQGNVINVTKSAPPSGWRQVLLEK 543
            KLLHYLADLAVNGSSIKGQIGLPKL ++P++PHLH+  G++++V+ + PP+GWR VLL+ 
Sbjct: 482  KLLHYLADLAVNGSSIKGQIGLPKLTTHPTIPHLHNEDGSLVDVS-AKPPAGWRDVLLDY 540

Query: 544  GPSEFAKQVRQFNGTLLMDTTWRDAHQSLLATRVRTHDLATIAPTTAHALAGAFALECWG 603
            GP EFAKQVR+FNGTLLMDTTWRDAHQSLLATRVRT+DLA IAPTTAHA++GAFALECWG
Sbjct: 541  GPEEFAKQVRKFNGTLLMDTTWRDAHQSLLATRVRTYDLAAIAPTTAHAMSGAFALECWG 600

Query: 604  GATFDVAMRFLHEDPWERLRKLRSLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKD 663
            GATFDV+MRFLHEDPWERLR LR LVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKD
Sbjct: 601  GATFDVSMRFLHEDPWERLRTLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKD 660

Query: 664  NGVDIFRVFDALNDLEQLXXXXXXXXXXXXXXXXXXCYSGDMLQPGKKYNLDYYLEVVEK 723
            NGVDIFRVFDALNDLEQL                  CYSGDML PGKKYNLDYYL++ EK
Sbjct: 661  NGVDIFRVFDALNDLEQLKVGVDAVKKAGGVVEATICYSGDMLAPGKKYNLDYYLDITEK 720

Query: 724  IVQMGTHILGIKDMAGTMKPAAAKLLIGSLRTRYPDLPIHVHSHDSAGTAVASMTACALA 783
            IV  GTHILGIKDMAGT+KP+AA+LLIGS+R +YP+LPIHVH+HDSAGT VASM ACAL+
Sbjct: 721  IVNSGTHILGIKDMAGTLKPSAARLLIGSIRAKYPELPIHVHTHDSAGTGVASMAACALS 780

Query: 784  GADVVDVAINSMSGLTSQPSINALLASLEGNIDTGINVEHVRELDAYWAEMRLLYSCFEA 843
            GADVVDVA NSMSGLTSQPSINALLA+L+G ID  +NV +VRELDAYWAEMRLLYSCFEA
Sbjct: 781  GADVVDVATNSMSGLTSQPSINALLAALDGEIDNNVNVGYVRELDAYWAEMRLLYSCFEA 840

Query: 844  DLKGPDPEVYQHEIPGGQLTNLLFQAQQLGLGEQWAETKRAYREANYLLGDIVKVTPTSK 903
            DLKGPDPEVY HEIPGGQLTNLLFQAQQLGLGE+WAETKRAYREAN LLGD+VKVTPTSK
Sbjct: 841  DLKGPDPEVYVHEIPGGQLTNLLFQAQQLGLGEKWAETKRAYREANLLLGDLVKVTPTSK 900

Query: 904  VVGDLAQFMVSNKLTSDDIRRLANSLDFPDSVMDFFEGLIGQPYGGFPEPLRSDVLRNKR 963
            VVGDLAQFMVSNKLTSDD+RRLA+SLDFPDSVMDFFEGLIGQPYGGFPEPLR+DVLRNKR
Sbjct: 901  VVGDLAQFMVSNKLTSDDVRRLASSLDFPDSVMDFFEGLIGQPYGGFPEPLRTDVLRNKR 960

Query: 964  RKLTCRPGLELEPFDLEKIREDLQNRFGDIDECDVASYNMYPRVYEDFQKIRETYGDLSV 1023
            RKLT RPGLEL PF+LEKI+EDL  RF DIDECDVASYNMYP+VYEDF+KI+E YGDLSV
Sbjct: 961  RKLTQRPGLELAPFELEKIKEDLSTRFSDIDECDVASYNMYPKVYEDFRKIKEKYGDLSV 1020

Query: 1024 LPTKNFLAPAEPDEEIEVTIEQGKTLIIKLQAVGDLNKKTGQREVYFELNGELRKIRVAD 1083
            LPTKNFL+P    EEI VTIEQGKTLIIK QA+GDLNK+TG REVYFELNGELRK+ VAD
Sbjct: 1021 LPTKNFLSPPVIGEEIVVTIEQGKTLIIKPQAIGDLNKETGIREVYFELNGELRKVSVAD 1080

Query: 1084 KSQNIQSVAKPKADVHDTHQIGAPMAGVIIEVKVHKGSLVKKGESIAVLSAMKMEMVVSS 1143
            +SQ ++SV+KPKAD HD  QIG+PMAGV++EVKVHKGSL+ KG+ +AVLSAMKMEMV+SS
Sbjct: 1081 RSQKVESVSKPKADAHDPFQIGSPMAGVVVEVKVHKGSLIAKGQPVAVLSAMKMEMVISS 1140

Query: 1144 PADGQVKDVFIKDGES 1159
            PADGQVK+V +KDGE+
Sbjct: 1141 PADGQVKEVLVKDGEN 1156

>AAR162C [350] [Homologous to ScYGL062W (PYC1) - SH; ScYBR218C (PYC2)
            - SH] (634067..637582) [3516 bp, 1171 aa]
          Length = 1171

 Score = 1954 bits (5063), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 939/1154 (81%), Positives = 1027/1154 (88%), Gaps = 1/1154 (0%)

Query: 6    KLAGLRDNFSLLGEKNKILVANRGEIPIRIFRSAHELSMRTIAIYSHEDRLSMHRLKADE 65
            +LAG R + +LLGEKNK+LVANRGEIPIRIFR+AHELSM T+A+YS+EDRLSMHR KADE
Sbjct: 4    QLAGFRRHSNLLGEKNKVLVANRGEIPIRIFRTAHELSMATVAVYSYEDRLSMHRQKADE 63

Query: 66   AYVIGEEGQYTPVGAYLAMDEIIEIAKKHKVDFIHPGYGFLSENSEFADKVVKAGITWIG 125
            AY+IG EGQYTPVGAYLA+DEI+ IA+ H VDFIHPGYGFLSEN+EFA KV  AGITWIG
Sbjct: 64   AYMIGREGQYTPVGAYLAIDEILRIARDHDVDFIHPGYGFLSENAEFAAKVEGAGITWIG 123

Query: 126  PPAEVIDSVGDKVSARHLAARANVPTVPGTPGPIETVQEALDFVNEYGYPVIIKAAFXXX 185
            PPA VI++VGDKVSAR+LAA A+VPTVPGT GPI +V+EA +FV +YGYPVIIKAAF   
Sbjct: 124  PPASVIEAVGDKVSARNLAAVADVPTVPGTEGPISSVEEAEEFVQKYGYPVIIKAAFGGG 183

Query: 186  XXXXXXXXXXXXXADAFQRATSEARTAFGNGTCFVERFLDKPKHIEVQLLADNHGNVVHL 245
                          DAFQRA SEA TAFGNGTCFVERFLD+PKHIEVQLLADN+GNVVHL
Sbjct: 184  GRGMRVVREGDDIRDAFQRARSEAETAFGNGTCFVERFLDQPKHIEVQLLADNYGNVVHL 243

Query: 246  FERDCSVQRRHQKVVEVAPAKTLPREVRDAILTDAVKLAKVCGYRNAGTAEFLVDNQNRH 305
            FERDCSVQRRHQKVVEVAPAKTL +EVRDAILTDAVKLAK  GYRNAGTAEFLVD QNRH
Sbjct: 244  FERDCSVQRRHQKVVEVAPAKTLSKEVRDAILTDAVKLAKASGYRNAGTAEFLVDKQNRH 303

Query: 306  YFIEINPRIQVEHTITEEITGIDIVSAQIQIXXXXXXXXXXXXXDKITTRGFSIQCRITT 365
            YFIEINPRIQVEHTITEEITG+DIV+AQIQI             D+ITTRGF+IQCRITT
Sbjct: 304  YFIEINPRIQVEHTITEEITGVDIVAAQIQIAAGASLEQLGLMQDRITTRGFAIQCRITT 363

Query: 366  EDPSKNFQPDTGRLEVYRSAGGNGVRLDGGNAYAGATISPHYDSMLVKCSCSGSTYEIVR 425
            EDPSKNFQPDTGRL+VYRSAGGNGVRLDGGNA+AGA ISPHYDSMLVKCSCSGSTYEIVR
Sbjct: 364  EDPSKNFQPDTGRLDVYRSAGGNGVRLDGGNAFAGAVISPHYDSMLVKCSCSGSTYEIVR 423

Query: 426  RKMIRALIEFRIRGVKTNIPFLLTLLTNPVFIEGTYWTTFIDDTPQLFQMVSSQNRAQKL 485
            RKM+RALIEFRIRGVKTNIPFLLTLLT+PVFI G YWTTFIDDTPQLF+MV+SQNRAQKL
Sbjct: 424  RKMLRALIEFRIRGVKTNIPFLLTLLTHPVFISGDYWTTFIDDTPQLFEMVASQNRAQKL 483

Query: 486  LHYLADLAVNGSSIKGQIGLPKLKSNPSVPHLHDAQGNVINVTKSAPPSGWRQVLLEKGP 545
            L YL+DLAVNGSSIKGQ+G+PKL + PS+P LH+A+G VI+V +S PP+GWRQVLLE GP
Sbjct: 484  LQYLSDLAVNGSSIKGQMGVPKLLAQPSIPQLHNAKGEVIDV-QSQPPAGWRQVLLEHGP 542

Query: 546  SEFAKQVRQFNGTLLMDTTWRDAHQSLLATRVRTHDLATIAPTTAHALAGAFALECWGGA 605
              FAK+VR+F+GTLL DTTWRDAHQSLLATRVRT+DLA IAPTTAHALAGAFALECWGGA
Sbjct: 543  EVFAKKVREFDGTLLTDTTWRDAHQSLLATRVRTYDLAAIAPTTAHALAGAFALECWGGA 602

Query: 606  TFDVAMRFLHEDPWERLRKLRSLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKDNG 665
            TFDVAMRFLHEDPWERLR LR LVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAK+NG
Sbjct: 603  TFDVAMRFLHEDPWERLRTLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKENG 662

Query: 666  VDIFRVFDALNDLEQLXXXXXXXXXXXXXXXXXXCYSGDMLQPGKKYNLDYYLEVVEKIV 725
            VDIFRVFDALNDLEQL                  CYSGDMLQPGKKYNLDYYLE+ EKIV
Sbjct: 663  VDIFRVFDALNDLEQLKVGVDAVKKAEGLVEATICYSGDMLQPGKKYNLDYYLELTEKIV 722

Query: 726  QMGTHILGIKDMAGTMKPAAAKLLIGSLRTRYPDLPIHVHSHDSAGTAVASMTACALAGA 785
             MGTHILGIKDMAGTMKP AAKLLIGS+R +YPDLPIHVH+HDSAGT VASM  CA++GA
Sbjct: 723  AMGTHILGIKDMAGTMKPGAAKLLIGSIRAKYPDLPIHVHTHDSAGTGVASMVQCAISGA 782

Query: 786  DVVDVAINSMSGLTSQPSINALLASLEGNIDTGINVEHVRELDAYWAEMRLLYSCFEADL 845
            DVVDVA NSMSGLTSQPSI AL ASL G+I TG++ +H  ELDAYWAEMRLLYSCFEADL
Sbjct: 783  DVVDVATNSMSGLTSQPSITALQASLGGDIATGVDPDHAIELDAYWAEMRLLYSCFEADL 842

Query: 846  KGPDPEVYQHEIPGGQLTNLLFQAQQLGLGEQWAETKRAYREANYLLGDIVKVTPTSKVV 905
            KGPDPEVY+HEIPGGQLTNLLFQAQQLGLGEQWAETKRAY EAN LLGD+VKVTPTSKVV
Sbjct: 843  KGPDPEVYKHEIPGGQLTNLLFQAQQLGLGEQWAETKRAYAEANQLLGDLVKVTPTSKVV 902

Query: 906  GDLAQFMVSNKLTSDDIRRLANSLDFPDSVMDFFEGLIGQPYGGFPEPLRSDVLRNKRRK 965
            GDLAQFMVSN+L SDD+RRLA+SLDFPDSVMDFFEGLIGQPYGGFPEPLRSDVLRNKRRK
Sbjct: 903  GDLAQFMVSNRLNSDDVRRLASSLDFPDSVMDFFEGLIGQPYGGFPEPLRSDVLRNKRRK 962

Query: 966  LTCRPGLELEPFDLEKIREDLQNRFGDIDECDVASYNMYPRVYEDFQKIRETYGDLSVLP 1025
            L  RPGLEL PFDL+KIRE+L++RF +IDECDVASYNMYP+VYEDF+KIRETYGDLSVLP
Sbjct: 963  LKVRPGLELAPFDLDKIREELRSRFDNIDECDVASYNMYPKVYEDFRKIRETYGDLSVLP 1022

Query: 1026 TKNFLAPAEPDEEIEVTIEQGKTLIIKLQAVGDLNKKTGQREVYFELNGELRKIRVADKS 1085
            T NFL+P +  EEI VTIEQGK LIIKLQA+GDLNK+TG+REVYFELNGELRK+ VADKS
Sbjct: 1023 THNFLSPPKIGEEIIVTIEQGKVLIIKLQAIGDLNKETGKREVYFELNGELRKVSVADKS 1082

Query: 1086 QNIQSVAKPKADVHDTHQIGAPMAGVIIEVKVHKGSLVKKGESIAVLSAMKMEMVVSSPA 1145
            Q +++V+K KAD HD  Q+GAPMAGVIIEVKVHKGS V KG+ +AVLSAMKMEMV+SSP+
Sbjct: 1083 QKLETVSKLKADAHDQFQVGAPMAGVIIEVKVHKGSAVTKGQPVAVLSAMKMEMVISSPS 1142

Query: 1146 DGQVKDVFIKDGES 1159
            DGQVKDVF+ DGE+
Sbjct: 1143 DGQVKDVFVSDGET 1156

>Sklu_1458.1 YGL062W, Contig c1458 155-3553 reverse complement
          Length = 1132

 Score = 1936 bits (5015), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 927/1116 (83%), Positives = 1005/1116 (90%), Gaps = 1/1116 (0%)

Query: 44   MRTIAIYSHEDRLSMHRLKADEAYVIGEEGQYTPVGAYLAMDEIIEIAKKHKVDFIHPGY 103
            M+T+AIYS+EDRLSMHRLKADEAY+IGE G+YTPVGAYLA+DEII IAK+H V FIHPGY
Sbjct: 1    MKTVAIYSNEDRLSMHRLKADEAYMIGEGGKYTPVGAYLAIDEIISIAKEHGVSFIHPGY 60

Query: 104  GFLSENSEFADKVVKAGITWIGPPAEVIDSVGDKVSARHLAARANVPTVPGTPGPIETVQ 163
            GFLSEN+EFA KV+ AGITWIGPP EVI+SVGDKVSAR LAA+ANVPTVPGTPGPIE+V+
Sbjct: 61   GFLSENAEFAAKVIDAGITWIGPPPEVINSVGDKVSARDLAAKANVPTVPGTPGPIESVE 120

Query: 164  EALDFVNEYGYPVIIKAAFXXXXXXXXXXXXXXXXADAFQRATSEARTAFGNGTCFVERF 223
            EA  FV EYGYPVIIKAAF                 DAFQRATSEA+TAFGNGTCFVERF
Sbjct: 121  EAEAFVAEYGYPVIIKAAFGGGGRGMRVVREGDDIGDAFQRATSEAKTAFGNGTCFVERF 180

Query: 224  LDKPKHIEVQLLADNHGNVVHLFERDCSVQRRHQKVVEVAPAKTLPREVRDAILTDAVKL 283
            LDKPKHIEVQLLADN+GNV+HLFERDCSVQRRHQKVVEVAPAKTLP+EVRD+ILTDAVKL
Sbjct: 181  LDKPKHIEVQLLADNYGNVIHLFERDCSVQRRHQKVVEVAPAKTLPKEVRDSILTDAVKL 240

Query: 284  AKVCGYRNAGTAEFLVDNQNRHYFIEINPRIQVEHTITEEITGIDIVSAQIQIXXXXXXX 343
            AK   YRNAGTAEFLVD QNRHYFIEINPRIQVEHTITEEITG+D+V+AQIQI       
Sbjct: 241  AKEAKYRNAGTAEFLVDAQNRHYFIEINPRIQVEHTITEEITGVDVVAAQIQIAAGASLQ 300

Query: 344  XXXXXXDKITTRGFSIQCRITTEDPSKNFQPDTGRLEVYRSAGGNGVRLDGGNAYAGATI 403
                  DKITTRGF+IQCRITTEDPSKNFQPDTGR+EVYRSAGGNGVRLDGGNAYAGA I
Sbjct: 301  QLGLLQDKITTRGFAIQCRITTEDPSKNFQPDTGRIEVYRSAGGNGVRLDGGNAYAGAVI 360

Query: 404  SPHYDSMLVKCSCSGSTYEIVRRKMIRALIEFRIRGVKTNIPFLLTLLTNPVFIEGTYWT 463
            SPHYDSMLVKCSCSGSTYEIVRRKM+RALIEFRIRGVKTNIPFLLTLLT+ VF  G YWT
Sbjct: 361  SPHYDSMLVKCSCSGSTYEIVRRKMLRALIEFRIRGVKTNIPFLLTLLTHSVFKSGEYWT 420

Query: 464  TFIDDTPQLFQMVSSQNRAQKLLHYLADLAVNGSSIKGQIGLPKLKSNPSVPHLHDAQGN 523
            TFIDDTPQLF+MVSSQNRAQKLLHYLADLAVNGSSIKGQIGLPKL + PSVP LHD+ GN
Sbjct: 421  TFIDDTPQLFEMVSSQNRAQKLLHYLADLAVNGSSIKGQIGLPKLTTQPSVPTLHDSNGN 480

Query: 524  VINVTKSAPPSGWRQVLLEKGPSEFAKQVRQFNGTLLMDTTWRDAHQSLLATRVRTHDLA 583
            V++V  +APP+GWR VLLE+GP  FAKQVR++NGTLLMDTTWRDAHQSLLATRVRTHDLA
Sbjct: 481  VVDVL-AAPPAGWRDVLLEQGPEGFAKQVRKYNGTLLMDTTWRDAHQSLLATRVRTHDLA 539

Query: 584  TIAPTTAHALAGAFALECWGGATFDVAMRFLHEDPWERLRKLRSLVPNIPFQMLLRGANG 643
            TIAPTTAHALAGAFALECWGGATF VAMRFLHEDPWERLR LR LVPNIPFQMLLRGANG
Sbjct: 540  TIAPTTAHALAGAFALECWGGATFVVAMRFLHEDPWERLRVLRKLVPNIPFQMLLRGANG 599

Query: 644  VAYSSLPDNAIDHFVKQAKDNGVDIFRVFDALNDLEQLXXXXXXXXXXXXXXXXXXCYSG 703
            VAYSSLPDNAIDHFV QAK+NGVDIFRVFDALNDLEQL                  CYSG
Sbjct: 600  VAYSSLPDNAIDHFVLQAKENGVDIFRVFDALNDLEQLKVGVDAVKKAGGVVEATVCYSG 659

Query: 704  DMLQPGKKYNLDYYLEVVEKIVQMGTHILGIKDMAGTMKPAAAKLLIGSLRTRYPDLPIH 763
            DMLQPGKKYNLDYYLE+ +KIV+MGTHILGIKDMAGT+KP+AAKLLIGS+R +YPDLPIH
Sbjct: 660  DMLQPGKKYNLDYYLEITDKIVKMGTHILGIKDMAGTLKPSAAKLLIGSIRAKYPDLPIH 719

Query: 764  VHSHDSAGTAVASMTACALAGADVVDVAINSMSGLTSQPSINALLASLEGNIDTGINVEH 823
            VH+HDSAGTAVASM ACALAGADVVDVA NSMSGLTSQPSINALLASL+G I+  ++V  
Sbjct: 720  VHTHDSAGTAVASMAACALAGADVVDVATNSMSGLTSQPSINALLASLDGEINNNVDVNM 779

Query: 824  VRELDAYWAEMRLLYSCFEADLKGPDPEVYQHEIPGGQLTNLLFQAQQLGLGEQWAETKR 883
            VRELDAYWA+MRLLYSCFEADLKGPDPEVYQHEIPGGQLTNLLFQAQQLGLGE+WAETKR
Sbjct: 780  VRELDAYWAQMRLLYSCFEADLKGPDPEVYQHEIPGGQLTNLLFQAQQLGLGERWAETKR 839

Query: 884  AYREANYLLGDIVKVTPTSKVVGDLAQFMVSNKLTSDDIRRLANSLDFPDSVMDFFEGLI 943
            AYREANYLLGD+VKVTPTSKVVGDLAQFMV+NKL SDD+RRLA+SLDFPDSVMDFFEGLI
Sbjct: 840  AYREANYLLGDLVKVTPTSKVVGDLAQFMVTNKLNSDDVRRLASSLDFPDSVMDFFEGLI 899

Query: 944  GQPYGGFPEPLRSDVLRNKRRKLTCRPGLELEPFDLEKIREDLQNRFGDIDECDVASYNM 1003
            GQPYGGFPEPLR+DVL+NKRRKLTCRPGLEL PFDLE+I+EDL +RFGDIDECDVASYNM
Sbjct: 900  GQPYGGFPEPLRTDVLKNKRRKLTCRPGLELPPFDLERIKEDLSSRFGDIDECDVASYNM 959

Query: 1004 YPRVYEDFQKIRETYGDLSVLPTKNFLAPAEPDEEIEVTIEQGKTLIIKLQAVGDLNKKT 1063
            YP+VYEDF+KIRE YGDLSVLPTKNFL+P    EEI VTIEQGKTLIIK QA+GDLNK T
Sbjct: 960  YPKVYEDFRKIREQYGDLSVLPTKNFLSPPAVGEEIVVTIEQGKTLIIKPQAIGDLNKDT 1019

Query: 1064 GQREVYFELNGELRKIRVADKSQNIQSVAKPKADVHDTHQIGAPMAGVIIEVKVHKGSLV 1123
            G REVYFELNGELRK+ V D+SQ +++++KPKAD HD +Q+GAPMAGV++EVKVHKGSLV
Sbjct: 1020 GIREVYFELNGELRKVSVVDRSQKVETISKPKADAHDPYQVGAPMAGVVVEVKVHKGSLV 1079

Query: 1124 KKGESIAVLSAMKMEMVVSSPADGQVKDVFIKDGES 1159
            KKG+ +AVLSAMKMEMV+SSPA G VKDV IKDGE+
Sbjct: 1080 KKGQPVAVLSAMKMEMVISSPAAGLVKDVLIKDGEN 1115

>CAGL0M05533g complement(588667..594171) similar to sp|P32528
            Saccharomyces cerevisiae YBR208c DUR1 urea amidolyase,
            hypothetical start
          Length = 1834

 Score =  302 bits (773), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 175/456 (38%), Positives = 251/456 (55%), Gaps = 11/456 (2%)

Query: 13   NFSLLGEKNKILVANRGEIPIRIFRSAHELSMRTIAIYSHEDRLSMHRLKADEAYVIGEE 72
            N S  G    +LVANRGEI +RI ++   + ++++AIYS  D+ S H L  D A  +   
Sbjct: 623  NESKKGHFKTVLVANRGEIAVRIIKTLKSMQIKSLAIYSATDKYSQHVLDVDMAQALD-- 680

Query: 73   GQYTPVGAYLAMDEIIEIAKKHKVDFIHPGYGFLSENSEFADKVVKAGITWIGPPAEVID 132
              +T    YL +++II IAKK+ VD I PGYGFLSEN+ FAD+  + GI +IGP  E I 
Sbjct: 681  -GHTVEETYLHVEKIISIAKKYDVDAIIPGYGFLSENASFADRCEQEGIQFIGPRGETIR 739

Query: 133  SVGDKVSARHLAARANVPTVPGTPGPIETVQEALDFVNEYGYPVIIKAAFXXXXXXXXXX 192
             +G K SAR +A  A VP VPG+P  ++   EA       GYPV++K+            
Sbjct: 740  KLGLKHSAREVAKSAGVPLVPGSP-LVKNADEAFTIAKNIGYPVMVKSTAGGGGIGLQKV 798

Query: 193  XXXXXXADAFQRATSEARTAFGNGTCFVERFLDKPKHIEVQLLADNHGNVVHLFERDCSV 252
                    AF+    +  + FG+   F+E+F+D  +H+EVQ++ D  G  + L ERDCS+
Sbjct: 799  DNEQDMRKAFETVKHQGSSYFGDSGVFMEKFIDNARHVEVQIMGDGKGKTLALGERDCSL 858

Query: 253  QRRHQKVVEVAPAKTLPREVRDAILTDAVKLAKVCGYRNAGTAEFLVDNQ-NRHYFIEIN 311
            QRR+QKV+E  PA  LPRE R  +LT A +L     YR AGT EF+ D Q ++ YF+E+N
Sbjct: 859  QRRNQKVIEETPAPNLPRETRQKMLTAAERLGAYLNYRGAGTVEFIYDEQRDQFYFLEVN 918

Query: 312  PRIQVEHTITEEITGIDIVSAQIQIXXXXXXXXXXXXXDKITTRGFSIQCRITTEDPSKN 371
             R+QVEH ITE +TG+D+V   I+I               I+  G SI+ R+  E+P K+
Sbjct: 919  TRLQVEHPITEMVTGLDLVEWMIKISAGVMPSLDEF---NISQNGASIEVRVYAENPLKD 975

Query: 372  FQPDTGRLEVYRSAGGNGVRLDGGNAYAGATISPHYDSMLVKCSCSGSTYEIVRRKMIRA 431
            F+P  G L   +    N  R+D      G  ISP +D  L K    G        KM +A
Sbjct: 976  FRPSPGELVDVQFP--NDCRVDTW-VKKGTKISPEFDPTLAKIIVHGKDRNEAILKMKKA 1032

Query: 432  LIEFRIRGVKTNIPFLLTLLTNPVFIEGTYWTTFID 467
            L E +I G  TN+ +L +L+++ +F      T +++
Sbjct: 1033 LNETKIYGCVTNVDYLKSLISSEMFRNAQLSTNYLN 1068

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 39/77 (50%)

Query: 1082 ADKSQNIQSVAKPKADVHDTHQIGAPMAGVIIEVKVHKGSLVKKGESIAVLSAMKMEMVV 1141
            AD  Q    V +      D   I +  AG   +  V  G+ ++K + +AV+ AMK EM+V
Sbjct: 1744 ADLKQTTTEVIEQNILEDDCEYIFSEYAGRFWKPIVEIGASIEKDQGVAVIEAMKTEMIV 1803

Query: 1142 SSPADGQVKDVFIKDGE 1158
            SS   G++K    K+G+
Sbjct: 1804 SSSVVGKLKKFLFKNGD 1820

>YBR208C (DUR1,2) [390] chr2 complement(636660..642167) Urea
            amidolyase, contains urea carboxylase and allophanate
            hydrolase activities fused together in a single
            polypeptide [5508 bp, 1835 aa]
          Length = 1835

 Score =  284 bits (726), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 169/471 (35%), Positives = 254/471 (53%), Gaps = 19/471 (4%)

Query: 6    KLAGLRDNFSLLGEK--------NKILVANRGEIPIRIFRSAHELSMRTIAIYSHEDRLS 57
            K  G R  F +L +K        + +L+ANRGEI +RI ++  +L +R++A+YS  D+ S
Sbjct: 611  KYGGFRAYFEMLKKKESQKKKLFDTVLIANRGEIAVRIIKTLKKLGIRSVAVYSDPDKYS 670

Query: 58   MHRLKADEAYVIGEEGQYTPVGAYLAMDEIIEIAKKHKVDFIHPGYGFLSENSEFADKVV 117
             H   AD +  +      T    YL M++II+ AK+     I PGYGFLSEN++F+D   
Sbjct: 671  QHVTDADVSVPLHGT---TAAQTYLDMNKIIDAAKQTNAQAIIPGYGFLSENADFSDACT 727

Query: 118  KAGITWIGPPAEVIDSVGDKVSARHLAARANVPTVPGTPGPIETVQEALDFVNEYGYPVI 177
             AGIT++GP  ++I  +G K SAR +A +A VP VPG+   I +V+EA     E  YPV+
Sbjct: 728  SAGITFVGPSGDIIRGLGLKHSARQIAQKAGVPLVPGSL-LITSVEEAKKVAAELEYPVM 786

Query: 178  IKAAFXXXXXXXXXXXXXXXXADAFQRATSEARTAFGNGTCFVERFLDKPKHIEVQLLAD 237
            +K+                     F+    +  T FG+   F+ERF++  +H+EVQL+ D
Sbjct: 787  VKSTAGGGGIGLQKVDSEEDIEHIFETVKHQGETFFGDAGVFLERFIENARHVEVQLMGD 846

Query: 238  NHGNVVHLFERDCSVQRRHQKVVEVAPAKTLPREVRDAILTDAVKLAKVCGYRNAGTAEF 297
              G  + L ERDCS+QRR+QKV+E  PA  LP + R A+   A  L  +  Y+ AGT EF
Sbjct: 847  GFGKAIALGERDCSLQRRNQKVIEETPAPNLPEKTRLALRKAAESLGSLLNYKCAGTVEF 906

Query: 298  LVD-NQNRHYFIEINPRIQVEHTITEEITGIDIVSAQIQIXXXXXXXXXXXXXDKITTRG 356
            + D  ++  YF+E+N R+QVEH ITE +TG+D+V   I+I              K+   G
Sbjct: 907  IYDEKKDEFYFLEVNTRLQVEHPITEMVTGLDLVEWMIRIAANDAPDFDST---KVEVNG 963

Query: 357  FSIQCRITTEDPSKNFQPDTGRLEVYRSAGGNGVRLDGGNAYAGATISPHYDSMLVKCSC 416
             S++ R+  E+P KNF+P  G L   +    +  R+D      G  ISP YD  L K   
Sbjct: 964  VSMEARLYAENPLKNFRPSPGLLVDVKFP--DWARVDTW-VKKGTNISPEYDPTLAKIIV 1020

Query: 417  SGSTYEIVRRKMIRALIEFRIRGVKTNIPFLLTLLTNPVFIEGTYWTTFID 467
             G   +    K+ +AL E ++ G  TNI +L +++T+  F +    T  ++
Sbjct: 1021 HGKDRDDAISKLNQALEETKVYGCITNIDYLKSIITSDFFAKAKVSTNILN 1071

 Score = 33.1 bits (74), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 11/39 (28%), Positives = 26/39 (66%)

Query: 1120 GSLVKKGESIAVLSAMKMEMVVSSPADGQVKDVFIKDGE 1158
            G +++ G+ + ++ AMK EM++S+P  G++  +   +G+
Sbjct: 1782 GDVIEAGQGLLIIEAMKAEMIISAPKSGKIIKICHGNGD 1820

>Sklu_2124.1 YBR208C, Contig c2124 43-5535 reverse complement
          Length = 1830

 Score =  276 bits (706), Expect = 8e-76,   Method: Compositional matrix adjust.
 Identities = 160/459 (34%), Positives = 246/459 (53%), Gaps = 14/459 (3%)

Query: 23   ILVANRGEIPIRIFRSAHELSMRTIAIYSHEDRLSMHRLKADEAYVIGEEGQYTPVGAYL 82
            +L+ANRGEI +RI ++  +L++R++A+YS  D+ S H + AD    +      T    YL
Sbjct: 629  VLIANRGEIAVRIIKTLKKLNIRSVAVYSDPDKYSQHVIDADLGVALNGR---TAAETYL 685

Query: 83   AMDEIIEIAKKHKVDFIHPGYGFLSENSEFADKVVKAGITWIGPPAEVIDSVGDKVSARH 142
             +D+II+ AK      I PGYGFLSEN+EFADK V+ GI ++GP  E I  +G K SAR 
Sbjct: 686  DIDKIIKAAKDTNAQAIIPGYGFLSENAEFADKCVEEGIVFVGPSGEAIRKLGLKHSARE 745

Query: 143  LAARANVPTVPGTPGPIETVQEALDFVNEYGYPVIIKAAFXXXXXXXXXXXXXXXXADAF 202
            +A +A VP VPG+ G + + +EA +  N+  YPV++K+                     F
Sbjct: 746  IAEKAGVPLVPGS-GLVTSAKEAKEIANKLEYPVMVKSTAGGGGIGLQKVDSENEIERVF 804

Query: 203  QRATSEARTAFGNGTCFVERFLDKPKHIEVQLLADNHGNVVHLFERDCSVQRRHQKVVEV 262
            +    + +  FG+   F+ERF++  +H+E+Q++ D +G  + + ERDCS+QRR+QK++E 
Sbjct: 805  ETVQHQGKAYFGDSGVFLERFVENARHVEIQMMGDGYGKAIAIGERDCSLQRRNQKIIEE 864

Query: 263  APAKTLPREVRDAILTDAVKLAKVCGYRNAGTAEFLVDN-QNRHYFIEINPRIQVEHTIT 321
             PA  L    R  +   A  L  +  Y+ AGT EF+ D  ++  YF+E+N R+QVEH IT
Sbjct: 865  TPAPNLGETTRTKMRQAAESLGSLLKYKCAGTVEFIYDERRDEFYFLEVNARLQVEHPIT 924

Query: 322  EEITGIDIVSAQIQIXXXXXXXXXXXXXDKITTRGFSIQCRITTEDPSKNFQPDTGRLEV 381
            E +TG+D+V   ++I               I   G SI+ R+  E+P+K+F+P  G L  
Sbjct: 925  EMVTGLDLVEWMLRIAADDAPDFESA---NIVVTGASIEARLYAENPAKDFRPSPGLLTD 981

Query: 382  YRSAGGNGVRLDGGNAYAGATISPHYDSMLVKCSCSGSTYEIVRRKMIRALIEFRIRGVK 441
                     R+D   +  G T+S  YD  L K    G        KM +AL E  + G  
Sbjct: 982  VHFP--EWARVDTWVS-KGTTVSAEYDPTLAKIIVHGKDRNDAIMKMNKALNETVVYGCI 1038

Query: 442  TNIPFLLTLLTNPVFIEGTYWTTFIDD---TPQLFQMVS 477
            TNI +L ++ ++ +F      T  +D     P  F++ S
Sbjct: 1039 TNIDYLRSIASSEMFKTAKVATKILDSYDYKPCAFEVTS 1077

 Score = 37.7 bits (86), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 45/87 (51%), Gaps = 7/87 (8%)

Query: 1077 RKIRVADKSQNIQSVAKPKADVHDTHQIGAPM-----AGVIIEVKVHKGSLVKKGESIAV 1131
            R I+VA+  Q ++S    K+ V + +   A M     +G   +  V  G  V KG+ + +
Sbjct: 1734 RLIQVAN--QELESSTTNKSAVEEEYPEDAEMVYSEYSGRFWKPMVSAGDTVTKGDGLVI 1791

Query: 1132 LSAMKMEMVVSSPADGQVKDVFIKDGE 1158
            + AMK EMVV +   G+V  +  K+G+
Sbjct: 1792 VEAMKTEMVVPAKKSGKVLKIVHKNGD 1818

>ADR051C [1792] [Homologous to ScYBR208C (DUR12) - SH]
            (796213..801672) [5460 bp, 1819 aa]
          Length = 1819

 Score =  274 bits (701), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 164/461 (35%), Positives = 244/461 (52%), Gaps = 19/461 (4%)

Query: 21   NKILVANRGEIPIRIFRSAHELSMRTIAIYSHEDRLSMHRLKADEAYVIGEEGQYTPVGA 80
            + +LVANRGEI +RI R+   L +R++A+YS  DR S H   AD A  +G     +    
Sbjct: 623  DTVLVANRGEIAVRIIRTLKRLGIRSVAVYSDPDRHSQHVRDADVAVALGGS---SAAET 679

Query: 81   YLAMDEIIEIAKKHKVDFIHPGYGFLSENSEFADKVVKAGITWIGPPAEVIDSVGDKVSA 140
            YL +D+I+  AKK     I PGYGFLSEN+ FA++    GI ++GP  + I  +G K  A
Sbjct: 680  YLDIDKILAAAKKTDTQAIIPGYGFLSENATFAERCGAEGIVFVGPSGDSIRKLGLKHWA 739

Query: 141  RHLAARANVPTVPGTPGPIETVQEALDFVNEYGYPVIIKAAFXXXXXXXXXXXXXXXXAD 200
            R LAA A VP   GT G +++   AL+   E GYP+++K+                  A 
Sbjct: 740  RELAASAGVPLTKGT-GLLQSASAALEAGEEIGYPLMVKSTAGGGGIGLQRVDSAAELAA 798

Query: 201  AFQRATSEARTAFGNGTCFVERFLDKPKHIEVQLLADNHGNVVHLFERDCSVQRRHQKVV 260
            AF++   +    F +   F+E F+ + +H+EVQ++ D HG  V L ERDCS+QRR+QK++
Sbjct: 799  AFEQVQRQGELYFTDSGVFLESFIARARHVEVQIMGDGHGRTVALGERDCSLQRRNQKII 858

Query: 261  EVAPAKTLPREVRDAILTDAVKLAKVCGYRNAGTAEFLVDNQ-NRHYFIEINPRIQVEHT 319
            E  PA  LP   R  +   A +L     Y+ AGT EF+ D Q +  YF+E+N R+QVEH 
Sbjct: 859  EETPAPNLPAHTRQKMRQAAQRLCSAVKYKCAGTVEFMYDEQKDEFYFLEVNTRLQVEHP 918

Query: 320  ITEEITGIDIVSAQIQIXXXXXXXXXXXXXDKITTRGFSIQCRITTEDPSKNFQPDTGRL 379
            ITE +TG+D+V   ++I               +   G S++ R+  E+P K F P  G L
Sbjct: 919  ITEMVTGLDLVEWMLRIAANTPPDFDA----GVEIEGVSMEARVYVENPVKGFTPSPGLL 974

Query: 380  E--VYRSAGGNGVRLDGGNAYAGATISPHYDSMLVKCSCSGSTYEIVRRKMIRALIEFRI 437
               V+ S      R+D      G  ++  YD  L K    G   E    K++ AL E RI
Sbjct: 975  TEVVFPSWA----RVDTW-ILKGTRVAAEYDPTLAKIIVHGKDREDAVSKLLLALSETRI 1029

Query: 438  RGVKTNIPFLLTLLTNPVFIEGTYWTTFIDD---TPQLFQM 475
             G  TN+ +L ++ ++  F + + +T  ++D   TP  F++
Sbjct: 1030 AGCMTNLDYLKSIASSEEFRKASVFTRLLNDFEYTPTAFEV 1070

 Score = 50.4 bits (119), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 52/97 (53%), Gaps = 3/97 (3%)

Query: 1062 KTGQREVYFELNGELRKIRVADKSQNIQSVAKPKADVHDTHQIGAPMAGVIIEVKVHKGS 1121
            ++G+R   F     L K+  +D    ++  A+P     D H + +  AG   +  V  G 
Sbjct: 1712 QSGERAAEF---ARLIKVANSDLETAVRKEAEPVEYPEDAHMVYSEYAGRFWKQVVSVGD 1768

Query: 1122 LVKKGESIAVLSAMKMEMVVSSPADGQVKDVFIKDGE 1158
             VK+G+ + ++ AMK EMVVS+ ADG+V ++   +G+
Sbjct: 1769 KVKEGDKLVIIEAMKTEMVVSATADGEVINILHANGD 1805

>KLLA0E08107g 730334..735823 highly similar to sp|P32528 Saccharomyces
            cerevisiae YBR208c DUR1_2 urea amidolyase, start by
            similarity
          Length = 1829

 Score =  270 bits (689), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 156/459 (33%), Positives = 248/459 (54%), Gaps = 14/459 (3%)

Query: 23   ILVANRGEIPIRIFRSAHELSMRTIAIYSHEDRLSMHRLKADEAYVIGEEGQYTPVGAYL 82
            +L+ANRGEI +RI ++   + ++++A+YS  D+ S H   AD  + +   G+ T    YL
Sbjct: 627  VLIANRGEIAVRIMKTLKRMGIKSVAVYSDPDKYSQHVTDAD--FSVALHGR-TAAETYL 683

Query: 83   AMDEIIEIAKKHKVDFIHPGYGFLSENSEFADKVVKAGITWIGPPAEVIDSVGDKVSARH 142
             +D+II  AKK     I PGYGFLSEN++F+D+  +  I ++GP  + I  +G K SAR 
Sbjct: 684  DIDKIINAAKKTGAQAIIPGYGFLSENADFSDRCSQENIVFVGPSGDAIRKLGLKHSARE 743

Query: 143  LAARANVPTVPGTPGPIETVQEALDFVNEYGYPVIIKAAFXXXXXXXXXXXXXXXXADAF 202
            +A RA VP VPG+ G I+  +EA +   +  YPV++K+                     F
Sbjct: 744  IAERAKVPLVPGS-GLIKDAKEAKEVAKKLEYPVMVKSTAGGGGIGLQKVDSEDDIERVF 802

Query: 203  QRATSEARTAFGNGTCFVERFLDKPKHIEVQLLADNHGNVVHLFERDCSVQRRHQKVVEV 262
            +    + ++ FG+   F+ERF++  +H+E+Q++ D  G  + + ERDCS+QRR+QKV+E 
Sbjct: 803  ETVQHQGKSYFGDAGVFMERFVNNARHVEIQMMGDGFGKAIAIGERDCSLQRRNQKVIEE 862

Query: 263  APAKTLPREVRDAILTDAVKLAKVCGYRNAGTAEFLVDNQ-NRHYFIEINPRIQVEHTIT 321
             PA  LP   R  +   + +L  +  Y+ AGT EF+ D Q +  YF+E+N R+QVEH IT
Sbjct: 863  TPAPNLPEATRAKMRAASERLGSLLKYKCAGTVEFIYDEQRDEFYFLEVNARLQVEHPIT 922

Query: 322  EEITGIDIVSAQIQIXXXXXXXXXXXXXDKITTRGFSIQCRITTEDPSKNFQPDTGRLEV 381
            E +TG+D+V   ++I              KI   G SI+ R+  E+P K+F+P  G+L  
Sbjct: 923  EMVTGLDLVEWMLRIAANDSPDFDNT---KIEVSGASIEARLYAENPVKDFRPSPGQLT- 978

Query: 382  YRSAGGNGVRLDGGNAYAGATISPHYDSMLVKCSCSGSTYEIVRRKMIRALIEFRIRGVK 441
               +  +  R+D      G  +S  YD  L K    G        K+ +AL E  + G  
Sbjct: 979  -SVSFPSWARVDTW-VKKGTNVSAEYDPTLAKIIVHGKDRNDAIMKLNQALNETAVYGCI 1036

Query: 442  TNIPFLLTLLTNPVFIEGTYWTTFIDD---TPQLFQMVS 477
            TNI +L ++ ++ +F E    T  +D     P  F++++
Sbjct: 1037 TNIDYLRSIASSKMFKEAKVATKVLDSFDYKPCAFEVLA 1075

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 43/88 (48%), Gaps = 11/88 (12%)

Query: 1073 NGELRKIRVADKSQNIQSVAKPKADVHD--THQIGAPMAGVIIEVKVHKGSLVKKGESIA 1130
            N EL+K    DK Q+++        ++   T +   P+A V        G  V+ G+ + 
Sbjct: 1739 NAELKK-SGDDKPQDVEEYPDDAELLYSEYTGRFWKPVAAV--------GDHVEAGDGVI 1789

Query: 1131 VLSAMKMEMVVSSPADGQVKDVFIKDGE 1158
            ++ AMK EMVV +   G+V  +  K+G+
Sbjct: 1790 IIEAMKTEMVVGATKSGKVYKILHKNGD 1817

>Scas_721.40
          Length = 1834

 Score =  265 bits (677), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 153/449 (34%), Positives = 247/449 (55%), Gaps = 17/449 (3%)

Query: 23   ILVANRGEIPIRIFRSAHELSMRTIAIYSHEDRLSMHRLKADEAYVIGEEGQYTPVGAYL 82
            +LVANRGEI +RI ++  ++ ++++AI+S  DR S H + AD    +  +G  +    YL
Sbjct: 630  VLVANRGEIAVRIIKTLKKMEIQSVAIFSTPDRYSQHVIDAD--LTVDLKG-VSAADTYL 686

Query: 83   AMDEIIEIAKKHKVDFIHPGYGFLSENSEFADKVVKAGITWIGPPAEVIDSVGDKVSARH 142
             +++II+ AKK     I PGYGFLSEN++F+++    GIT++GP  +V+  +G K SAR 
Sbjct: 687  NIEKIIDAAKKTGAQAIIPGYGFLSENADFSERCDAEGITFVGPSGDVMRGLGLKHSARE 746

Query: 143  LAARANVPTVPGTPGPIETVQEALDFVNEYGYPVIIKAAFXXXXXXXXXXXXXXXXADAF 202
            +A +ANVP VPG+   I T  EA +   +  YP+++K+                     F
Sbjct: 747  IAKKANVPLVPGS-SLITTAHEAKEIAAKLEYPIMVKSTAGGGGIGLQKVESEDDIERIF 805

Query: 203  QRATSEARTAFGNGTCFVERFLDKPKHIEVQLLADNHGNVVHLFERDCSVQRRHQKVVEV 262
            +    +    FG+   F+ERF++  +H+EVQ++ D  GN + + ERDCS+QRR+QK++E 
Sbjct: 806  ETVKHQGAAYFGDSGVFMERFIENARHVEVQIMGDGLGNALAIGERDCSLQRRNQKIIEE 865

Query: 263  APAKTLPREVRDAILTDAVKLAKVCGYRNAGTAEFLVDN-QNRHYFIEINPRIQVEHTIT 321
             PA  LP   R  +   A +L  +  Y+ AGT EF+ D  ++  YF+E+N R+QVEH IT
Sbjct: 866  TPAPNLPETTRQKLREAAQRLGSLLKYKCAGTVEFIYDEIRDEFYFLEVNTRLQVEHPIT 925

Query: 322  EEITGIDIVSAQIQIXXXXXXXXXXXXXDKITTRGFSIQCRITTEDPSKNFQPDTGRL-- 379
            E +TGID+V   + I              KI   G +++ R+  E+P  +F+P  G+L  
Sbjct: 926  EMVTGIDLVEWMLVIAADMAPDFNQL---KIDVNGVAMEARLYAENPVHDFKPSPGQLVE 982

Query: 380  -EVYRSAGGNGVRLDGGNAYAGATISPHYDSMLVKCSCSGSTYEIVRRKMIRALIEFRIR 438
             E  + A     R+D   +  G  ++P YD  L K    G        K+ +AL+E ++ 
Sbjct: 983  VEFPKWA-----RIDTWVS-KGTIVTPEYDPTLAKIIVHGKDRHDALEKLNKALVETKVS 1036

Query: 439  GVKTNIPFLLTLLTNPVFIEGTYWTTFID 467
            G  TNI +L ++ ++ +F +    T  ++
Sbjct: 1037 GCITNIDYLRSISSSEMFRDAKVSTNILN 1065

 Score = 35.4 bits (80), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 41/85 (48%), Gaps = 13/85 (15%)

Query: 1073 NGELRKIRVADKSQNIQSVAKPKADVHDTHQIGAPMAGVIIEVKVHKGSLVKKGESIAVL 1132
            N E+ K +V D  +N             +  I +  +G   +  V +G  VK G+ + ++
Sbjct: 1746 NDEIEKDQVNDYPEN-------------SVMIYSEYSGRFWKPLVTEGEFVKSGQGLIII 1792

Query: 1133 SAMKMEMVVSSPADGQVKDVFIKDG 1157
             AMK EM+V +  DG+V  +  K+G
Sbjct: 1793 EAMKTEMLVPTLHDGKVLKIVHKNG 1817

>Kwal_27.11951
          Length = 1869

 Score =  263 bits (673), Expect = 9e-72,   Method: Compositional matrix adjust.
 Identities = 162/459 (35%), Positives = 250/459 (54%), Gaps = 14/459 (3%)

Query: 23   ILVANRGEIPIRIFRSAHELSMRTIAIYSHEDRLSMHRLKADEAYVIGEEGQYTPVGAYL 82
            +LVANRGEI +RI ++  +L ++++A+YS  D+ S H   AD A  +  +G+ T    YL
Sbjct: 668  VLVANRGEIAVRIIKTLKKLKIKSVAVYSDPDKYSQHVTDADVAVAL--KGR-TAAETYL 724

Query: 83   AMDEIIEIAKKHKVDFIHPGYGFLSENSEFADKVVKAGITWIGPPAEVIDSVGDKVSARH 142
             +D+II  AK+   + I PGYGFLSEN++F+D+    GI ++GP  + I  +G K SAR 
Sbjct: 725  DIDKIIAAAKETGTEAIIPGYGFLSENADFSDRCASEGIVFVGPAGDAIRKLGLKHSARE 784

Query: 143  LAARANVPTVPGTPGPIETVQEALDFVNEYGYPVIIKAAFXXXXXXXXXXXXXXXXADAF 202
            +A +A VP VPG+ G ++T QEA +      YPV++K+                     F
Sbjct: 785  IAEKAGVPLVPGS-GLVKTPQEAREIAKALEYPVMVKSTAGGGGIGLQKVDSEEDIERVF 843

Query: 203  QRATSEARTAFGNGTCFVERFLDKPKHIEVQLLADNHGNVVHLFERDCSVQRRHQKVVEV 262
            +    + +  FG+   F+ERF++  +H+E+Q++ D  G  + + ERDCS+QRR+QKV+E 
Sbjct: 844  ETVQHQGKAYFGDSGVFLERFVENARHVEIQMMGDGKGKAIAIGERDCSLQRRNQKVIEE 903

Query: 263  APAKTLPREVRDAILTDAVKLAKVCGYRNAGTAEFLVDN-QNRHYFIEINPRIQVEHTIT 321
             PA  L  + R  +   +  L  +  YR AGT EF+ D  ++  YF+E+N R+QVEH IT
Sbjct: 904  TPAPNLSEKTRARMREASENLGSLLKYRCAGTVEFIYDERRDEFYFLEVNARLQVEHPIT 963

Query: 322  EEITGIDIVSAQIQIXXXXXXXXXXXXXDKITTRGFSIQCRITTEDPSKNFQPDTGRLEV 381
            E +TG+D+V   + I              KIT  G SI+ R+  E+P K+F+P  G+L  
Sbjct: 964  EMVTGLDLVEWMLLIAAGTPPDFDAT---KITVTGASIEARLYAENPVKDFRPSPGQLT- 1019

Query: 382  YRSAGGNGVRLDGGNAYAGATISPHYDSMLVKCSCSGSTYEIVRRKMIRALIEFRIRGVK 441
               +     R+D   +  G TIS  YD  L K    G   +   +K+ +AL E  I G  
Sbjct: 1020 -DVSFPEWARVDTWVS-KGTTISAEYDPTLAKIIVHGKDRDEAIQKLNQALNETSIYGCI 1077

Query: 442  TNIPFLLTLLTNPVFIEGTYWTTFIDD---TPQLFQMVS 477
            TNI +L ++ ++ +F      T  +D     P  F++ S
Sbjct: 1078 TNIDYLRSIASSEMFKTAKVATKVLDSYDYRPSAFEITS 1116

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/104 (32%), Positives = 51/104 (49%), Gaps = 12/104 (11%)

Query: 1060 NKKTGQREVYF-----ELNGELRKIRVADKSQNIQSVAKPKADVHDTHQIGAPMAGVIIE 1114
            NK+ G++   F     E N EL K   A  SQ       P+    D   + +  +G   +
Sbjct: 1761 NKQNGEKAEEFAKLIQESNAELEK---APDSQGAVEEEFPE----DAEMVYSEYSGRFWK 1813

Query: 1115 VKVHKGSLVKKGESIAVLSAMKMEMVVSSPADGQVKDVFIKDGE 1158
              V  G +VK G+ + V+ AMK EM+VS+P  G+V  V  K+G+
Sbjct: 1814 PLVSVGDVVKAGDGLIVVEAMKTEMMVSAPKGGKVLKVVHKNGD 1857

>CAGL0L10780g complement(1149588..1156289) highly similar to
           sp|Q00955 Saccharomyces cerevisiae YNR016c ACC1 or
           sp|P32874 Saccharomyces cerevisiae YMR207c HFA1, start
           by similarity
          Length = 2233

 Score =  208 bits (530), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 156/534 (29%), Positives = 249/534 (46%), Gaps = 89/534 (16%)

Query: 21  NKILVANRGEIPIRIFRSAHELSMRT---------IAIYSHEDRLSMHRLKADEAYV-IG 70
           +K+L+AN G   ++  RS  + +  T         +A+ + ED      L+A+  Y+ + 
Sbjct: 60  SKVLIANNGIAAVKEIRSVRKWAYETFGDEKIVQFVAMATPED------LEANAEYIRMA 113

Query: 71  EEGQYTPVGA----YLAMDEIIEIAKKHKVDFIHPGYGFLSENSEFADKVVKAG--ITWI 124
           ++    P G     Y  +D I++IA++  VD +  G+G  SEN    +K+ ++   I +I
Sbjct: 114 DQYVEVPGGTNNNNYANVDLIVDIAERADVDAVWAGWGHASENPLLPEKLARSKRKILFI 173

Query: 125 GPPAEVIDSVGDKVSARHLAARANVPTVPGTPGPIETV---------------------- 162
           GPP   + S+GDK+S+  +A  A VP +P +   ++TV                      
Sbjct: 174 GPPGNAMRSLGDKISSTIVAQHAKVPCIPWSGTGVDTVHIDEKNGLVSVDDDIYQKGCCS 233

Query: 163 --QEALDFVNEYGYPVIIKAAFXXXXXXXXXXXXXXXXADAFQRATSEARTAFGNGTCFV 220
             ++ L+   + G+PV+IKA+                  + + +A +E          F+
Sbjct: 234 SPEDGLEKAKKIGFPVMIKASEGGGGKGIRQVTREEDFINLYHQAANE----IPGSPIFI 289

Query: 221 ERFLDKPKHIEVQLLADNHGNVVHLFERDCSVQRRHQKVVEVAPAKTLPREVRDAILTDA 280
            +   K +H+EVQLLAD +G  + LF RDCSVQRRHQK++E AP      E    +   A
Sbjct: 290 MKLAGKARHLEVQLLADQYGTNISLFGRDCSVQRRHQKIIEEAPVTIAGPETFGEMEKAA 349

Query: 281 VKLAKVCGYRNAGTAEFLVD-NQNRHYFIEINPRIQVEHTITEEITGIDIVSAQIQIXX- 338
           V+L K+ GY +AGT E+L   + N+ YF+E+NPR+QVEH  TE +TG+++ +AQ+QI   
Sbjct: 350 VRLGKLVGYVSAGTVEYLYSHDDNKFYFLELNPRLQVEHPTTEMVTGVNLPAAQLQIAMG 409

Query: 339 -------------------XXXXXXXXXXXDKITT------RGFSIQCRITTEDPSKNFQ 373
                                         D + T      +G    CRIT+EDP+  F+
Sbjct: 410 IPMHRISDIRIFYGLNPRGSSEIDFEFKSEDSLKTQRKPIPKGHCTACRITSEDPNDGFK 469

Query: 374 PDTGRLEV--YRSAGGNGVRLDGGNAYAGATISPHYDSMLVKCSCSGSTYEIVRRKMIRA 431
           P  G L    +RS+         GN      I    DS        G   +  R+ M+ A
Sbjct: 470 PSGGTLNELNFRSSSNVWGYFSVGN---NGGIHSFSDSQFGHIFAFGENRQASRKHMVVA 526

Query: 432 LIEFRIRG-VKTNIPFLLTLLTNPVFIEGTYWTTFIDDTPQLFQMVSSQNRAQK 484
           L E  IRG  +T + +L+ LL    F E T  T ++DD      ++S++  A+K
Sbjct: 527 LKELSIRGDFRTTVEYLIKLLETEDFEENTITTGWLDD------LISTKMTAKK 574

>Scas_720.74
          Length = 2231

 Score =  207 bits (527), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 152/518 (29%), Positives = 240/518 (46%), Gaps = 83/518 (16%)

Query: 21  NKILVANRGEIPIRIFRS---------AHELSMRTIAIYSHEDRLSMHRLKADEAYV-IG 70
           +KIL+AN G   ++  RS          +E +++ +A+ + ED      L+A+  Y+ + 
Sbjct: 60  SKILIANNGIAAVKEIRSVRKWAYETFGNERTIQFVAMATPED------LEANAEYIRMA 113

Query: 71  EEGQYTPVGA----YLAMDEIIEIAKKHKVDFIHPGYGFLSENSEFADKVV--KAGITWI 124
           ++    P G     Y  +D I++IA++  VD +  G+G  SEN    +K+   K  + +I
Sbjct: 114 DQYVEVPGGTNNKNYANVDLIVDIAERADVDAVWAGWGHASENPHLPEKLAMSKRKVVFI 173

Query: 125 GPPAEVIDSVGDKVSARHLAARANVPTVPGTPGPIETVQ--------------------- 163
           GPP   + S+GDK+S+  +A  A+VP +P +   I+ VQ                     
Sbjct: 174 GPPGSAMRSLGDKISSTIVAQSAHVPCIPWSGTGIDKVQVDKDTGLVSVADEVYAQGCCS 233

Query: 164 ---EALDFVNEYGYPVIIKAAFXXXXXXXXXXXXXXXXADAFQRATSEARTAFGNGTCFV 220
              + L+   + G+PV+IKA+                    + +A +E          F+
Sbjct: 234 SPEDGLEKAKKIGFPVMIKASEGGGGKGIRQVEREEDFIALYHQAANE----IPGSPIFI 289

Query: 221 ERFLDKPKHIEVQLLADNHGNVVHLFERDCSVQRRHQKVVEVAPAKTLPREVRDAILTDA 280
            +   K +H+EVQLLAD +GN + LF RDCSVQRRHQK++E AP      E    +   A
Sbjct: 290 MKLAGKARHLEVQLLADQYGNNISLFGRDCSVQRRHQKIIEEAPVTIAAPETFAMMEKSA 349

Query: 281 VKLAKVCGYRNAGTAEFLVDNQNRH-YFIEINPRIQVEHTITEEITGIDIVSAQIQIXXX 339
           V+L K+ GY +AGT E+L  ++++  YF+E+NPR+QVEH  TE +TG+++ + Q+QI   
Sbjct: 350 VRLGKLVGYVSAGTVEYLYSHEDKKFYFLELNPRLQVEHPTTEMVTGVNLPATQLQIAMG 409

Query: 340 X--------------------------XXXXXXXXXDKITTRGFSIQCRITTEDPSKNFQ 373
                                                K   +G    CRIT+EDP + F+
Sbjct: 410 IPMHRISDIRVFYGMNPHTASEIDFDFSTEESLKTQRKPVPKGHCTACRITSEDPDEGFK 469

Query: 374 PDTGRLEV--YRSAGGNGVRLDGGNAYAGATISPHYDSMLVKCSCSGSTYEIVRRKMIRA 431
           P  G L    +RS+         GN      I    DS        G   +  R+ M+ A
Sbjct: 470 PSGGSLHELNFRSSSNVWGYFSVGN---NGGIHSFSDSQFGHIFAFGENRQASRKHMVVA 526

Query: 432 LIEFRIRG-VKTNIPFLLTLLTNPVFIEGTYWTTFIDD 468
           L E  IRG  +T + +L+ LL    F + T  T ++DD
Sbjct: 527 LKELSIRGDFRTTVEYLIKLLETEDFEDNTITTGWLDD 564

>KLLA0F06072g 583276..589971 highly similar to sp|Q00955
           Saccharomyces cerevisiae YNR016c ACC1 acetyl-CoA
           carboxylase, start by similarity
          Length = 2231

 Score =  206 bits (523), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 156/561 (27%), Positives = 257/561 (45%), Gaps = 91/561 (16%)

Query: 21  NKILVANRGEIPIRIFRSAHELSMRT---------IAIYSHEDRLSMHRLKADEAYV-IG 70
           +K+L+AN G   ++  RS  + +  T         +A+ + ED      L+A+  Y+ + 
Sbjct: 61  SKVLIANNGIAAVKEIRSVRKWAYETFGDERTVQFVAMATPED------LEANAEYIRMA 114

Query: 71  EEGQYTPVGA----YLAMDEIIEIAKKHKVDFIHPGYGFLSENSEFADKVVKA--GITWI 124
           ++    P G     Y  +D I+E+A++  VD +  G+G  SEN    +++  +   I +I
Sbjct: 115 DQYIEVPGGTNNNNYANVDLIVEVAERADVDAVWAGWGHASENPLLPERLAASHRKIIFI 174

Query: 125 GPPAEVIDSVGDKVSARHLAARANVPTVPGTPGPIETV---------------------- 162
           GPP   + S+GDK+S+  +A  A VP +P +   ++ V                      
Sbjct: 175 GPPGNAMRSLGDKISSTIVAQHAKVPCIPWSGTGVDEVHVDKETNLVSVEDKVYQEGCCS 234

Query: 163 --QEALDFVNEYGYPVIIKAAFXXXXXXXXXXXXXXXXADAFQRATSEARTAFGNGTCFV 220
             ++ L    E G+P+++KA+                    +Q+A +E          F+
Sbjct: 235 SPEDGLKKAKEIGFPIMVKASEGGGGKGIRKVENEDEFLSLYQQAANE----IPGSPIFI 290

Query: 221 ERFLDKPKHIEVQLLADNHGNVVHLFERDCSVQRRHQKVVEVAPAKTLPREVRDAILTDA 280
            +   K +H+EVQLLAD +G  + LF RDCSVQRRHQK++E AP      +    +   A
Sbjct: 291 MKLAGKARHLEVQLLADQYGTNISLFGRDCSVQRRHQKIIEEAPVTIAKPDTFTEMEKAA 350

Query: 281 VKLAKVCGYRNAGTAEFLVD-NQNRHYFIEINPRIQVEHTITEEITGIDIVSAQIQIXX- 338
           V+L ++ GY +AGT E+L   ++++ YF+E+NPR+QVEH  TE +TG+++ SAQ+QI   
Sbjct: 351 VRLGQLVGYVSAGTVEYLYSHDEDKFYFLELNPRLQVEHPTTEMVTGVNLPSAQLQIAMG 410

Query: 339 -------------------------XXXXXXXXXXXDKITTRGFSIQCRITTEDPSKNFQ 373
                                                K T +G    CRIT+EDP++ F+
Sbjct: 411 IPMHRIRDIRLLYGVDPKSASEIDFNFSTPESAKTQRKPTPKGHCTACRITSEDPNEGFK 470

Query: 374 PDTGRLEV--YRSAGGNGVRLDGGNAYAGATISPHYDSMLVKCSCSGSTYEIVRRKMIRA 431
           P  G L    +RS+         GN      I    DS        G   +  R+ M+ A
Sbjct: 471 PSGGALHELNFRSSSNVWGYFSVGN---NGGIHSFSDSQFGHIFAFGENRQASRKHMVVA 527

Query: 432 LIEFRIRG-VKTNIPFLLTLLTNPVFIEGTYWTTFIDDTPQLFQMVSSQNRAQKLLHYLA 490
           L E  IRG  +T + +L+ LL    F + T  T ++DD      ++S +  A+K    L+
Sbjct: 528 LKELSIRGDFRTTVEYLIKLLETEDFEDNTITTGWLDD------LISQKMTAEKPDRTLS 581

Query: 491 DLAVNGSSIKGQIGLPKLKSN 511
              + G++ K  I   K + +
Sbjct: 582 --VICGAATKAHIASQKARED 600

>AAR071W [257] [Homologous to ScYNR016C (ACC1) - SH; ScYMR207C
           (HFA1) - SH] complement(466791..473486) [6696 bp, 2231
           aa]
          Length = 2231

 Score =  203 bits (516), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 160/568 (28%), Positives = 261/568 (45%), Gaps = 94/568 (16%)

Query: 10  LRDNFSLLGEK---NKILVANRGEIPIRIFRSAHELSMRT---------IAIYSHEDRLS 57
           LRD   L G     +KIL+AN G   ++  RS  + +  T         + + + ED   
Sbjct: 46  LRDYVRLHGGHTVISKILIANNGIAAVKEIRSVRKWAYETFGDGKVVQFVVMATPED--- 102

Query: 58  MHRLKADEAYV-IGEEGQYTPVGA----YLAMDEIIEIAKKHKVDFIHPGYGFLSENSEF 112
              L+A+  Y+ + ++    P G     Y  +D I+++A++  VD +  G+G  SEN   
Sbjct: 103 ---LEANTEYIRMADQYVEVPGGTNNNNYANVDLIVDVAERADVDAVWAGWGHASENPLL 159

Query: 113 ADKVVKAG--ITWIGPPAEVIDSVGDKVSARHLAARANVPTVPGTPGPIETVQ------- 163
            +K+ ++   + +IGPP   + S+GDK+S+  +A  A VP +P +   ++ V+       
Sbjct: 160 PEKLARSKRKVVFIGPPGSAMRSLGDKISSTIVAQHAKVPCIPWSGTGVDQVEIDPHTKL 219

Query: 164 -----------------EALDFVNEYGYPVIIKAAFXXXXXXXXXXXXXXXXADAFQRAT 206
                            + L+   + G+PV++KA+                    +Q+A 
Sbjct: 220 VSVADDIYQKGCCLSPEDGLNKAKQIGFPVMVKASEGGGGKGIRKVVREEDFISLYQQAA 279

Query: 207 SEARTAFGNGTCFVERFLDKPKHIEVQLLADNHGNVVHLFERDCSVQRRHQKVVEVAPAK 266
           +E          F+ +   K +H+EVQLLAD +G  + LF RDCSVQRRHQK++E AP  
Sbjct: 280 NE----IPGSPIFIMKLAGKARHLEVQLLADQYGTNISLFGRDCSVQRRHQKIIEEAPVT 335

Query: 267 TLPREVRDAILTDAVKLAKVCGYRNAGTAEFLVDN-QNRHYFIEINPRIQVEHTITEEIT 325
               +    +   AV+L K+ GY +AGT E+L  + +++ YF+E+NPR+QVEH  TE +T
Sbjct: 336 IAKPDTFAEMERAAVRLGKLVGYVSAGTVEYLYSHEEDKFYFLELNPRLQVEHPTTEMVT 395

Query: 326 GIDIVSAQIQIX--------------------XXXXXXXXXXXXDKITT------RGFSI 359
           G+++ +AQ+QI                                 D + T      +G   
Sbjct: 396 GVNLPAAQLQIAMGIPLHRIRDIRLFYGLDPHTATEIDFEFSSADALQTQRRPIPKGHCT 455

Query: 360 QCRITTEDPSKNFQPDTGRLEV--YRSAGGNGVRLDGGNAYAGATISPHYDSMLVKCSCS 417
            CRIT+EDP++ F+P  G L    +RS+         GN      I    DS        
Sbjct: 456 ACRITSEDPNEGFKPSGGSLHELNFRSSSNVWGYFSVGN---NGGIHSFSDSQFGHIFAF 512

Query: 418 GSTYEIVRRKMIRALIEFRIRG-VKTNIPFLLTLLTNPVFIEGTYWTTFIDDTPQLFQMV 476
           G   +  R+ M+ AL E  IRG  +T + +L+ LL    F + T  T ++DD      ++
Sbjct: 513 GENRQASRKHMVVALKELSIRGDFRTTVEYLIKLLETEDFEDNTITTGWLDD------LI 566

Query: 477 SSQNRAQKLLHYLADLAVNGSSIKGQIG 504
           S +  A+K    LA   + G++ K  I 
Sbjct: 567 SQKISAEKPDPMLA--VICGATTKAHIA 592

>YNR016C (ACC1) [4599] chr14 complement(654672..661373) Acetyl-CoA
           carboxylase, first and rate-limiting step in fatty acid
           biosynthesis pathway [6702 bp, 2233 aa]
          Length = 2233

 Score =  198 bits (504), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 148/518 (28%), Positives = 235/518 (45%), Gaps = 83/518 (16%)

Query: 21  NKILVANRGEIPIRIFRSAHELSMRT---------IAIYSHEDRLSMHRLKADEAYV-IG 70
           +KIL+AN G   ++  RS  + +  T         +A+ + ED      L+A+  Y+ + 
Sbjct: 60  SKILIANNGIAAVKEIRSVRKWAYETFGDDRTVQFVAMATPED------LEANAEYIRMA 113

Query: 71  EEGQYTPVGA----YLAMDEIIEIAKKHKVDFIHPGYGFLSENSEFADKVV--KAGITWI 124
           ++    P G     Y  +D I++IA++  VD +  G+G  SEN    +K+   K  + +I
Sbjct: 114 DQYIEVPGGTNNNNYANVDLIVDIAERADVDAVWAGWGHASENPLLPEKLSQSKRKVIFI 173

Query: 125 GPPAEVIDSVGDKVSARHLAARANVPTVPGTPGPIETV---------------------- 162
           GPP   + S+GDK+S+  +A  A VP +P +   ++TV                      
Sbjct: 174 GPPGNAMRSLGDKISSTIVAQSAKVPCIPWSGTGVDTVHVDEKTGLVSVDDDIYQKGCCT 233

Query: 163 --QEALDFVNEYGYPVIIKAAFXXXXXXXXXXXXXXXXADAFQRATSEARTAFGNGTCFV 220
             ++ L      G+PV+IKA+                    + +A +E          F+
Sbjct: 234 SPEDGLQKAKRIGFPVMIKASEGGGGKGIRQVEREEDFIALYHQAANE----IPGSPIFI 289

Query: 221 ERFLDKPKHIEVQLLADNHGNVVHLFERDCSVQRRHQKVVEVAPAKTLPREVRDAILTDA 280
            +   + +H+EVQLLAD +G  + LF RDCSVQRRHQK++E AP      E    +   A
Sbjct: 290 MKLAGRARHLEVQLLADQYGTNISLFGRDCSVQRRHQKIIEEAPVTIAKAETFHEMEKAA 349

Query: 281 VKLAKVCGYRNAGTAEFLVDNQN-RHYFIEINPRIQVEHTITEEITGIDIVSAQIQIXX- 338
           V+L K+ GY +AGT E+L  + + + YF+E+NPR+QVEH  TE ++G+++ +AQ+QI   
Sbjct: 350 VRLGKLVGYVSAGTVEYLYSHDDGKFYFLELNPRLQVEHPTTEMVSGVNLPAAQLQIAMG 409

Query: 339 -------------------------XXXXXXXXXXXDKITTRGFSIQCRITTEDPSKNFQ 373
                                                +   +G    CRIT+EDP+  F+
Sbjct: 410 IPMHRISDIRTLYGMNPHSASEIDFEFKTQDATKKQRRPIPKGHCTACRITSEDPNDGFK 469

Query: 374 PDTGRLEV--YRSAGGNGVRLDGGNAYAGATISPHYDSMLVKCSCSGSTYEIVRRKMIRA 431
           P  G L    +RS+         GN      I    DS        G   +  R+ M+ A
Sbjct: 470 PSGGTLHELNFRSSSNVWGYFSVGN---NGNIHSFSDSQFGHIFAFGENRQASRKHMVVA 526

Query: 432 LIEFRIRG-VKTNIPFLLTLLTNPVFIEGTYWTTFIDD 468
           L E  IRG  +T + +L+ LL    F + T  T ++DD
Sbjct: 527 LKELSIRGDFRTTVEYLIKLLETEDFEDNTITTGWLDD 564

 Score = 31.6 bits (70), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 28/52 (53%)

Query: 1099 HDTHQIGAPMAGVIIEVKVHKGSLVKKGESIAVLSAMKMEMVVSSPADGQVK 1150
            +D  Q+  P  G +++  V  G  + KG+  A +  MKM+M + S  +G V+
Sbjct: 698  NDPTQLRTPSPGKLVKFLVENGEHIIKGQPYAEIEVMKMQMPLVSQENGIVQ 749

>Kwal_23.6157
          Length = 2230

 Score =  191 bits (484), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 149/538 (27%), Positives = 248/538 (46%), Gaps = 97/538 (18%)

Query: 21  NKILVANRGEIPIRIFRS---------AHELSMRTIAIYSHEDRLSMHRLKADEAYV-IG 70
           +K+L+AN G   ++  RS          +E +++ +A+ + ED      L+A+  Y+ + 
Sbjct: 61  SKVLIANNGIAAVKEIRSVRKWAYETFGNERAVQFVAMATPED------LEANAEYLRMA 114

Query: 71  EEGQYTPVGA----YLAMDEIIEIAKKHKVDFIHPGYGFLSENSEFADKVVKA--GITWI 124
           ++    P G     Y  +D I+E+A++  VD +  G+G  SEN    +++  +   + +I
Sbjct: 115 DQYVEVPGGTNNNNYANVDLIVELAERADVDAVWAGWGHASENPLLPERLAASPRKVIFI 174

Query: 125 GPPAEVIDSVGDKVSARHLAARANVPTVP--GT----------------------PGPIE 160
           GPP   + S+GDK+S+  +A  A VP +P  GT                       G  +
Sbjct: 175 GPPGNAMRSLGDKISSTIVAQHAKVPCIPWSGTGVDQVHLDEENGLVSVTDDIYQKGCCD 234

Query: 161 TVQEALDFVNEYGYPVIIKAAFXXXXXXXXXXXXXXXXADAFQRATSEARTAFGNGTCFV 220
           + ++ L    + G+PV++KA+                    +++A +E          F+
Sbjct: 235 SPEDGLAKAKKIGFPVMVKASEGGGGKGIRKVEREQDFIPLYKQAANE----IPGSPIFI 290

Query: 221 ERFLDKPKHIEVQLLADNHGNVVHLFERDCSVQRRHQKVVEVAPAKTLPREVRDAILTDA 280
            +     +H+EVQLLAD +G  + LF RDCSVQRRHQK++E AP      +    +   A
Sbjct: 291 MKLAGNARHLEVQLLADQYGTNISLFGRDCSVQRRHQKIIEEAPVTIAKPDTFTEMERSA 350

Query: 281 VKLAKVCGYRNAGTAEFLVD-NQNRHYFIEINPRIQVEHTITEEITGIDIVSAQIQIXXX 339
           V+L K+ GY +AGT E+L   + ++ YF+E+NPR+QVEH  TE ++G+++ +AQ+QI   
Sbjct: 351 VRLGKLVGYVSAGTVEYLYSHDDDKFYFLELNPRLQVEHPTTEMVSGVNLPAAQLQIAMG 410

Query: 340 X--------------------------XXXXXXXXXDKITTRGFSIQCRITTEDPSKNFQ 373
                                                + T +G    CRIT+EDP++ F+
Sbjct: 411 IPMHRIKDIRLMYGVDPHTATEIDFDFSSKDSTKIQRRPTPKGHCTACRITSEDPNEGFK 470

Query: 374 PDTGRLEV--YRSA----GGNGVRLDGGNAYAGATISPHYDSMLVKCSCSGSTYEIVRRK 427
           P  G L    +RS+    G   V   GG       I    DS        G   +  R+ 
Sbjct: 471 PSGGSLHELNFRSSSNVWGYFSVSSSGG-------IHSFSDSQFGHIFAFGENRQASRKH 523

Query: 428 MIRALIEFRIRG-VKTNIPFLLTLLTNPVFIEGTYWTTFIDDTPQLFQMVSSQNRAQK 484
           M+ AL E  IRG  +T + +L+ LL    F   +  T ++DD      ++S +  A+K
Sbjct: 524 MVVALKELSIRGDFRTTVEYLIKLLETEDFEGNSITTGWLDD------LISQKMTAEK 575

>YMR207C (HFA1) [4163] chr13 complement(677192..683563) Protein with
           similarity to acetyl-CoA carboxylase [6372 bp, 2123 aa]
          Length = 2123

 Score =  189 bits (481), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 129/436 (29%), Positives = 210/436 (48%), Gaps = 55/436 (12%)

Query: 81  YLAMDEIIEIAKKHKVDFIHPGYGFLSENSEFADKVVKA--GITWIGPPAEVIDSVGDKV 138
           Y  +D I+++A++  VD +  G+G  SEN    + +  +   I +IGPP   + S+GDK+
Sbjct: 54  YANIDLILDVAEQTDVDAVWAGWGHASENPCLPELLASSQRKILFIGPPGRAMRSLGDKI 113

Query: 139 SARHLAARANVPTVPGTPGPIETV------------------------QEALDFVNEYGY 174
           S+  +A  A +P +P +   I+T+                        ++AL+     G+
Sbjct: 114 SSTIVAQSAKIPCIPWSGSHIDTIHIDNKTNFVSVPDDVYVRGCCSSPEDALEKAKLIGF 173

Query: 175 PVIIKAAFXXXXXXXXXXXXXXXXADAFQRATSEARTAFGNGTCFVERFLDKPKHIEVQL 234
           PV+IKA+                    +++A +E          FV + +   +H+EVQL
Sbjct: 174 PVMIKASEGGGGKGIRRVDNEDDFIALYRQAVNET----PGSPMFVMKVVTDARHLEVQL 229

Query: 235 LADNHGNVVHLFERDCSVQRRHQKVVEVAPAKTLPREVRDAILTDAVKLAKVCGYRNAGT 294
           LAD +G  + LF RDCS+QRRHQK++E AP      E    +   A++L ++ GY +AGT
Sbjct: 230 LADQYGTNITLFGRDCSIQRRHQKIIEEAPVTITKPETFQRMERAAIRLGELVGYVSAGT 289

Query: 295 AEFLVD-NQNRHYFIEINPRIQVEHTITEEITGIDIVSAQIQIXX--------------- 338
            E+L     ++ YF+E+NPR+QVEH  TE I+G+++ + Q+QI                 
Sbjct: 290 VEYLYSPKDDKFYFLELNPRLQVEHPTTEMISGVNLPATQLQIAMGIPMHMISDIRKLYG 349

Query: 339 ---XXXXXXXXXXXDKITTRGFSIQCRITTEDPSKNFQPDTGRLEV--YRSAGGNGVRLD 393
                          + + +G  I CRIT+EDP++ F+P TG++    +RS+        
Sbjct: 350 LDPTGTSYIDFKNLKRPSPKGHCISCRITSEDPNEGFKPSTGKIHELNFRSSSNVWGYFS 409

Query: 394 GGNAYAGATISPHYDSMLVKCSCSGSTYEIVRRKMIRALIEFRIRG-VKTNIPFLLTLLT 452
            GN  A  + S   DS        G+  +  ++ M+ AL +F IRG  KT I +L+ LL 
Sbjct: 410 VGNNGAIHSFS---DSQFGHIFAVGNDRQDAKQNMVLALKDFSIRGEFKTPIEYLIELLE 466

Query: 453 NPVFIEGTYWTTFIDD 468
              F      T ++DD
Sbjct: 467 TRDFESNNISTGWLDD 482

>Sklu_2331.1 YJL130C, Contig c2331 2029-8691
          Length = 2220

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 70/330 (21%), Positives = 127/330 (38%), Gaps = 46/330 (13%)

Query: 19  EKNKILVANRGEIPI-----------RIFRSAHELSMRTIAIYSHEDRLSMHRLKADEAY 67
           E  K+LV   G + I           +  ++  E  + TI I  +   +   +  AD+ Y
Sbjct: 437 EAKKVLVLGSGGLSIGQAGEFDYSGSQAIKALKEEGIYTILINPNIATIQTSKGLADKVY 496

Query: 68  VIGEEGQYTPVGAYLAMDEIIEIAKKHKVDFIHPGYG---FLSENSEFADKVVKAGITWI 124
                  + PV A      I+      + D I+  +G    LS   E  D+    G+  +
Sbjct: 497 -------FLPVTAEFVRKVILH----ERPDAIYVTFGGQTALSVGIEMKDEFETLGVKVL 545

Query: 125 GPPAEVIDSVGDKVSARHLAARANVPTVPGTPGPIETVQEALDFVNEYGYPVIIKAAFXX 184
           G P + + +  D+    +     N            TV+EAL+ V E G+PVI++AA+  
Sbjct: 546 GTPIDTVITTEDRELFSNAMDEINEKCAKSKAA--STVKEALEAVKEIGFPVIVRAAYAL 603

Query: 185 XXXXXXXXXXXXXXADAFQRATSEARTAFGNG-TCFVERFLDKPKHIEVQLLADNHGNVV 243
                          D           AF +     VER +   K +E +++ D   N +
Sbjct: 604 GGLGSGFASNETELVDL-------CNVAFASSPQVLVERSMKGWKEVEYEVVRDAFDNCI 656

Query: 244 HLFERDCSVQR------RHQKVVEVAPAKTLPREVRDAILTDAVKLAKVCGYRNAGTAEF 297
            +    C+++            + VAP++TL  E  + + T AV + +  G       ++
Sbjct: 657 TV----CNMENFDPLGIHTGDSIVVAPSQTLSDEDYNMLRTTAVNVIRHLGVVGECNIQY 712

Query: 298 LVDNQNRHY-FIEINPRIQVEHTITEEITG 326
            ++  ++ Y  IE+N R+     +  + TG
Sbjct: 713 ALNPFSKEYCIIEVNARLSRSSALASKATG 742

 Score = 36.2 bits (82), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 31/173 (17%), Positives = 65/173 (37%), Gaps = 6/173 (3%)

Query: 159  IETVQEALDFVNEYGYPVIIKAAFXXXXXXXXXXXXXXXXADAFQRATSEARTAFGNGTC 218
            + ++ EA  F    GYPV+++ ++                A    +A   +R    +   
Sbjct: 1115 LTSIDEAEGFAENVGYPVLVRPSYVLSGAAMNTVYSKDDLASYLNQAVEVSR----DYPV 1170

Query: 219  FVERFLDKPKHIEVQLLADNHGNVVHLFERDCSVQRRHQ-KVVEVAPAKTLPREVRDAIL 277
             + ++++  K IE+  +A +   V+H+          H      + P + L  E  + I+
Sbjct: 1171 VITKYIENAKEIEMDAVAKDGELVMHVVSEHVENAGVHSGDATLIVPPQDLDPETVNRIV 1230

Query: 278  TDAVKLAKVCGYRNAGTAEFLVDNQNRHYFIEINPRIQVEHTITEEITGIDIV 330
                K+ K          +F+  N N    IE N R         ++ G++++
Sbjct: 1231 VATAKIGKALKITGPYNIQFIAKN-NDIKVIECNVRASRSFPFISKVVGVNLI 1282

>ABR157W [750] [Homologous to ScYJR109C (CPA2) - SH]
           complement(695747..699088) [3342 bp, 1113 aa]
          Length = 1113

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 51/220 (23%), Positives = 94/220 (42%), Gaps = 27/220 (12%)

Query: 118 KAGITWIGPPAEVIDSVGDKVSARHLAARA----NVPTVPGTPGPIETVQEALDFVNEYG 173
           K G+T +G P  V+++  D    R L ARA    N+P          TV++A+   N+ G
Sbjct: 131 KYGVTVLGTPISVLETTED----RELFARALKEINMPIAESVA--CSTVEDAVAAANDIG 184

Query: 174 YPVIIKAAFXXXXXXXXXXXXXXXXADAFQRATSEARTAFGNGTCFVERFLDKPKHIEVQ 233
           YPVI+++A+                 D  Q     A++   +    VE+ L   K IE +
Sbjct: 185 YPVIVRSAYALGGLGSGFAD------DDLQLRQLCAQSLALSPQVLVEKSLKGWKEIEYE 238

Query: 234 LLADNHGNVVHLFERDCSVQR------RHQKVVEVAPAKTLPREVRDAILTDAVKLAKVC 287
           ++ D  GN + +    C+++            + +AP++TL  E    + T A+++ +  
Sbjct: 239 VVRDRVGNCITV----CNMENFDPLGIHTGDSIVLAPSQTLSDEEFHMLRTAAIEIIRHL 294

Query: 288 GYRNAGTAEFLVDNQNRHY-FIEINPRIQVEHTITEEITG 326
           G       ++ +      +  IE+N R+     +  + TG
Sbjct: 295 GVVGECNVQYALQPDGLAFKVIEVNARLSRSSALASKATG 334

>Kwal_33.14061
          Length = 2221

 Score = 47.8 bits (112), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 70/330 (21%), Positives = 126/330 (38%), Gaps = 46/330 (13%)

Query: 19  EKNKILVANRGEIPI-----------RIFRSAHELSMRTIAIYSHEDRLSMHRLKADEAY 67
           E  K+LV   G + I           +  ++  E  + TI I  +   +   +  AD+ Y
Sbjct: 437 EAKKVLVLGSGGLSIGQAGEFDYSGSQAIKALKEEGIYTILINPNIATIQTSKGLADKVY 496

Query: 68  VIGEEGQYTPVGAYLAMDEIIEIAKKHKVDFIHPGYG---FLSENSEFADKVVKAGITWI 124
                  + PV A      I+      + D I+  +G    LS   E  D+    G+  +
Sbjct: 497 -------FLPVNAEFVRKVILH----ERPDAIYVTFGGQTALSVGIEMKDEFEALGVKVL 545

Query: 125 GPPAEVIDSVGDKVSARHLAARANVPTVPGTPGPIETVQEALDFVNEYGYPVIIKAAFXX 184
           G P + + +  D+    +     N            TV+EAL+ V E G+PVI +AA+  
Sbjct: 546 GTPIDTVITTEDRELFSNAMDEINEKCAKSKAAA--TVEEALEAVKEIGFPVICRAAYAL 603

Query: 185 XXXXXXXXXXXXXXADAFQRATSEARTAFGNG-TCFVERFLDKPKHIEVQLLADNHGNVV 243
                          D           AF +     VER +   K +E +++ D   N +
Sbjct: 604 GGLGSGFANNEKELVDL-------CNIAFASSPQVLVERSMKGWKEVEYEVVRDAFDNCI 656

Query: 244 HLFERDCSVQR------RHQKVVEVAPAKTLPREVRDAILTDAVKLAKVCGYRNAGTAEF 297
            +    C+++            + VAP++TL  E  + + T AV + +  G       ++
Sbjct: 657 TV----CNMENFDPLGIHTGDSIVVAPSQTLSDEDYNMLRTTAVNVIRHLGVVGECNIQY 712

Query: 298 LVDNQNRHY-FIEINPRIQVEHTITEEITG 326
            ++  ++ Y  IE+N R+     +  + TG
Sbjct: 713 ALNPFSKEYCIIEVNARLSRSSALASKATG 742

 Score = 31.6 bits (70), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 28/173 (16%), Positives = 65/173 (37%), Gaps = 6/173 (3%)

Query: 159  IETVQEALDFVNEYGYPVIIKAAFXXXXXXXXXXXXXXXXADAFQRATSEARTAFGNGTC 218
            + +++EA  F +   +PV+++ ++                A    +A   +R    +   
Sbjct: 1115 LTSIEEAEQFADAVSFPVLVRPSYVLSGAAMNTVYSKDDLASYLNQAVEVSR----DYPV 1170

Query: 219  FVERFLDKPKHIEVQLLADNHGNVVHLFERDCSVQRRHQ-KVVEVAPAKTLPREVRDAIL 277
             + ++++  K IE+  +A +   V+H+          H      + P + L  E  + I+
Sbjct: 1171 VITKYIENAKEIEMDAVAKDGELVMHVVSEHVENAGVHSGDATLIVPPQDLDPETVERIV 1230

Query: 278  TDAVKLAKVCGYRNAGTAEFLVDNQNRHYFIEINPRIQVEHTITEEITGIDIV 330
                K+ K          +F+  N N    IE N R         ++  ++++
Sbjct: 1231 VATAKIGKALKITGPFNIQFIAKN-NDIKVIECNVRASRSFPFISKVVNVNLI 1282

>CAGL0L05676g 619734..626369 highly similar to sp|P07259
           Saccharomyces cerevisiae YJL130c URA2, start by
           similarity
          Length = 2211

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 73/332 (21%), Positives = 130/332 (39%), Gaps = 50/332 (15%)

Query: 19  EKNKILVANRGEIPI-----------RIFRSAHELSMRTIAIYSHEDRLSMHRLKADEAY 67
           E  K+LV   G + I           +  ++  E  + TI I  +   +   +  AD+ Y
Sbjct: 435 EAKKVLVLGSGGLSIGQAGEFDYSGSQAIKALKEEGIYTILINPNIATIQTSKGLADKVY 494

Query: 68  VIGEEGQYTPVGAYLAMDEIIEIAKKHKVDFIHPGYG---FLSENSEFADKVVKAGITWI 124
                  + PV A      I+      + D I+  +G    LS   E  D+    G+  +
Sbjct: 495 -------FLPVTAEFVRKVILH----ERPDAIYVTFGGQTALSVGIEMKDEFESLGVKVL 543

Query: 125 GPPAEVIDSVGDKVSARHLAARA--NVPTVPGTPGPIETVQEALDFVNEYGYPVIIKAAF 182
           G P + I +  D    R L A A   +           +V+EAL  V + G+PVI++AA+
Sbjct: 544 GTPIDTIITTED----RELFANAIDEIDEKCAKSQAANSVEEALAAVKDIGFPVIVRAAY 599

Query: 183 XXXXXXXXXXXXXXXXADAFQRATSEARTAFGNG-TCFVERFLDKPKHIEVQLLADNHGN 241
                           A+  Q        AF +     VER +   K +E +++ D   N
Sbjct: 600 -------ALGGLGSGFANNEQELIDLCNVAFASSPQVLVERSMKGWKEVEYEVVRDAFDN 652

Query: 242 VVHLFERDCSVQR------RHQKVVEVAPAKTLPREVRDAILTDAVKLAKVCGYRNAGTA 295
            + +    C+++            + VAP++TL  E  + + T AV + +  G       
Sbjct: 653 CITV----CNMENFDPLGIHTGDSIVVAPSQTLSDEDYNMLRTTAVNVIRHLGVVGECNI 708

Query: 296 EFLVDNQNRHY-FIEINPRIQVEHTITEEITG 326
           ++ ++  ++ Y  IE+N R+     +  + TG
Sbjct: 709 QYALNPFSKEYCIIEVNARLSRSSALASKATG 740

 Score = 38.9 bits (89), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 32/173 (18%), Positives = 66/173 (38%), Gaps = 6/173 (3%)

Query: 159  IETVQEALDFVNEYGYPVIIKAAFXXXXXXXXXXXXXXXXADAFQRATSEARTAFGNGTC 218
            + ++ EA DF  + GYPV+++ ++                     +A   +R    +   
Sbjct: 1113 LTSMDEAEDFAEKVGYPVLVRPSYVLSGAAMNTVYSKNDLESYLNQAVEVSR----DYPV 1168

Query: 219  FVERFLDKPKHIEVQLLADNHGNVVHLFERDCSVQRRHQ-KVVEVAPAKTLPREVRDAIL 277
             + ++++  K IE+  +A N   V+H+          H      + P + L  E  D I+
Sbjct: 1169 VITKYIENAKEIEMDAVARNGELVMHVVSEHVENAGVHSGDATLIVPPQDLAPETVDRIV 1228

Query: 278  TDAVKLAKVCGYRNAGTAEFLVDNQNRHYFIEINPRIQVEHTITEEITGIDIV 330
                K+ K          +F+  + N    IE N R         ++ G++++
Sbjct: 1229 VATAKIGKALKITGPYNIQFIAKD-NEIKVIECNVRASRSFPFISKVVGVNLI 1280

>Scas_582.4*
          Length = 2193

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 47/207 (22%), Positives = 84/207 (40%), Gaps = 34/207 (16%)

Query: 128 AEVIDSVGDKVSARHLAARANVPTVPGTPGPIETVQEALDFVNEYGYPVIIKAAFXXXXX 187
           A  ID + +K +  H A                +V+EAL  V + G+PVI++AA+     
Sbjct: 557 ANAIDEINEKCAKSHAA---------------NSVEEALTAVKDIGFPVIVRAAY----- 596

Query: 188 XXXXXXXXXXXADAFQRATSEARTAFGNG-TCFVERFLDKPKHIEVQLLADNHGNVVHLF 246
                      A+  Q        AF +     VER +   K IE +++ D   N V + 
Sbjct: 597 --ALGGLGSGFANNEQELIDLCNVAFASSPQVLVERSMKGWKEIEYEVVRDAFDNCVTV- 653

Query: 247 ERDCSVQR------RHQKVVEVAPAKTLPREVRDAILTDAVKLAKVCGYRNAGTAEFLVD 300
              C+++            + VAP++TL  E  + +   AV + +  G       ++ ++
Sbjct: 654 ---CNMENFDPLGIHTGDSIVVAPSQTLSDEEYNMLRNTAVNVIRHLGVVGECNIQYALN 710

Query: 301 NQNRHY-FIEINPRIQVEHTITEEITG 326
             ++ Y  IE+N R+     +  + TG
Sbjct: 711 PFSKEYCIIEVNARLSRSSALASKATG 737

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 32/173 (18%), Positives = 67/173 (38%), Gaps = 6/173 (3%)

Query: 159  IETVQEALDFVNEYGYPVIIKAAFXXXXXXXXXXXXXXXXADAFQRATSEARTAFGNGTC 218
            + ++ EA  F  + GYPV+++ ++                A    +A   +R    +   
Sbjct: 1090 LTSMDEAESFAEKVGYPVLVRPSYVLSGAAMNTVYSKNDLASYLNQAVEVSR----DYPV 1145

Query: 219  FVERFLDKPKHIEVQLLADNHGNVVHLFERDCSVQRRHQ-KVVEVAPAKTLPREVRDAIL 277
             + ++++  K IE+  +A N   V+H+          H      + P + L +E  D I+
Sbjct: 1146 VITKYIENAKEIEMDAVARNGELVMHVVSEHVENAGVHSGDATLIVPPQDLAKETVDRIV 1205

Query: 278  TDAVKLAKVCGYRNAGTAEFLVDNQNRHYFIEINPRIQVEHTITEEITGIDIV 330
                K+ K          +F+  + N    IE N R         ++ G++++
Sbjct: 1206 VATAKIGKALKITGPYNIQFIAKD-NEIKVIECNVRASRSFPFISKVVGVNLI 1257

>ACR263C [1310] [Homologous to ScYJL130C (URA2) - SH]
           (827830..834552) [6723 bp, 2240 aa]
          Length = 2240

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 73/332 (21%), Positives = 128/332 (38%), Gaps = 50/332 (15%)

Query: 19  EKNKILVANRGEIPI-----------RIFRSAHELSMRTIAIYSHEDRLSMHRLKADEAY 67
           E  K+LV   G + I           +  ++  E  + TI I  +   +   +  AD+ Y
Sbjct: 453 EPKKVLVLGSGGLSIGQAGEFDYSGSQAIKALKEEGIYTILINPNIATIQTSKGLADKVY 512

Query: 68  VIGEEGQYTPVGAYLAMDEIIEIAKKHKVDFIHPGYG---FLSENSEFADKVVKAGITWI 124
                  + PV A      I+      + D I+  +G    LS   E  D+    G+  +
Sbjct: 513 -------FLPVTAEFVRKVILH----ERPDAIYVTFGGQTALSVGIEMKDEFEALGVKVL 561

Query: 125 GPPAEVIDSVGDKVSARHLAARA--NVPTVPGTPGPIETVQEALDFVNEYGYPVIIKAAF 182
           G   + I +  D    R L A A   +           TV EAL+ V + G+PVI++AA+
Sbjct: 562 GTSIDTIITTED----RELFANAMDEINEKCAKSKAASTVDEALEAVKDIGFPVIVRAAY 617

Query: 183 XXXXXXXXXXXXXXXXADAFQRATSEARTAFGNG-TCFVERFLDKPKHIEVQLLADNHGN 241
                           A   Q        AF +     VER +   K +E +++ D   N
Sbjct: 618 -------ALGGLGSGFASNEQELVDLCNVAFASSPQVLVERSMKGWKEVEYEVVRDAFDN 670

Query: 242 VVHLFERDCSVQR------RHQKVVEVAPAKTLPREVRDAILTDAVKLAKVCGYRNAGTA 295
            + +    C+++            + VAP++TL  E  + + T AV + +  G       
Sbjct: 671 CITV----CNMENFDPLGIHTGDSIVVAPSQTLSDEDYNMLRTTAVNVIRHLGVVGECNI 726

Query: 296 EFLVDNQNRHY-FIEINPRIQVEHTITEEITG 326
           ++ ++  ++ Y  IE+N R+     +  + TG
Sbjct: 727 QYALNPFSKEYCIIEVNARLSRSSALASKATG 758

 Score = 37.0 bits (84), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 30/173 (17%), Positives = 66/173 (38%), Gaps = 6/173 (3%)

Query: 159  IETVQEALDFVNEYGYPVIIKAAFXXXXXXXXXXXXXXXXADAFQRATSEARTAFGNGTC 218
            + +++EA DF N+ GYPV+++ ++                     +A   +R        
Sbjct: 1131 LTSMEEAEDFANKVGYPVLVRPSYVLSGAAMNTVYSKDDLESYLNQAVEVSREY----PV 1186

Query: 219  FVERFLDKPKHIEVQLLADNHGNVVHLFERDCSVQRRHQ-KVVEVAPAKTLPREVRDAIL 277
             + ++++  K IE+  +A +   ++H+          H      + P + L  E    I+
Sbjct: 1187 VITKYIENAKEIEMDAVAKDGEMIMHVVSEHVENAGVHSGDATLIVPPQDLDPETVRRIV 1246

Query: 278  TDAVKLAKVCGYRNAGTAEFLVDNQNRHYFIEINPRIQVEHTITEEITGIDIV 330
                K+ +          +F+  N N    IE N R         ++ G++++
Sbjct: 1247 DATAKIGRALKITGPYNIQFIAKN-NEIKVIECNVRASRSFPFISKVIGVNLI 1298

>Kwal_55.19783
          Length = 1121

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 46/216 (21%), Positives = 86/216 (39%), Gaps = 19/216 (8%)

Query: 118 KAGITWIGPPAEVIDSVGDKVSARHLAARANVPTVPGTPGPIETVQEALDFVNEYGYPVI 177
           K G+  +G P + +++  D+          N+PT        ETV EAL   +  GYPVI
Sbjct: 134 KYGVKVLGTPIKTLETSEDRDLFAQALKEINIPTAESFA--CETVDEALSAASRVGYPVI 191

Query: 178 IKAAFXXXXXXXXXXXXXXXXADAFQRATSEARTAFGNGTCFVERFLDKPKHIEVQLLAD 237
           +++A+                 +   +A S +          VE+ L   K +E +++ D
Sbjct: 192 VRSAYALGGLGSGFAENEAEMKELAAQALSLSP------QILVEKSLKGWKEVEYEVVRD 245

Query: 238 NHGNVVHLFERDCSVQR------RHQKVVEVAPAKTLPREVRDAILTDAVKLAKVCGYRN 291
              N + +    C+++            +  AP++TL  E    + T A+K+ +  G   
Sbjct: 246 RVDNCITV----CNMENFDPLGVHTGDSIVFAPSQTLSDEEFHMLRTAAIKIIRHLGVVG 301

Query: 292 AGTAEFLVDNQNRHY-FIEINPRIQVEHTITEEITG 326
               ++ +      Y  IE+N R+     +  + TG
Sbjct: 302 ECNVQYALQPDGLDYRVIEVNARLSRSSALASKATG 337

 Score = 34.7 bits (78), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 33/183 (18%), Positives = 68/183 (37%), Gaps = 12/183 (6%)

Query: 159 IETVQEALDFVNEYGYPVIIKAAFXXXXXXXXXXXXXXXXADAFQRATSEARTAFGNGTC 218
           + +V EA DF    GYPV+I+ ++                 D  +   + A     +   
Sbjct: 717 LSSVSEAKDFSKSVGYPVLIRPSYVLSGAAMSVVNSE----DELETKLTNASDVSPDHPV 772

Query: 219 FVERFLDKPKHIEVQLLADNHGNVVHLFERDCSVQRRHQ-KVVEVAPAKTLPREVRDAIL 277
            + +F++  + I+V  +A N   +VH           H      + P ++L   +++ + 
Sbjct: 773 VISKFIEGAQEIDVDAVAYNGEVLVHAISEHVENAGVHSGDATLILPPQSLSESIKERLY 832

Query: 278 TDAVKLAKVCGYRNAGTAEFLVDNQNRH-----YFIEINPRIQVEHTITEEITGIDIVSA 332
             A K+A    ++  G     +   +RH       IE N R         ++ G + +  
Sbjct: 833 DIAKKVAH--AWKITGPFNMQIIKDDRHEGTSLKVIECNIRASRSFPFVSKVLGCNFIDV 890

Query: 333 QIQ 335
            ++
Sbjct: 891 AVK 893

>YJL130C (URA2) [2788] chr10 complement(165641..172285)
           Multifunctional protein of pyrimidine biosynthesis
           pathway, contains glutamine amidotransferase,
           glutamine-dependent carbamylphosphate synthetase
           (CPSase), dihydroorotase-like (DHOase) domain, and
           aspartate carbamyltransferase (ATCase) [6645 bp, 2214
           aa]
          Length = 2214

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 68/329 (20%), Positives = 124/329 (37%), Gaps = 44/329 (13%)

Query: 19  EKNKILVANRGEIPI-----------RIFRSAHELSMRTIAIYSHEDRLSMHRLKADEAY 67
           E  K+LV   G + I           +  ++  E  + TI I  +   +   +  AD+ Y
Sbjct: 437 EAKKVLVLGSGGLSIGQAGEFDYSGSQAIKALKEEGIYTILINPNIATIQTSKGLADKVY 496

Query: 68  VIGEEGQYTPVGAYLAMDEIIEIAKKHKVDFIHPGYG---FLSENSEFADKVVKAGITWI 124
                  + PV A      I+      + D I+  +G    LS      D+    G+  +
Sbjct: 497 -------FVPVTAEFVRKVILH----ERPDAIYVTFGGQTALSVGIAMKDEFEALGVKVL 545

Query: 125 GPPAEVIDSVGDKVSARHLAARANVPTVPGTPGPIETVQEALDFVNEYGYPVIIKAAFXX 184
           G P + I +  D+    +     N            +V EAL  V E G+PVI++AA+  
Sbjct: 546 GTPIDTIITTEDRELFSNAIDEINEKCAKSQAA--NSVDEALAAVKEIGFPVIVRAAYAL 603

Query: 185 XXXXXXXXXXXXXXADAFQRATSEARTAFGNGTCFVERFLDKPKHIEVQLLADNHGNVVH 244
                          D    A S +          VE+ +   K +E +++ D   N + 
Sbjct: 604 GGLGSGFANNEKELVDLCNVAFSSS------PQVLVEKSMKGWKEVEYEVVRDAFDNCIT 657

Query: 245 LFERDCSVQR------RHQKVVEVAPAKTLPREVRDAILTDAVKLAKVCGYRNAGTAEFL 298
           +    C+++            + VAP++TL  E  + + T AV + +  G       ++ 
Sbjct: 658 V----CNMENFDPLGIHTGDSIVVAPSQTLSDEDYNMLRTTAVNVIRHLGVVGECNIQYA 713

Query: 299 VDNQNRHY-FIEINPRIQVEHTITEEITG 326
           ++  ++ Y  IE+N R+     +  + TG
Sbjct: 714 LNPVSKDYCIIEVNARLSRSSALASKATG 742

 Score = 36.6 bits (83), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 31/173 (17%), Positives = 65/173 (37%), Gaps = 6/173 (3%)

Query: 159  IETVQEALDFVNEYGYPVIIKAAFXXXXXXXXXXXXXXXXADAFQRATSEARTAFGNGTC 218
            + ++ EA  F  + GYPV+++ ++                     +A   +R    +   
Sbjct: 1115 LTSMDEAESFAEKVGYPVLVRPSYVLSGAAMNTVYSKNDLESYLNQAVEVSR----DYPV 1170

Query: 219  FVERFLDKPKHIEVQLLADNHGNVVHLFERDCSVQRRHQ-KVVEVAPAKTLPREVRDAIL 277
             + ++++  K IE+  +A N   V+H+          H      + P + L  E  D I+
Sbjct: 1171 VITKYIENAKEIEMDAVARNGELVMHVVSEHVENAGVHSGDATLIVPPQDLAPETVDRIV 1230

Query: 278  TDAVKLAKVCGYRNAGTAEFLVDNQNRHYFIEINPRIQVEHTITEEITGIDIV 330
                K+ K          +F+  + N    IE N R         ++ G++++
Sbjct: 1231 VATAKIGKALKITGPYNIQFIAKD-NEIKVIECNVRASRSFPFISKVVGVNLI 1282

>KLLA0E23782g complement(2105401..2106582) highly similar to
           sp|Q12122 Saccharomyces cerevisiae YDL131w LYS21
           homocitrate synthase, start by similarity
          Length = 393

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 46/218 (21%), Positives = 88/218 (40%), Gaps = 21/218 (9%)

Query: 718 LEVVEKIVQMGTHILGIKDMAGTMKPAAAKLLIGSLRTRYPDLPIHVHSHDSAGTAVASM 777
           L + + + ++G + +GI D  G   P     L+ +L++      I  H HD  G A+ + 
Sbjct: 165 LNIYKTVDKIGVNRVGIADTVGCANPRQVYELVRTLKS-VVSCDIECHFHDDTGCAIGNS 223

Query: 778 TACALAGADVVDVA---INSMSGLTSQPSINA-LLASLEGNIDTGINVEHVRELDAYWAE 833
            +   AGA ++DV+   I   +G+TS   + A ++ S    + +   +  +R+L+   A+
Sbjct: 224 YSALEAGARLIDVSVLGIGERNGITSLGGLMARMIVSAPEYVKSKYKLHKLRDLENLVAD 283

Query: 834 MRLLYSCFEADLKG-----PDPEVYQHEIPGGQLTNLLFQAQQLGLGEQ---------WA 879
              +   F   + G         ++   I     T  +   +  G+            W 
Sbjct: 284 AVSVNVPFNNPITGFCAFTHKAGIHAKAILANPSTYEILNPEDFGMKRYIHFANRLTGWN 343

Query: 880 ETKRAYREANYLLGD--IVKVTPTSKVVGDLAQFMVSN 915
             K    + N  L D  I +VT   K +GD+ Q  + +
Sbjct: 344 AIKSRVEQLNLHLSDDQIKEVTSKIKQIGDVRQLSIED 381

>Sklu_2413.4 YJR109C, Contig c2413 10886-14254
          Length = 1122

 Score = 40.0 bits (92), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 43/216 (19%), Positives = 86/216 (39%), Gaps = 19/216 (8%)

Query: 118 KAGITWIGPPAEVIDSVGDKVSARHLAARANVPTVPGTPGPIETVQEALDFVNEYGYPVI 177
           K G+  +G P + +++  D+          N+P         ET+ +AL+   +  YPVI
Sbjct: 134 KYGVKVLGTPIKTLETSEDRDLFAQALKEINIPIAESFA--CETIDQALEAAAKVKYPVI 191

Query: 178 IKAAFXXXXXXXXXXXXXXXXADAFQRATSEARTAFGNGTCFVERFLDKPKHIEVQLLAD 237
           +++A+                 +   ++ S A          VE+ L   K IE +++ D
Sbjct: 192 VRSAYALGGLGSGFANDEQEMKELASQSLSLAP------QILVEKSLKGWKEIEYEVVRD 245

Query: 238 NHGNVVHLFERDCSVQR------RHQKVVEVAPAKTLPREVRDAILTDAVKLAKVCGYRN 291
             GN + +    C+++            +  AP++TL  E    + + A+K+ +  G   
Sbjct: 246 RVGNCITV----CNMENFDPLGIHTGDSIVFAPSQTLSDEEFHMLRSAAIKIIRHLGVVG 301

Query: 292 AGTAEFLVDNQNRHY-FIEINPRIQVEHTITEEITG 326
               ++ +      Y  IE+N R+     +  + TG
Sbjct: 302 ECNVQYALQPDGLDYRVIEVNARLSRSSALASKATG 337

 Score = 32.7 bits (73), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 35/181 (19%), Positives = 69/181 (38%), Gaps = 8/181 (4%)

Query: 159 IETVQEALDFVNEYGYPVIIKAAFXXXXXXXXXXXXXXXXADAFQRATSEARTAFGNGTC 218
           + +V EA  F ++ GYPV+I+ ++                 D  +   + A     +   
Sbjct: 717 LTSVNEAKIFASKVGYPVLIRPSYVLSGAAMSVVNSE----DELEVKLTNASDVSPDHPV 772

Query: 219 FVERFLDKPKHIEVQLLADNHGNVVHLFERDCSVQRRHQKVVE-VAPAKTLPREVRDAIL 277
            + +F++  + I+V  +A +   +VH           H      + P + L  E +  + 
Sbjct: 773 VISKFIEGAQEIDVDAVAYDGKVLVHAISEHVENAGVHSGDASLILPPQHLSEETKQRLK 832

Query: 278 TDAVKLAK---VCGYRNAGTAEFLVDNQNRHYFIEINPRIQVEHTITEEITGIDIVSAQI 334
             A K+AK   +CG  N    +   D+      IE N R         ++ GI+ +   +
Sbjct: 833 DIADKVAKAWNICGPFNMQIIKDDRDHGTSLKVIECNIRASRSFPFVSKVLGINFIDVAV 892

Query: 335 Q 335
           +
Sbjct: 893 K 893

>Sklu_2431.2 YDL131W, Contig c2431 3030-4214
          Length = 394

 Score = 38.5 bits (88), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 29/120 (24%), Positives = 57/120 (47%), Gaps = 5/120 (4%)

Query: 718 LEVVEKIVQMGTHILGIKDMAGTMKPAAAKLLIGSLRTRYPDLPIHVHSHDSAGTAVASM 777
           L + + + ++G   +GI D  G   P     L+ +L++      I  H H+  G A+ + 
Sbjct: 165 LNIYKTVDKIGVDRVGIADTVGCANPRQVYELVRTLKS-VIHCDIECHFHNDTGCAIGNS 223

Query: 778 TACALAGADVVDVA---INSMSGLTSQPSINA-LLASLEGNIDTGINVEHVRELDAYWAE 833
            +   AGA ++DV+   I   +G+TS   + A ++ S    + +   +  +R+L+   AE
Sbjct: 224 YSALEAGARLIDVSVLGIGERNGITSLGGLMARMIVSAPDYVKSKYKLHKLRDLETLVAE 283

>KLLA0F03190g complement(296883..300236) highly similar to sp|P03965
           Saccharomyces cerevisiae YJR109c CPA2 arginine-specific
           carbamoylphosphate synthase, large chain, start by
           similarity
          Length = 1117

 Score = 38.9 bits (89), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 44/221 (19%), Positives = 88/221 (39%), Gaps = 19/221 (8%)

Query: 113 ADKVVKAGITWIGPPAEVIDSVGDKVSARHLAARANVPTVPGTPGPIETVQEALDFVNEY 172
           A  + K  I  +G P + +++  D+          ++PT        ETV  AL+  +  
Sbjct: 127 AGVLAKYNIKVLGTPIKTLETSEDRDLFAQALKEIDIPTAESIA--CETVDAALEAADIV 184

Query: 173 GYPVIIKAAFXXXXXXXXXXXXXXXXADAFQRATSEARTAFGNGTCFVERFLDKPKHIEV 232
           G+PVI+++A+                     ++ S A          VE+ L   K +E 
Sbjct: 185 GFPVIVRSAYALGGLGSGFANNAQEMKQLASQSLSLAP------QILVEKSLKGWKEVEY 238

Query: 233 QLLADNHGNVVHLFERDCSVQR------RHQKVVEVAPAKTLPREVRDAILTDAVKLAKV 286
           +++ D  GN + +    C+++            +  AP++TL  E    + + A+K+ + 
Sbjct: 239 EVVRDRVGNCITV----CNMENFDPLGIHTGDSIVFAPSQTLSDEEFHMLRSAAIKIIRH 294

Query: 287 CGYRNAGTAEFLVDNQNRHY-FIEINPRIQVEHTITEEITG 326
            G       ++ +   +  Y  IE+N R+     +  + TG
Sbjct: 295 LGVIGECNVQYALSPDSLDYRVIEVNARLSRSSALASKATG 335

>ADR107W [1848] [Homologous to ScYDL131W (LYS21) - SH; ScYDL182W
           (LYS20) - SH] complement(897769..897784,897846..899158)
           [1329 bp, 442 aa]
          Length = 442

 Score = 38.1 bits (87), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 59/288 (20%), Positives = 105/288 (36%), Gaps = 62/288 (21%)

Query: 718 LEVVEKIVQMGTHILGIKDMAGTMKPAAAKLLIGSLRTRYPDLPIHVHSHDSAGTAVASM 777
           L + + + ++G + +GI D  G   P     L+ +L++      +  H H+  G A+A+ 
Sbjct: 182 LNIYKTVDKIGVNRVGIADTVGCANPRQVYELVRTLKS-VVSCDVECHFHNDTGCAIANA 240

Query: 778 TACALAGADVVDVAINSMSGLTSQPSINALLASL----EGNIDTGINVEHVRELDAYWAE 833
                 GA +VDV++  +        +  L+A +       + +   +  +R+++   AE
Sbjct: 241 YTALDGGAKLVDVSVLDIGERNEITPLGGLMARMIVAAPDYVKSKYKLHKIRDIENLVAE 300

Query: 834 MRLLYSCFEADLKG----------------PDPEVYQHEIPGG-QLTNLLFQAQQLGLGE 876
              +   F   + G                 +P  Y+   P    +T  +  A +L    
Sbjct: 301 AVEVNVPFNNPITGFCAFTHKAGIHAKAILANPSTYEILNPNDFGMTRYIHFANRL---T 357

Query: 877 QWAETKRAYREAN-YLLGDIVKVTPTSKVVGDLAQFMVSNKLTSDDIRRLANSLDFPDSV 935
            W   K    + N +L  D VK     +V   + QF  S  L  DD+          DS+
Sbjct: 358 GWNAIKSRVDQLNLHLTDDQVK-----EVTAKIKQFGTSRPLNIDDV----------DSI 402

Query: 936 MDFFEGLIGQPYGGFPEPLRSDVLRNKRRKLTCRPG---LELEPFDLE 980
           +  F   I  P                  ++T RP     E+  FDLE
Sbjct: 403 IKAFHAQIATP------------------RVTARPANREEEINGFDLE 432

>Kwal_27.12090
          Length = 394

 Score = 38.1 bits (87), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 46/218 (21%), Positives = 84/218 (38%), Gaps = 21/218 (9%)

Query: 718 LEVVEKIVQMGTHILGIKDMAGTMKPAAAKLLIGSLRTRYPDLPIHVHSHDSAGTAVASM 777
           L + + +  +G + +GI D  G   P     L+ +L+       I  H HD  G A+ + 
Sbjct: 165 LNIYKTVSAIGVNRVGIADTVGCANPRQVYDLVRTLKGVVT-CDIECHFHDDTGCAIGNA 223

Query: 778 TACALAGADVVDVA---INSMSGLTSQPSINA-LLASLEGNIDTGINVEHVRELDAYWAE 833
            +   AGA ++DV+   I   +G+T    + A ++ +    + +   +  +R+++   AE
Sbjct: 224 YSALEAGAKLIDVSVLGIGERNGITPLGGLMARMIVAAPEYVKSKYKLHKIRDIENLVAE 283

Query: 834 MRLLYSCFEADLKG-----PDPEVYQHEIPGGQLTNLLFQAQQLGLGEQ---------WA 879
              +   F   + G         ++   I     T  +   Q  GL            W 
Sbjct: 284 AVEVNVPFNNPITGFCAFTHKAGIHAKAILANPSTYEILDPQDFGLKRYIHFANRLTGWN 343

Query: 880 ETKRAYREANYLLGD--IVKVTPTSKVVGDLAQFMVSN 915
             K    + N  L D  I  VT   K +GD+ Q  + +
Sbjct: 344 AIKSRVEQLNLHLTDDQIKDVTQKIKKIGDVRQLSIDD 381

>KLLA0F05489g 541146..542471 highly similar to sp|Q12122
           Saccharomyces cerevisiae YDL131w LYS21 homocitrate
           synthase, start by similarity
          Length = 441

 Score = 37.4 bits (85), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 37/75 (49%), Gaps = 1/75 (1%)

Query: 718 LEVVEKIVQMGTHILGIKDMAGTMKPAAAKLLIGSLRTRYPDLPIHVHSHDSAGTAVASM 777
           L + + + ++G + +GI D  G   P     L+ +L++      I  H H+  G A+A+ 
Sbjct: 182 LNIYKTVDKIGVNRVGIADTVGCANPRQVYELVRTLKS-VVSCDIECHFHNDTGCAIANA 240

Query: 778 TACALAGADVVDVAI 792
                 GA ++DVA+
Sbjct: 241 YTALEGGARLIDVAV 255

>Scas_701.35
          Length = 430

 Score = 37.0 bits (84), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 36/75 (48%), Gaps = 1/75 (1%)

Query: 718 LEVVEKIVQMGTHILGIKDMAGTMKPAAAKLLIGSLRTRYPDLPIHVHSHDSAGTAVASM 777
           L + + +  +G + +GI D  G   P     L+ +LR+      I  H H+  G A+A+ 
Sbjct: 170 LNIYKTVNSIGVNRVGIADTVGCANPRQVYELVRTLRS-VVSCDIECHFHNDTGCAIANA 228

Query: 778 TACALAGADVVDVAI 792
                 GA ++DV++
Sbjct: 229 YTALEGGARLIDVSV 243

>Kwal_56.24401
          Length = 441

 Score = 37.0 bits (84), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 36/75 (48%), Gaps = 1/75 (1%)

Query: 718 LEVVEKIVQMGTHILGIKDMAGTMKPAAAKLLIGSLRTRYPDLPIHVHSHDSAGTAVASM 777
           L + + +  +G + +GI D  G   P     L+ +L+T      +  H H+  G A+A+ 
Sbjct: 179 LNIYKTVDAIGVNRVGIADTVGCANPRQVYELMRTLKT-VVSCDVECHFHNDTGCAIANA 237

Query: 778 TACALAGADVVDVAI 792
                 GA ++DVA+
Sbjct: 238 YTALEGGAKLIDVAV 252

>KLLA0E15444g 1370741..1377427 highly similar to sp|P07259
           Saccharomyces cerevisiae YJL130c URA2 multifunctional
           pyrimidine biosynthesis protein, start by similarity
          Length = 2228

 Score = 37.4 bits (85), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 35/166 (21%), Positives = 68/166 (40%), Gaps = 19/166 (11%)

Query: 169 VNEYGYPVIIKAAFXXXXXXXXXXXXXXXXADAFQRATSEARTAFGNG-TCFVERFLDKP 227
           V + G+PVI++AA+                 D           AF +     VER +   
Sbjct: 586 VKDIGFPVIVRAAYALGGLGSGFASNEKELVDL-------CNVAFASSPQVLVERSMKGW 638

Query: 228 KHIEVQLLADNHGNVVHLFERDCSVQR------RHQKVVEVAPAKTLPREVRDAILTDAV 281
           K IE +++ D   N + +    C+++            + +AP++TL  E  + + T AV
Sbjct: 639 KEIEYEVVRDAFDNCITV----CNMENFDPLGIHTGDSIVIAPSQTLSDEDYNMLRTTAV 694

Query: 282 KLAKVCGYRNAGTAEFLVDNQNRHY-FIEINPRIQVEHTITEEITG 326
            + +  G       ++ ++  ++ Y  IE+N R+     +  + TG
Sbjct: 695 NVIRHLGVVGECNIQYALNPTSKEYCIIEVNARLSRSSALASKATG 740

>YDL131W (LYS21) [738] chr4 (227393..228715) Homocitrate synthase
           isoenzyme, involved in lysine metabolism [1323 bp, 440
           aa]
          Length = 440

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 37/75 (49%), Gaps = 1/75 (1%)

Query: 718 LEVVEKIVQMGTHILGIKDMAGTMKPAAAKLLIGSLRTRYPDLPIHVHSHDSAGTAVASM 777
           L + + + ++G + +GI D  G   P     LI +L++      I  H H+  G A+A+ 
Sbjct: 180 LNIYKTVDKIGVNRVGIADTVGCANPRQVYELIRTLKS-VVSCDIECHFHNDTGCAIANA 238

Query: 778 TACALAGADVVDVAI 792
                 GA ++DV++
Sbjct: 239 YTALEGGARLIDVSV 253

>CAGL0J09240g 911669..912982 highly similar to sp|Q12122
           Saccharomyces cerevisiae YDL131w LYS21 or sp|P48570
           Saccharomyces cerevisiae YDL182w LYS20, start by
           similarity
          Length = 437

 Score = 36.6 bits (83), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 21/94 (22%), Positives = 43/94 (45%), Gaps = 1/94 (1%)

Query: 718 LEVVEKIVQMGTHILGIKDMAGTMKPAAAKLLIGSLRTRYPDLPIHVHSHDSAGTAVASM 777
           L + + + ++G + +GI D  G   P     L+ +L++      I  H H+  G A+A+ 
Sbjct: 177 LNIYKTVDKIGVNRVGIADTVGCANPRQVYELVRTLKSVVS-CDIECHFHNDTGCAIANA 235

Query: 778 TACALAGADVVDVAINSMSGLTSQPSINALLASL 811
                 GA ++DV++  +        +  L+A +
Sbjct: 236 YTALEGGAKLIDVSVLGIGERNGITPLGGLMARM 269

>CAGL0J06402g complement(608851..610146) highly similar to sp|Q12122
           Saccharomyces cerevisiae YDL131w LYS21 or sp|P48570
           Saccharomyces cerevisiae YDL182w LYS20, hypothetical
           start
          Length = 431

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 37/75 (49%), Gaps = 1/75 (1%)

Query: 718 LEVVEKIVQMGTHILGIKDMAGTMKPAAAKLLIGSLRTRYPDLPIHVHSHDSAGTAVASM 777
           L + + + ++G + +GI D  G   P     L+ +L++      I  H H+  G A+A+ 
Sbjct: 165 LNIYKTVDKIGVNRVGIADTVGCANPRQVYELVRTLKS-VVSCDIECHFHNDTGCAIANA 223

Query: 778 TACALAGADVVDVAI 792
                 GA ++DV++
Sbjct: 224 YTALEGGAKLIDVSV 238

>Scas_704.3
          Length = 438

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 37/75 (49%), Gaps = 1/75 (1%)

Query: 718 LEVVEKIVQMGTHILGIKDMAGTMKPAAAKLLIGSLRTRYPDLPIHVHSHDSAGTAVASM 777
           L + + + ++G + +GI D  G   P     L+ +L++      I  H H+  G A+A+ 
Sbjct: 179 LNIYKTVNKIGVNRVGIADTVGCANPRQVYELVRTLKS-VVSCDIECHFHNDTGCAIANA 237

Query: 778 TACALAGADVVDVAI 792
                 GA ++DV++
Sbjct: 238 YTALEGGARLIDVSV 252

>YDL182W (LYS20) [690] chr4 (133438..134724) Homocitrate synthase
           isoenzyme, involved in lysine biosynthesis [1287 bp, 428
           aa]
          Length = 428

 Score = 36.2 bits (82), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 37/75 (49%), Gaps = 1/75 (1%)

Query: 718 LEVVEKIVQMGTHILGIKDMAGTMKPAAAKLLIGSLRTRYPDLPIHVHSHDSAGTAVASM 777
           L + + + ++G + +GI D  G   P     LI +L++      I  H H+  G A+A+ 
Sbjct: 166 LNIYKTVDKIGVNRVGIADTVGCANPRQVYELIRTLKS-VVSCDIECHFHNDTGCAIANA 224

Query: 778 TACALAGADVVDVAI 792
                 GA ++DV++
Sbjct: 225 YTALEGGARLIDVSV 239

>YJR109C (CPA2) [3001] chr10 complement(629500..632856)
           Carbamoylphosphate synthetase of arginine biosynthetic
           pathway, synthetase (large) subunit [3357 bp, 1118 aa]
          Length = 1118

 Score = 35.8 bits (81), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 38/174 (21%), Positives = 70/174 (40%), Gaps = 17/174 (9%)

Query: 160 ETVQEALDFVNEYGYPVIIKAAFXXXXXXXXXXXXXXXXADAFQRATSEARTAFGNGTCF 219
           ETV EAL+      YPVI+++A+                 +   ++ S A          
Sbjct: 171 ETVDEALEAAERVKYPVIVRSAYALGGLGSGFANNASEMKELAAQSLSLA------PQIL 224

Query: 220 VERFLDKPKHIEVQLLADNHGNVVHLFERDCSVQRRHQKVVEV------APAKTLPREVR 273
           VE+ L   K +E +++ D  GN + +    C+++      V        AP++TL  E  
Sbjct: 225 VEKSLKGWKEVEYEVVRDRVGNCITV----CNMENFDPLGVHTGDSMVFAPSQTLSDEEF 280

Query: 274 DAILTDAVKLAKVCGYRNAGTAEFLVDNQNRHY-FIEINPRIQVEHTITEEITG 326
             + + A+K+ +  G       ++ +      Y  IE+N R+     +  + TG
Sbjct: 281 HMLRSAAIKIIRHLGVIGECNVQYALQPDGLDYRVIEVNARLSRSSALASKATG 334

>CAGL0C04917g 457506..460847 highly similar to sp|P03965
           Saccharomyces cerevisiae YJR109c CPA2, hypothetical
           start
          Length = 1113

 Score = 35.8 bits (81), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 33/178 (18%), Positives = 66/178 (37%), Gaps = 5/178 (2%)

Query: 159 IETVQEALDFVNEYGYPVIIKAAFXXXXXXXXXXXXXXXXADAFQRATSEARTAFGNGTC 218
           + +V+EA  F N+  YPV+I+ ++                 D    A+  +     +   
Sbjct: 714 LTSVEEAKTFANKVSYPVLIRPSYVLSGAAMSVVNNEHELEDKLTLASDVSP----DHPV 769

Query: 219 FVERFLDKPKHIEVQLLADNHGNVVHLFERDCSVQRRHQ-KVVEVAPAKTLPREVRDAIL 277
            + +F+   + I+V  +A N   +VH           H      + P + L   V+  + 
Sbjct: 770 VMSKFIQGAQEIDVDAVACNGELLVHAISEHVEDAGVHSGDATLILPPQHLSENVKSQLK 829

Query: 278 TDAVKLAKVCGYRNAGTAEFLVDNQNRHYFIEINPRIQVEHTITEEITGIDIVSAQIQ 335
           T A K+AK          + +   +N    IE N R         ++ G++ +   ++
Sbjct: 830 TIAKKVAKAWNITGPFNMQVIKAGENDLKVIECNIRASRSFPFVSKVLGVNFIEVAVK 887

 Score = 32.7 bits (73), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 35/174 (20%), Positives = 69/174 (39%), Gaps = 17/174 (9%)

Query: 160 ETVQEALDFVNEYGYPVIIKAAFXXXXXXXXXXXXXXXXADAFQRATSEARTAFGNGTCF 219
           E + + L   +  GYPVII++A+                 +   ++ S A          
Sbjct: 170 ENIDDVLSAASTIGYPVIIRSAYALGGLGSGFANNPEELKELASQSLSLAP------QVL 223

Query: 220 VERFLDKPKHIEVQLLADNHGNVVHLFERDCSVQR------RHQKVVEVAPAKTLPREVR 273
           VE+ L   K +E +++ D   N + +    C+++            +  AP++TL  E  
Sbjct: 224 VEKSLRGWKEVEYEVVRDRENNCITV----CNMENFDPLGVHTGDSIVFAPSQTLSDEEF 279

Query: 274 DAILTDAVKLAKVCGYRNAGTAEF-LVDNQNRHYFIEINPRIQVEHTITEEITG 326
             + + A+K+ +  G       ++ L  N   +  IE+N R+     +  + TG
Sbjct: 280 HMLRSAAIKIIRHLGVVGECNVQYALSPNSLDYRVIEVNARLSRSSALASKATG 333

>Scas_691.19
          Length = 1117

 Score = 35.0 bits (79), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 44/221 (19%), Positives = 83/221 (37%), Gaps = 29/221 (13%)

Query: 118 KAGITWIGPPAEVIDSVGDKVSARHLAARANVPTVPGTPGPIETVQEALDFVNEYGYPVI 177
           K  +  +G P + + +  D+    +     N+P          TV EAL   N   YPVI
Sbjct: 131 KYNVKVLGTPIKTLITSEDRDLFANALKEINIPIANSIA--CATVDEALAAANSIKYPVI 188

Query: 178 IKAAFXXXXXXXXXXXXXXXXADAFQRATSEAR-----TAFGNGTCFVERFLDKPKHIEV 232
           I++A+                   F     E +     +   +    VER +   K +E 
Sbjct: 189 IRSAY-----------ALGGLGSGFANNDQELKQLSSQSLSLSPQILVERSMKGWKEVEY 237

Query: 233 QLLADNHGNVVHLFERDCSVQR------RHQKVVEVAPAKTLPREVRDAILTDAVKLAKV 286
           +++ D  GN + +    C+++            +  AP++TL  E    + + A+K+ + 
Sbjct: 238 EVVRDRVGNCITV----CNMENFDPLGVHTGDSIVFAPSQTLSDEEYHMLRSAAIKIIRH 293

Query: 287 CGYRNAGTAEFLVDNQNRHY-FIEINPRIQVEHTITEEITG 326
            G       ++ +      Y  IE+N R+     +  + TG
Sbjct: 294 LGVIGECNVQYALQPDGLDYCVIEVNARLSRSSALASKATG 334

>KLLA0D03146g complement(263816..264970) similar to sp|P53164
           Saccharomyces cerevisiae YGL067w NPY1 NADH
           pyrophosphatase I of the Nudix family of hydrolases, has
           a peroxisomal targeting signal singleton, start by
           similarity
          Length = 384

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 35/70 (50%), Gaps = 10/70 (14%)

Query: 788 VDVAINSMSGLTSQP---SINALLASLEGNIDTG-----INVEHVREL-DAYWAEMRLLY 838
           + V +N +  L +QP     N ++  L G ID       IN+EH +EL DA W EM L+ 
Sbjct: 279 IKVELNDVDILFTQPWPYPCNLMIGCL-GLIDFNGDNEIINLEHDKELLDAQWFEMELVS 337

Query: 839 SCFEADLKGP 848
             FE   K P
Sbjct: 338 QAFERYGKAP 347

>YHR216W (IMD2) [2500] chr8 (554394..555965)
           Inosine-5'-monophosphate dehydrogenase, catalyzes the
           conversion of inosine 5'-phosphate and NAD(+) to
           xanthosine 5'-phosphate and NADH, the first reaction
           unique to GMP biosynthesis [1572 bp, 523 aa]
          Length = 523

 Score = 32.3 bits (72), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 40/131 (30%), Positives = 59/131 (45%), Gaps = 12/131 (9%)

Query: 364 TTEDPSKNFQPDTGRLEVYRSAGG-NGVRLDG--GNAYAGATISPHYDSMLVKCSCSGST 420
           TTE P + F  D  RL+ YR  G  + ++  G  GNA      S   DS+LV    SG+ 
Sbjct: 397 TTESPGEYFYQDGKRLKAYRGMGSIDAMQKTGTKGNASTSRYFS-ESDSVLVAQGVSGA- 454

Query: 421 YEIVRRKMIRALIEFRIRGVKTNIPFL----LTLLTNPVFIEGTYWTTFIDDTPQLFQMV 476
             +V +  I+  I +   G++ +   +    LTLL N V   G     F   + QL   V
Sbjct: 455 --VVDKGSIKKFIPYLYNGLQHSCQDIGCRSLTLLKNNV-QRGKVRFEFRTASAQLEGGV 511

Query: 477 SSQNRAQKLLH 487
            + +  +K LH
Sbjct: 512 HNLHSYEKRLH 522

>Kwal_47.19231
          Length = 795

 Score = 32.3 bits (72), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 28/127 (22%), Positives = 51/127 (40%), Gaps = 3/127 (2%)

Query: 113 ADKVVKAGITWIGPPAEVIDSVGDKVSARHLAARANVPTVPGTPGPIETVQEALDFVNEY 172
           AD   KAGI   GP A+     G K  ++   A+ N+PT        +  ++A +++ + 
Sbjct: 87  ADVFTKAGIPVFGPSAKAAIFEGSKTFSKDFMAKHNIPTA--RYANFDDYEKAKEYLEKV 144

Query: 173 GYPVIIKAAFXXXXXXXXXXXXXXXXADAFQRATSEARTAFGNGTCFVERFLDKPKHIEV 232
            Y V++KA                   DA +    E +      +  +E FL+    I +
Sbjct: 145 DYQVVLKADGIAAGKGVLIPTTPQEAQDALKALMVERQFGAAGDSIVIEEFLEG-DEISI 203

Query: 233 QLLADNH 239
             ++D +
Sbjct: 204 LTISDGY 210

>YML056C (IMD4) [3914] chr13
           complement(162194..163308,163717..164176) Protein with
           similarity to inosine-5'-monophosphate dehydrogenase
           [1575 bp, 524 aa]
          Length = 524

 Score = 32.0 bits (71), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 38/81 (46%), Gaps = 7/81 (8%)

Query: 364 TTEDPSKNFQPDTGRLEVYRSAGGNGVRLDGGNAYAGATISPHY---DSMLVKCSCSGST 420
           TTE P + F  D  RL+ YR  G        GN    A+ S ++   DS+LV    SG+ 
Sbjct: 398 TTESPGEYFYKDGKRLKAYRGMGSIDAMQKTGNK-GNASTSRYFSESDSVLVAQGVSGA- 455

Query: 421 YEIVRRKMIRALIEFRIRGVK 441
             +V +  I+  I +   G++
Sbjct: 456 --VVDKGSIKKFIPYLYNGLQ 474

>CAGL0K10780g
           join(1047904..1047925,1049093..1049539,1050106..1051220)
           highly similar to sp|P50094 Saccharomyces cerevisiae
           YML056c IMD4 or sp|P50095 Saccharomyces cerevisiae
           YLR432w IMD3 or sp|P38697 Saccharomyces cerevisiae
           YHR216w PUR5
          Length = 527

 Score = 30.8 bits (68), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 39/81 (48%), Gaps = 7/81 (8%)

Query: 364 TTEDPSKNFQPDTGRLEVYRSAGG-NGVRLDG--GNAYAGATISPHYDSMLVKCSCSGST 420
           TTE P   F  D  RL+VYR  G  + ++  G  GNA      S   DS+LV    SG+ 
Sbjct: 401 TTESPGDYFYRDGKRLKVYRGMGSIDAMQKTGKKGNASTSRYFS-ETDSVLVAQGVSGA- 458

Query: 421 YEIVRRKMIRALIEFRIRGVK 441
             +V +  I+  I +   G++
Sbjct: 459 --VVDKGSIKKFIPYLYNGLQ 477

>Scas_712.17
          Length = 793

 Score = 30.8 bits (68), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 25/101 (24%), Positives = 41/101 (40%), Gaps = 11/101 (10%)

Query: 84  MDEIIEIAKKHKVDFIHPGYGFLSENSEFADKVV----KAGITWIGPPAEVIDSVGDKVS 139
            D + E A  H ++ + PG           D +     K GI   GP A+V    G KV 
Sbjct: 60  FDALREFALNHDINLVIPG-----PEQPLVDGITTIFNKVGIPVFGPSAKVAQLEGSKVF 114

Query: 140 ARHLAARANVPTVPGTPGPIETVQEALDFVNEYGYPVIIKA 180
           ++    +  +PT           ++A  ++ E  Y V++KA
Sbjct: 115 SKRFMDKHGIPT--AKYASFTDFEKAKKYLAEVDYNVVLKA 153

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.136    0.396 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 35,040,158
Number of extensions: 1461992
Number of successful extensions: 3840
Number of sequences better than 10.0: 58
Number of HSP's gapped: 3837
Number of HSP's successfully gapped: 85
Length of query: 1159
Length of database: 16,596,109
Length adjustment: 113
Effective length of query: 1046
Effective length of database: 12,684,275
Effective search space: 13267751650
Effective search space used: 13267751650
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)