Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YBR217W (ATG12)1861848701e-121
Scas_686.181801594053e-50
Sklu_752.22001663942e-48
CAGL0K06765g1811453696e-45
Kwal_14.18111961683309e-39
KLLA0C05720g1891823281e-38
AAR160W1891563098e-36
YKL010C (UFD4)148331661.4
Kwal_26.7819266126623.0
KLLA0F10912g128381606.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YBR217W
         (184 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YBR217W (ATG12) [398] chr2 (657789..658349) Protein conjugated t...   339   e-121
Scas_686.18                                                           160   3e-50
Sklu_752.2 YBR217W, Contig c752 791-1393                              156   2e-48
CAGL0K06765g 658479..659024 similar to sp|P38316 Saccharomyces c...   146   6e-45
Kwal_14.1811                                                          131   9e-39
KLLA0C05720g 510735..511304 similar to sp|P38316 Saccharomyces c...   130   1e-38
AAR160W [348] [Homologous to ScYBR217W (APG12) - SH] complement(...   123   8e-36
YKL010C (UFD4) [3246] chr11 complement(421067..425518) Ubiquitin...    30   1.4  
Kwal_26.7819                                                           28   3.0  
KLLA0F10912g 1003827..1007678 weakly similar to sp|P40450 Saccha...    28   6.4  

>YBR217W (ATG12) [398] chr2 (657789..658349) Protein conjugated to
           Apg5p, involved in autophagy and cytoplasm-to-vacuole
           protein targeting pathway [561 bp, 186 aa]
          Length = 186

 Score =  339 bits (870), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 166/184 (90%), Positives = 166/184 (90%)

Query: 1   MSRILXXXXXXXXXXXXXXXXXXGTAMERSRNNQELRSSPHTVQNRLELFSRRLSQLGLA 60
           MSRIL                  GTAMERSRNNQELRSSPHTVQNRLELFSRRLSQLGLA
Sbjct: 1   MSRILESENETESDESSIISTNNGTAMERSRNNQELRSSPHTVQNRLELFSRRLSQLGLA 60

Query: 61  SDISVDQQVEDSSSGTYEQEETIKTNAQTSKQKSHKDEKNIQKIQIKFQPIGSIGQLKPS 120
           SDISVDQQVEDSSSGTYEQEETIKTNAQTSKQKSHKDEKNIQKIQIKFQPIGSIGQLKPS
Sbjct: 61  SDISVDQQVEDSSSGTYEQEETIKTNAQTSKQKSHKDEKNIQKIQIKFQPIGSIGQLKPS 120

Query: 121 VCKISMSQSFAMVILFLKRRLKMDHVYCYINNSFAPSPQQNIGELWMQFKTNDELIVSYC 180
           VCKISMSQSFAMVILFLKRRLKMDHVYCYINNSFAPSPQQNIGELWMQFKTNDELIVSYC
Sbjct: 121 VCKISMSQSFAMVILFLKRRLKMDHVYCYINNSFAPSPQQNIGELWMQFKTNDELIVSYC 180

Query: 181 ASVA 184
           ASVA
Sbjct: 181 ASVA 184

>Scas_686.18
          Length = 180

 Score =  160 bits (405), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 78/159 (49%), Positives = 113/159 (71%), Gaps = 12/159 (7%)

Query: 26  AMERSRNNQELRSSPHTVQNRLELFSRRLSQLGLASDISVDQQVEDSSSGTYEQEETIKT 85
           ++ R +NN E+ S    ++NRLEL+SRRLSQLGL     +  + +++S    E+E+    
Sbjct: 32  SVSRGQNN-EIPS--LALRNRLELYSRRLSQLGLEETPQIPLETDNTSLSQAEKEKI--- 85

Query: 86  NAQTSKQKSHKDEKNIQKIQIKFQPIGSIGQLKPSVCKISMSQSFAMVILFLKRRLKMDH 145
                 +     + N  K++IKFQPIGS+ Q+KP VCKIS +QSF+ +I FL++RL+M++
Sbjct: 86  ------KNEEGPDVNSFKVKIKFQPIGSVPQIKPPVCKISATQSFSSIISFLRKRLRMEN 139

Query: 146 VYCYINNSFAPSPQQNIGELWMQFKTNDELIVSYCASVA 184
           VYCY+N+SFAP+PQQN+G+LW QFK NDELI+SYC +VA
Sbjct: 140 VYCYVNSSFAPTPQQNVGDLWTQFKVNDELIISYCGAVA 178

>Sklu_752.2 YBR217W, Contig c752 791-1393
          Length = 200

 Score =  156 bits (394), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 83/166 (50%), Positives = 109/166 (65%), Gaps = 22/166 (13%)

Query: 41  HTVQNRLELFSRRLSQLGLASDISVDQQVE-----DSSSGTYE------QEETIKTNAQT 89
           + VQ++LEL+S+RLSQL + SD   + ++      D S GT E      QE  + T+   
Sbjct: 33  YMVQSKLELYSKRLSQLRMQSDDEEEDELSRPSQSDRSQGTIEDGPVPRQEIPLTTSLIL 92

Query: 90  SKQKSHKDE-----------KNIQKIQIKFQPIGSIGQLKPSVCKISMSQSFAMVILFLK 138
           +      DE           +  +KIQIKFQPIGSI Q+ P VCKIS +QSF+MVI FL+
Sbjct: 93  NNLPPRTDEVIKEVEQQEESQTPEKIQIKFQPIGSIRQISPQVCKISPTQSFSMVITFLR 152

Query: 139 RRLKMDHVYCYINNSFAPSPQQNIGELWMQFKTNDELIVSYCASVA 184
           R+LK+  VYCYINNSFAP+PQQN+G+LW QFK  +EL+VSYC+SVA
Sbjct: 153 RKLKVSEVYCYINNSFAPTPQQNVGDLWTQFKIQEELVVSYCSSVA 198

>CAGL0K06765g 658479..659024 similar to sp|P38316 Saccharomyces
           cerevisiae YBR217w APG12 Autophagy protein, start by
           similarity
          Length = 181

 Score =  146 bits (369), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 74/145 (51%), Positives = 99/145 (68%), Gaps = 6/145 (4%)

Query: 43  VQNRLELFSRRLSQLGLASDISVDQQVEDSS---SGTYEQEETIKTNAQTSKQKSHKDEK 99
           V+NRLE +SRRLSQL L          E       G+   ++++K + Q+S   SH    
Sbjct: 38  VENRLEQYSRRLSQLALVDTNESSDSSEKEEVFVQGSLRSQQSLKASIQSS---SHGHTG 94

Query: 100 NIQKIQIKFQPIGSIGQLKPSVCKISMSQSFAMVILFLKRRLKMDHVYCYINNSFAPSPQ 159
             QK+ IKFQ IGSI  + PSVC+IS ++ F+++I FL+R+LKM++++CYINNSFAP P 
Sbjct: 95  APQKVMIKFQSIGSITSITPSVCQISTNKPFSVIISFLQRKLKMENIHCYINNSFAPVPS 154

Query: 160 QNIGELWMQFKTNDELIVSYCASVA 184
           QN+G+LW QFK NDELIVSYC SVA
Sbjct: 155 QNVGDLWNQFKVNDELIVSYCGSVA 179

>Kwal_14.1811
          Length = 196

 Score =  131 bits (330), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 69/168 (41%), Positives = 106/168 (63%), Gaps = 23/168 (13%)

Query: 40  PHTVQNRLELFSRRLSQLGLASD---ISVDQQV------EDSSSGTYEQEET----IKTN 86
           P TV++ LE +S RL+ LGL S     S  Q++      +D+ S T E        + T+
Sbjct: 27  PFTVRDELEQYSTRLNLLGLDSGEQITSSTQELRNLESSDDNDSSTVESNRAHTAPVSTS 86

Query: 87  A----------QTSKQKSHKDEKNIQKIQIKFQPIGSIGQLKPSVCKISMSQSFAMVILF 136
           A          Q  K+ + ++++   KI I+F+PIGS+ Q+ P + +IS SQ F++V+ F
Sbjct: 87  AILGHLSVAGDQALKKMAEREQELPTKIPIRFKPIGSVPQVAPQLARISASQPFSVVVTF 146

Query: 137 LKRRLKMDHVYCYINNSFAPSPQQNIGELWMQFKTNDELIVSYCASVA 184
           L +RLK+++VYCYINNSF+P+PQQ++G+LW  F+  DEL+VSYC+ VA
Sbjct: 147 LTKRLKLNNVYCYINNSFSPAPQQSVGDLWGHFRIKDELVVSYCSGVA 194

>KLLA0C05720g 510735..511304 similar to sp|P38316 Saccharomyces
           cerevisiae YBR217w APG12 component of the autophagic
           system singleton, start by similarity
          Length = 189

 Score =  130 bits (328), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 69/182 (37%), Positives = 105/182 (57%), Gaps = 35/182 (19%)

Query: 28  ERSRNNQELRSSPHTVQNRLELFSRRLSQLGLASDISVDQQVEDSSSGTYEQEETIKTNA 87
           E S    EL S   +++ +LE FS +L++L LA          D +S   ++EE++  + 
Sbjct: 16  EVSGRQSELISGDESIKGKLEEFSAKLNELRLA----------DGNSDGGDEEESLSPDT 65

Query: 88  QTSKQKSHKDEKNIQ-------------------------KIQIKFQPIGSIGQLKPSVC 122
           ++ +++S ++ +N+                          K++I+ QPIG+I Q++P VC
Sbjct: 66  KSQREESSENSENVSRSTSRPPLTSSIVSSVEREQLKSQVKVKIRLQPIGAIPQIQPRVC 125

Query: 123 KISMSQSFAMVILFLKRRLKMDHVYCYINNSFAPSPQQNIGELWMQFKTNDELIVSYCAS 182
           +IS  Q F  +  FL +RLK  H++CYINN+FAPS  QNIG+LW QFK NDELIVSYC +
Sbjct: 126 QISAHQQFLALTRFLCKRLKRKHIHCYINNAFAPSLDQNIGDLWTQFKVNDELIVSYCET 185

Query: 183 VA 184
           VA
Sbjct: 186 VA 187

>AAR160W [348] [Homologous to ScYBR217W (APG12) - SH]
           complement(632807..633376) [570 bp, 189 aa]
          Length = 189

 Score =  123 bits (309), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 73/156 (46%), Positives = 100/156 (64%), Gaps = 17/156 (10%)

Query: 42  TVQNRLELFSRRLSQLGLASDISVDQQVEDS-------------SSGTYEQEETIKTNAQ 88
           ++QNRLE +  RLS+L L S  S D +  D              S+  Y           
Sbjct: 36  SLQNRLEEYHERLSRLQLPS--SSDSECSDIEQESLELEQEVPLSTSVYLAGARSAGGLP 93

Query: 89  TSKQKSHKDEKNIQKIQIKFQPIGSIGQLKPSVCKISMSQSFAMVILFLKRRLKMDHVYC 148
           +S + S   E    K+ I+FQPIGS+GQ+ P VC+IS +QSF  V++FL+RRL++D V+C
Sbjct: 94  SSSELSETPEP--PKVAIRFQPIGSVGQVMPQVCRISSAQSFGAVLVFLRRRLRLDTVHC 151

Query: 149 YINNSFAPSPQQNIGELWMQFKTNDELIVSYCASVA 184
           Y++NSFAP+PQQN+G+LW QFK NDEL+VSYCA+VA
Sbjct: 152 YVSNSFAPTPQQNVGQLWEQFKVNDELVVSYCATVA 187

>YKL010C (UFD4) [3246] chr11 complement(421067..425518)
           Ubiquitin-protein ligase (E3 enzyme) functioning in
           ubiquitin fusion degradation pathway [4452 bp, 1483 aa]
          Length = 1483

 Score = 30.0 bits (66), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 20/31 (64%)

Query: 26  AMERSRNNQELRSSPHTVQNRLELFSRRLSQ 56
            +ERS +N E  S+P  + + LE F++RL Q
Sbjct: 101 GLERSHDNNEFGSNPLHLPDILETFAQRLEQ 131

>Kwal_26.7819
          Length = 266

 Score = 28.5 bits (62), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 34/126 (26%), Positives = 64/126 (50%), Gaps = 11/126 (8%)

Query: 27  MERSRNNQELRSSPHTVQNRLELFSRRLSQLGLASDISVDQQVE----DSSSGTYEQEET 82
           +E+ ++++  + S     ++LE   +RLS++    +    +Q+E    D+ S   + E+ 
Sbjct: 138 LEKQQHDENKKISKGDQGDKLEQIEKRLSKMQQEQEDY--EQLEALRKDNLSKMRKAEQL 195

Query: 83  IKTNAQTSKQKSHKDEKNIQK--IQIKFQPIGSIGQLKPSVCKISMSQSFAMVILFLKRR 140
            K   Q S++K+ +DEK+ +K  +Q + Q I    Q  P    ISMS      I  LK++
Sbjct: 196 RKEEQQASREKALRDEKSAEKAFLQFRDQEIPGTAQANPGP--ISMSPVIPQKIR-LKKK 252

Query: 141 LKMDHV 146
           LK + +
Sbjct: 253 LKTNAL 258

>KLLA0F10912g 1003827..1007678 weakly similar to sp|P40450
            Saccharomyces cerevisiae YIL159w BNR1 regulator of
            budding, start by similarity
          Length = 1283

 Score = 27.7 bits (60), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 20/81 (24%), Positives = 39/81 (48%), Gaps = 3/81 (3%)

Query: 50   FSR---RLSQLGLASDISVDQQVEDSSSGTYEQEETIKTNAQTSKQKSHKDEKNIQKIQI 106
            F+R   RLS LG  +  S++ ++ +        +E+ +    +  +K H D+K  +KI  
Sbjct: 1069 FTRDLNRLSDLGKINIESIESEIHEYYEKIMRMKESFERGKLSHTEKHHPDDKFRKKISA 1128

Query: 107  KFQPIGSIGQLKPSVCKISMS 127
            K        +L  + CK++M+
Sbjct: 1129 KLPSAVRKAELLHNQCKLTMN 1149

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.127    0.350 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 5,035,357
Number of extensions: 194068
Number of successful extensions: 1138
Number of sequences better than 10.0: 43
Number of HSP's gapped: 1129
Number of HSP's successfully gapped: 43
Length of query: 184
Length of database: 16,596,109
Length adjustment: 95
Effective length of query: 89
Effective length of database: 13,307,399
Effective search space: 1184358511
Effective search space used: 1184358511
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 58 (26.9 bits)