Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YBR216C (YBP1)67466234920.0
Scas_686.1966365912831e-169
Scas_563.1066665811521e-149
CAGL0K06743g65566411161e-144
Kwal_14.18126846729911e-125
YGL060W (YBP2)6416329721e-123
KLLA0C05698g7026898861e-109
AAR159C6136426831e-80
CAGL0F06985g6306373751e-37
Scas_707.25*212441702.6
Sklu_2115.6107934684.5
Kwal_56.24404491101675.4
Kwal_34.16089133370675.5
YPL058C (PDR12)151142677.0
Sklu_2405.764899667.8
Scas_721.1464699658.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YBR216C
         (662 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YBR216C (YBP1) [397] chr2 complement(655533..657557) Protein wit...  1349   0.0  
Scas_686.19                                                           498   e-169
Scas_563.10                                                           448   e-149
CAGL0K06743g complement(656238..658205) similar to sp|P38315 Sac...   434   e-144
Kwal_14.1812                                                          386   e-125
YGL060W (YBP2) [1919] chr7 (390068..391993) Protein involved in ...   379   e-123
KLLA0C05698g complement(508204..510312) weakly similar to sp|P38...   345   e-109
AAR159C [347] [Homologous to ScYBR216C - SH; ScYGL060W - SH] (63...   267   1e-80
CAGL0F06985g 684832..686724 similar to sp|P53169 Saccharomyces c...   149   1e-37
Scas_707.25*                                                           32   2.6  
Sklu_2115.6 YGL156W, Contig c2115 5286-8525 reverse complement         31   4.5  
Kwal_56.24404                                                          30   5.4  
Kwal_34.16089                                                          30   5.5  
YPL058C (PDR12) [5383] chr16 complement(445837..450372) Protein ...    30   7.0  
Sklu_2405.7 YPL093W, Contig c2405 13698-15644 reverse complement       30   7.8  
Scas_721.14                                                            30   8.5  

>YBR216C (YBP1) [397] chr2 complement(655533..657557) Protein with
           moderate similarity to S. cerevisiae Ygl060p, which is
           involved in stress resistance [2025 bp, 674 aa]
          Length = 674

 Score = 1349 bits (3492), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 662/662 (100%), Positives = 662/662 (100%)

Query: 1   MEPIDDILFEVTDAFKTQKEDLLELVTLIDIYGEQVNQEGSYEEKTRFIETLNTLLEDNP 60
           MEPIDDILFEVTDAFKTQKEDLLELVTLIDIYGEQVNQEGSYEEKTRFIETLNTLLEDNP
Sbjct: 1   MEPIDDILFEVTDAFKTQKEDLLELVTLIDIYGEQVNQEGSYEEKTRFIETLNTLLEDNP 60

Query: 61  STTGEIGWDLPKGLLKFLSKDNVDVNGRLGTNMIVQGVMKCFYAISIQGEPKKCLITGLE 120
           STTGEIGWDLPKGLLKFLSKDNVDVNGRLGTNMIVQGVMKCFYAISIQGEPKKCLITGLE
Sbjct: 61  STTGEIGWDLPKGLLKFLSKDNVDVNGRLGTNMIVQGVMKCFYAISIQGEPKKCLITGLE 120

Query: 121 LLSSLCSKDFSKSDQQNKEDFVDKKANTLPPEGVIENSSNRKDFPSYGESKSSNEFFLKL 180
           LLSSLCSKDFSKSDQQNKEDFVDKKANTLPPEGVIENSSNRKDFPSYGESKSSNEFFLKL
Sbjct: 121 LLSSLCSKDFSKSDQQNKEDFVDKKANTLPPEGVIENSSNRKDFPSYGESKSSNEFFLKL 180

Query: 181 KSYILFEFIGASLKRISTLFPSKYLGAAVSTIEKFVYSHADTFEDALFLLRRVYTFCRNY 240
           KSYILFEFIGASLKRISTLFPSKYLGAAVSTIEKFVYSHADTFEDALFLLRRVYTFCRNY
Sbjct: 181 KSYILFEFIGASLKRISTLFPSKYLGAAVSTIEKFVYSHADTFEDALFLLRRVYTFCRNY 240

Query: 241 IPPDPPKDIQLNEDFTREMFDKVVEEESELQVRLLRRLCTFGISTPIKTVTTNADVKYYC 300
           IPPDPPKDIQLNEDFTREMFDKVVEEESELQVRLLRRLCTFGISTPIKTVTTNADVKYYC
Sbjct: 241 IPPDPPKDIQLNEDFTREMFDKVVEEESELQVRLLRRLCTFGISTPIKTVTTNADVKYYC 300

Query: 301 ALNQQKFELSAYYTEYLELFCRYYQMAFSLDVDIEGEFQNVIKECRIIYKSVPQEISAVN 360
           ALNQQKFELSAYYTEYLELFCRYYQMAFSLDVDIEGEFQNVIKECRIIYKSVPQEISAVN
Sbjct: 301 ALNQQKFELSAYYTEYLELFCRYYQMAFSLDVDIEGEFQNVIKECRIIYKSVPQEISAVN 360

Query: 361 DEAKLVLERMVYKLAYTFEVQKAAKEKNVGLDYNGVILFSGIHYLETNQHLVKEMNITDA 420
           DEAKLVLERMVYKLAYTFEVQKAAKEKNVGLDYNGVILFSGIHYLETNQHLVKEMNITDA
Sbjct: 361 DEAKLVLERMVYKLAYTFEVQKAAKEKNVGLDYNGVILFSGIHYLETNQHLVKEMNITDA 420

Query: 421 IYLYLRFTTPSLYSKVYYNVAVESVSRYWLWYAITTEPLEDVKKELKNLSVFVTKTLLHV 480
           IYLYLRFTTPSLYSKVYYNVAVESVSRYWLWYAITTEPLEDVKKELKNLSVFVTKTLLHV
Sbjct: 421 IYLYLRFTTPSLYSKVYYNVAVESVSRYWLWYAITTEPLEDVKKELKNLSVFVTKTLLHV 480

Query: 481 LLQKNCIQVNQQLRMITFTLLTRLLCLIPEKVAFEFILDVLKTSPLPLAKTSVLCVFKDL 540
           LLQKNCIQVNQQLRMITFTLLTRLLCLIPEKVAFEFILDVLKTSPLPLAKTSVLCVFKDL
Sbjct: 481 LLQKNCIQVNQQLRMITFTLLTRLLCLIPEKVAFEFILDVLKTSPLPLAKTSVLCVFKDL 540

Query: 541 SRRRISTKDNDSETDLIVEKLSKLKVNDSNKAQQSNIRHYIQLDSSKMKAVHDCCLQTIQ 600
           SRRRISTKDNDSETDLIVEKLSKLKVNDSNKAQQSNIRHYIQLDSSKMKAVHDCCLQTIQ
Sbjct: 541 SRRRISTKDNDSETDLIVEKLSKLKVNDSNKAQQSNIRHYIQLDSSKMKAVHDCCLQTIQ 600

Query: 601 DSFTADAKKSDILLLLTYLNIFIVLKKTWDEDLLKIVCSKIDSNLKSVEPDKLPKYKEIV 660
           DSFTADAKKSDILLLLTYLNIFIVLKKTWDEDLLKIVCSKIDSNLKSVEPDKLPKYKEIV
Sbjct: 601 DSFTADAKKSDILLLLTYLNIFIVLKKTWDEDLLKIVCSKIDSNLKSVEPDKLPKYKEIV 660

Query: 661 DK 662
           DK
Sbjct: 661 DK 662

>Scas_686.19
          Length = 663

 Score =  498 bits (1283), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 253/659 (38%), Positives = 404/659 (61%), Gaps = 14/659 (2%)

Query: 1   MEPIDDILFEVTDAFKTQKEDLLELVTLIDIYGEQVNQEGSYEEKTRFIETLNTLLEDNP 60
           M  ++DI+ ++ +AF    +D + L  ++++Y +Q+N +G  ++K +F+  L  L++D+P
Sbjct: 1   MANVNDIIADLVNAFDEYSDDSVSLTAILEMYIDQINMDGEIDDKEQFLTALLGLMKDHP 60

Query: 61  STTGEIGWDLPKGLLKFLSKDNVDVNGRLGTNMIVQGVMKCFYAISIQGEPKKCLITGLE 120
                I WD PK +LKFL+  NVDV  RLG ++I+  VMKCF  I+   EPK+CL+TG E
Sbjct: 61  DVVARISWDFPKEILKFLTTANVDVTKRLGYSVIISLVMKCFNEIAFSAEPKECLLTGCE 120

Query: 121 LLSSLCSKDFSKSDQQNKEDFVDKKANTLPPEGVIENSSNRKDFPSYGESKSSNEFFLKL 180
           LLS+L  ++ +   +  + D  + K  T           +  +   Y   ++  +FF+ +
Sbjct: 121 LLSNLSLENENIELEMEQGDHTNSKGQT---------HYSSAEIGKYHAERTPADFFVSV 171

Query: 181 KSYILFEFIGASLKRISTLFPSKYLGAAVSTIEKFVYSHADTFEDALFLLRRVYTFCRNY 240
           K YILFE IG +L+RI TL PSKYLG A S + +F+ ++ D   D   ++RR+++FCRNY
Sbjct: 172 KMYILFELIGTTLQRIPTLNPSKYLGLATSAMIRFIKANCDGINDVRIVMRRIFSFCRNY 231

Query: 241 IPPDPPKDIQLNEDFTREMFDKVVEEESELQVRLLRRLCTFGISTPIKTVTTNADVKYYC 300
           +PPD    +  +   T+E   ++ E E   Q R+LR LCT G+ T +K +    DVKY+ 
Sbjct: 232 VPPDTSLCVIKDRSLTKEDLIRIEERELASQRRILRNLCTIGLETCLKAINGRTDVKYFY 291

Query: 301 ALNQQKFELSAYYTEYLELFCRYYQMAFSLDVDIEGEFQNVIKECRIIYKSVPQEISAVN 360
            L+  +F L+ +Y +  E+  R++ +A S D+DI+ EF   +K    IYK +P++ S  +
Sbjct: 292 FLSNTEFTLAGFYKDISEVNSRFFNLALSFDIDIKKEFLECVKTSHDIYKGLPKDSSIGS 351

Query: 361 DEAKLVLERMVYKLAYTFEVQKAAKEKNVGLDYNGVILFSGIHYLETNQHLVKEMNITDA 420
           +EAK ++++ VYKLAY++E+Q+ AK KNV LD  G+++ SG++Y+ET++HL  ++ + DA
Sbjct: 352 EEAKKLIQQTVYKLAYSYELQRIAKHKNVQLDPLGIVILSGVYYMETDKHLYPQITVKDA 411

Query: 421 IYLYLRFTTPSLYSKVYYNVAVESVSRYWLWYAITTEPLEDVKKELKNLSVFVTKTLLHV 480
           IYLYLR TTPSL+SK Y N +VESV RYWLW +IT      ++KEL+ L  ++  T L  
Sbjct: 412 IYLYLRCTTPSLFSKFYENFSVESVVRYWLWVSITNHSSAVLRKELEELPSYLLTTFLQT 471

Query: 481 LLQKNCIQVNQQLRMITFTLLTRLLCLIPEKVAFEFILDVLKTSPLPLAKTSVLCVFKDL 540
            L KNC Q N+++RM++FTL TR+LCLIPE V F+FIL+ L  S  P  K+SVL + KDL
Sbjct: 472 FLSKNCKQPNEEIRMVSFTLFTRILCLIPEAVTFKFILETLTASSYPHVKSSVLGILKDL 531

Query: 541 SRRRISTKD---NDSETDLIVEKLSKLKVND-SNKAQQSNIRHYIQLDSSKMKAVHDCCL 596
             +R S +D   ND++ + +   L+KLK+N   N+      + Y+++   +M  +H   L
Sbjct: 532 MSKRRSCQDLCANDND-EALSNSLAKLKINSKKNEGAGVESQVYVEVSEERMNEIHHLAL 590

Query: 597 QTIQDSFTADAKKSDILLLLTYLNIFIVLKKTWDEDLLKIVCSKIDSNLKSVEPDKLPK 655
           + I         +++I+L+L YL  F  L   WD+ LL+ +  +I+  +++   + L K
Sbjct: 591 RAINSLEEEKTTRANIILILNYLEFFNGLHSEWDKSLLQSIHDEIEDKVENCSDEDLKK 649

>Scas_563.10
          Length = 666

 Score =  448 bits (1152), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 256/658 (38%), Positives = 397/658 (60%), Gaps = 27/658 (4%)

Query: 5   DDILFEVTDAFKTQKEDLLELVTLIDIYGEQVNQEGSYEEKTRFIETLNTLLEDNPSTTG 64
           + I  ++T AF+ QKED + LVT+ID+YG+++N++GS +EK +++E L +LL DNP    
Sbjct: 10  ESIYAKLTRAFEEQKEDPVTLVTIIDMYGQEINEDGSIDEKNKYLEHLCSLLNDNPHILR 69

Query: 65  EIGWDLPKGLLKFLSKDNVDVNGRLGTNMIVQGVMKCFYAISIQGEPKKCLITGLELLSS 124
           EI WDLPKGLL+FLS +N+DV+ RL  + IV  VMKCF  I+I G PK+CL+   ELLS 
Sbjct: 70  EISWDLPKGLLEFLSLENIDVHKRLADSSIVSNVMKCFNEIAINGNPKECLLAACELLSE 129

Query: 125 LCSKDFSKSDQQNKEDFVDKKANTLPPEGVIENSSNRKDFPSYGESKSSNEFFLKLKSYI 184
           L  +   +++ + +E   D K           NSS+      Y E +   EF   LK Y 
Sbjct: 130 LTVEPVMENETEEEEGGKDNKKTDGDETPTDLNSSD------YIE-RDLTEFIPSLKVYA 182

Query: 185 LFEFIGASLKRISTLFPSKYLGAAVSTIEKFVYSHADTFEDALFLLRRVYTFCRNYIPPD 244
           +F+ + ++L RI TL+PSK+L  A+S I KF+ ++ +   D  FLLRR++ FC NY    
Sbjct: 183 IFQLLNSTLGRIITLYPSKFLNMAISAIMKFMATNINDIADVTFLLRRIHEFCNNYDVHA 242

Query: 245 PPKDIQLNEDFTREMFDKVVEEESELQVRLLRRLCTFGISTPIKTVTTNADVKYYCALNQ 304
           P + +    D   E   K+ ++E +LQ +L++ L    +S  +K   T  DVKY+ +L  
Sbjct: 243 PDRKLIDGSDLNDEEIKKLTDDEFDLQNKLIKELFCSALSICLKNQPTTFDVKYFESLTH 302

Query: 305 QKFELSAYY----TEYLELFCRYYQMAFSLDVDIEGEFQNVIKECRIIYKSVPQEISAVN 360
           QKFE S +Y    T+YL L  +Y        +DI+ EF   ++E R IY+S+P +I   +
Sbjct: 303 QKFEESEHYAVIRTQYLGLVNKY-------KIDIKEEFLQCLQESRQIYESLPSDIDESD 355

Query: 361 DEAKLVLERMVYKLAYTFEVQKAAKEKNVGLDYNGVILFSGIHYLETNQHLVKEMNITDA 420
           ++ K  L +++Y+L+Y +++QK + +  + +D+N +IL SG +Y ET  HL+ +++I DA
Sbjct: 356 EKKKSALNQVIYQLSYRYQMQKISNQDTLEIDFNSIILLSGSYYAETGLHLLPQISIQDA 415

Query: 421 IYLYLRFTTPSLYSKVYYNVAVESVSRYWLWYAITTEPLEDVKKELKNLSVFVTKTLLHV 480
           +YLYLR +T SLYS  + N AV+ V+RYWLW AIT  P++++++ L  +        L +
Sbjct: 416 VYLYLRCSTISLYSDTFSNEAVKGVTRYWLWVAITQSPIKEIEQNLLKIPSHFNTVFLQM 475

Query: 481 LLQKNCIQVNQQLRMITFTLLTRLLCLIPEKVAFEFILDVLKTSPLPLAKTSVLCVFKDL 540
           LL  NC + + ++RM TFTLLTR+LCL+PE ++F+FILD L T P   AK+SVL + KDL
Sbjct: 476 LLLNNCNEKDGKIRMATFTLLTRILCLMPEDLSFQFILDTLLTCPYNSAKSSVLAILKDL 535

Query: 541 SRRRISTKDNDSETDLIVEKLSKLKV-NDSNKAQQSNIRHYIQLDSSKMKAVHDCCLQTI 599
                  KDN     L  E+LS L + ++ NK      R YI ++  +M ++H      I
Sbjct: 536 -----MLKDNQISKPL-EEELSTLDISSEKNKGPTLPPRPYILINEDRMASLHSVASMCI 589

Query: 600 QDSFTAD--AKKSDILLLLTYLNIFIVLKKTWDEDLLKIVCSKIDSNLKSVEPDKLPK 655
            +    D   K++++ LLL Y+N FI L+  W+ +LL+I+  ++D+ L  VE +  P+
Sbjct: 590 SNLKLLDNPNKRTELSLLLNYMNFFISLRYKWNVNLLQIIHDEVDAKLAGVEDEAAPE 647

>CAGL0K06743g complement(656238..658205) similar to sp|P38315
           Saccharomyces cerevisiae YBR216c, hypothetical start
          Length = 655

 Score =  434 bits (1116), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 243/664 (36%), Positives = 391/664 (58%), Gaps = 25/664 (3%)

Query: 4   IDDILFEVTDAFKTQ----KEDLLELVTLIDIYGEQVNQEGSYEEKTRFIETLNTLLEDN 59
           + D   EV DA K      KED L LVT+ID   E+V++    +EK +F+E L  LLE +
Sbjct: 1   MSDAFEEVCDALKASFTDDKEDSLTLVTMIDTLSEEVDEGFEVKEKEQFLELLLNLLEAD 60

Query: 60  PSTTGEIGWDLPKGLLKFLSKDNVDVNGRLGTNMIVQGVMKCFYAISIQGEPKKCLITGL 119
                 +GWDLP+ LL+F +  N+  + RL    +V   M  F  +++  +P++CL+T L
Sbjct: 61  TELVSAVGWDLPRTLLRFCNAKNIKNSDRLRKCKVVTICMAIFNLLALHAKPQECLVTTL 120

Query: 120 ELLSSLCSKDFSKSDQQNKEDFVDKKANTLPPEG-VIENSSNRKDFPSYGESKSSNEFFL 178
           ELLS L  K+  +   Q  ED  D   NT   +   +E+    +D P         E   
Sbjct: 121 ELLSELNFKNIVEECHQLSEDGSDN--NTAEEDNDAVEDYMKDRDQP---------EIIF 169

Query: 179 KLKSYILFEFIGASLKRISTLFPSKYLGAAVSTIEKFVYSHADTFEDALFLLRRVYTFCR 238
            +KSY LFE  G+ ++R++TL PSKYL  AV+ I K+V ++ +  ED  F+LRRV+ FCR
Sbjct: 170 GVKSYALFELAGSLIRRVATLHPSKYLEEAVTAIRKYVTNNTEVVEDVKFILRRVFAFCR 229

Query: 239 NYIPPDPPKDIQLNEDFTREMFDKVVEEESELQVRLLRRLCTFGISTPIKTVTTNADVKY 298
            YIPP+PP+ + ++     E +D+++  E ELQVRLLR LCTF ++  +K +    +V Y
Sbjct: 230 GYIPPEPPRQLIVDLKMNHEEYDEIMNSEIELQVRLLRNLCTFSVAYCVKFLNDKTEVVY 289

Query: 299 YCALNQQKFELSAYYTEYLELFCRYYQMAFSLDVDIEGEFQNVIKECRIIYKSVPQEISA 358
           +  L  +  +L  +Y    ++  RYYQ+AFS D+D+  EF ++++E R IY+ V + I+ 
Sbjct: 290 FHKLINKDLQLPEFYRSVHDIISRYYQIAFSFDIDLNDEFNDILRETRGIYEDVIKRINE 349

Query: 359 VNDEAKLVLERMVYKLAYTFEVQKAAKEKNVGLDYNGVILFSGIHYLETNQHLVKEMNIT 418
            N+  K     ++ K  Y +EVQK A+EK +  D  G+IL SG +Y+E   HL+ +++I 
Sbjct: 350 TNNTDKNAKSDILLKAGYYYEVQKTAREKEINPDTKGIILLSGFNYIENGDHLI-DIDIA 408

Query: 419 DAIYLYLRFTTPSLYSKVYYNVAVESVSRYWLWYAITTEPLEDVKKELKNLSVFVTKTLL 478
           DA+YLYLRF + SL+S   +NV +E V+RYW+W A+TT     +K++L  LS  V  ++L
Sbjct: 409 DALYLYLRFASESLFSPTCHNVTIEGVARYWIWAALTTTDNNILKEKLAELSPLVLHSVL 468

Query: 479 HVLLQKNCIQVNQQLRMITFTLLTRLLCLIPEKVAFEFILDVLKTSPLPLAKTSVLCVFK 538
           ++LL KNC QVN+++RMITFTL+TR+LCL+PE  ++EF++D L    +   K+ VL + +
Sbjct: 469 NLLLVKNCHQVNEEIRMITFTLITRILCLLPENCSYEFLMDELDNCAVVFGKSCVLGILR 528

Query: 539 DLS-RRRISTKDNDSETDLIVEKLSKLKVNDSNKAQQSNIRHYIQLDSSKMKAVHDCCLQ 597
           DL  +   S   N+++T+ + E +++LK+N+  +A+++    +I LD  +   + D  ++
Sbjct: 529 DLVIKVDHSVSSNNTDTEDLSESMAQLKINNEKRAKKT----FITLDPKRAGEIEDLAIK 584

Query: 598 TIQDSFTADAKKSDILLLLTYLNIFIVLKKTWDEDLLKIVCSKIDSNLKSVEPDKLPKYK 657
           T++++     KK  ILL+L Y+  F      W++  L    + + +N    +   LP+  
Sbjct: 585 TLKET-KKSMKKDYILLVLNYIKFFSTFAHKWNKSKLNEFTTLVATNFS--DSKMLPEIN 641

Query: 658 EIVD 661
            I+D
Sbjct: 642 AIID 645

>Kwal_14.1812
          Length = 684

 Score =  386 bits (991), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 231/672 (34%), Positives = 370/672 (55%), Gaps = 37/672 (5%)

Query: 1   MEPIDDILFEVTDAFKTQKEDLLELVTLIDIYGEQVNQEGSYEEKTRFIETLNTLLEDNP 60
           M+    +L ++  AF   KED L L+T+ID+Y  +VN++   EEK +F+E L   ++D+ 
Sbjct: 1   MKSSSSLLDKLNHAFDECKEDPLSLITIIDLYASEVNKKEGGEEKAQFLEILLKRIQDDH 60

Query: 61  STTGEIGWDLPKGLLKFLSKDNVDVNGRLGTNMIVQGVMKCFYAISIQGEPKKCLITGLE 120
               ++GWDLPK L++F++  NVD+N RL  N +V   +KCF  I++ G  K+C +TG E
Sbjct: 61  HLIQQVGWDLPKVLIRFINTRNVDLNTRLLYNGVVATSLKCFNEIALHGNAKECFLTGCE 120

Query: 121 LLSSLCSKDFSKSDQQNKEDF-----VDKKANTLPPE---GVIENSSNRKDFPSYGESKS 172
           LL  L      K  ++++ED      V+ +A    PE   G   N+           S+ 
Sbjct: 121 LLGELELHPSEKVQEEHEEDATEAVEVEAQAIKSTPEEANGPKMNAQTSSRTVVRPLSRD 180

Query: 173 SNEFFLKLKSYILFEFIGASLKRISTLFPSKYLGAAVSTIEKFVYSHADTFEDALFLLRR 232
             E  L++K ++L E I ++L+RI T +PS++L  AVS+I  FV S++   +D  F+LRR
Sbjct: 181 PEELVLEVKLHMLLELINSTLRRIRTCYPSRFLAMAVSSIFSFVRSNSIDIDDTTFVLRR 240

Query: 233 VYTFCRNYIPPDPPKDIQLNEDFTREMFDKVVEEESELQVRLLRRLCTFGISTPIKTVTT 292
           VYTF RN+IPP    + +  +D + E   KV ++E  LQ +LLR L TF I   ++    
Sbjct: 241 VYTFARNFIPPQ--SNAEAYKDMSTEEILKVRDDEEALQRKLLRCLLTFSIGQLVRPRVL 298

Query: 293 NADVKYYCALNQQKFELSAYYTEYLE---------LFCRYYQMAFSLDVDIEGEF-QNVI 342
           N   +Y+       F L   YT   E         +  RYYQ+A+S D+D++ EF +  +
Sbjct: 299 NIATEYF-------FRLKNKYTTDFEYEMRVNLKHILSRYYQLAYSFDIDVKEEFLKQCV 351

Query: 343 KECRIIYKSVPQEISAVNDEAKLVLERMVYKLAYTFEVQKAAKEKNVGLDYNGVILFSGI 402
           K+   IY+S+P +   +ND A+  + ++VY+L+Y++ +Q++  EKN+ LD  G+++ +  
Sbjct: 352 KDSSAIYQSLPNDSELINDAARNGITQLVYQLSYSYGLQRSINEKNLSLDPAGLLVLATQ 411

Query: 403 HYLETNQHLVKEMNITDAIYLYLRFTTPSLYSKVYYNVAVESVSRYWLWYAITTEPLEDV 462
           HYLET Q L   +    AIY+YLRF TP +Y+    N        +WLW A+T    +D 
Sbjct: 412 HYLETGQILDSTIRADCAIYMYLRFVTPEMYNPAMKNTYACDCCNFWLWVAVTKSSCKDS 471

Query: 463 KKELKNLSVFVTKTLLHVLLQKNCIQVNQQLRMITFTLLTRLLCLIPEKVAFEFILDVLK 522
           K+ L+N+  +++ T L +LL K+  +  +  RM++FTLLTRLLCL+PE+  FEF  D L 
Sbjct: 472 KEALQNIPSYLSLTFLQILLLKSFNETLEHARMVSFTLLTRLLCLMPEETTFEFAKDTLL 531

Query: 523 TSPLPLAKTSVLCVFKDLSRRRISTKDNDSETDLIVEKLSKLKVNDSNKAQQS---NIRH 579
           + P    K  +L + KDL         N      +  +LS+LK+++  K+        R 
Sbjct: 532 SCPFIDLKCCMLGILKDLMLNSKIPVSN------LATELSELKLSEDEKSHSKPPLPSRP 585

Query: 580 YIQLDSSKMKAVHDCCLQTIQDSFTADAKKSDILLLLTYLNIFIVLKKTWDEDLLKIVCS 639
           +I ++  +M  +H   L + +D+   +A K ++ L LTY+N F+ L+  WD+ LL  V  
Sbjct: 586 FIMINEDRMATIHSLALLSFEDTI-ENADKGNLRLSLTYINFFVGLRLKWDKHLLAEVEG 644

Query: 640 KIDSNLKSVEPD 651
                + SV  D
Sbjct: 645 AASKIVNSVTKD 656

>YGL060W (YBP2) [1919] chr7 (390068..391993) Protein involved in
           stress resistance [1926 bp, 641 aa]
          Length = 641

 Score =  379 bits (972), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 226/632 (35%), Positives = 343/632 (54%), Gaps = 33/632 (5%)

Query: 31  IYGEQVNQEGSYEEKTRFIETLNTLLEDNPSTTGEIGWDLPKGLLKFLSKDNVDVNGRLG 90
           +Y EQVN   S +EK R+++ L  +L+DNP T  EIGWDLPKGLL+F S+ N++VN  L 
Sbjct: 1   MYNEQVNSGKSIKEKERYLDALLKILKDNPVTLKEIGWDLPKGLLQFFSRKNINVNIHLV 60

Query: 91  TNMIVQGVMKCFYAISIQGEPKKCLITGLELLSSL--CSKDFSKSDQQNKEDFVDKKANT 148
            + +V  VM+CF  ++I G PK+CL+T  EL+S+L     +   SD++N ED  D   N 
Sbjct: 61  FSPLVSSVMECFNELAINGNPKECLLTACELVSTLHIVLTETGDSDEEN-EDLNDSNRN- 118

Query: 149 LPPEGVIENSSNRKD-----FPSYGE--SKSSNEFFLKLKSYILFEFIGASLKRISTLFP 201
                   ++SN  D      P  G   +K++ EF   LK Y+LFEF+   LKR+ TL+P
Sbjct: 119 --------DASNITDELSVITPEIGHYMAKNTVEFIPNLKIYVLFEFMSLLLKRVDTLYP 170

Query: 202 SKYLGAAVSTIEKFVYSHADTFEDALFLLRRVYTFCRNYIPPDPPKDIQLNEDFTREMFD 261
           SK+L    S I K+V ++    +D  F+LR VY FC NY P  P     L +  +    +
Sbjct: 171 SKFLAMVTSAIIKYVTTNVQAMDDPHFILRIVYNFCTNYSPAQP--SASLTDGISTNDLE 228

Query: 262 KVVEEESELQVRLLRRLCTFGISTPIKTVTTNADVKYYCALNQQKFELSAYYTEYLELFC 321
           K+ ++ES LQ +LL  L  F IS  +K    N D  Y+  L  +K + +      L++  
Sbjct: 229 KIHDDESALQKKLLANLSVFVISNCLKNHPGNIDKIYFKTLMHKKTDENEIDASVLQICH 288

Query: 322 RYYQMAFSLDVDIEGEFQNVIKECRIIYKSVPQEISAVNDEAKLVLERMVYKLAYTFEVQ 381
           +YY+   SLDV ++   +  + E R IY S+    +A   E K  + ++VY+++Y ++++
Sbjct: 289 QYYEYVTSLDVHMKELLEKCLVESRSIYNSLLMNPAASTPEFKEEINQLVYEVSYAYQIK 348

Query: 382 KAAKEKNVGLDYNGVILFSGIHYLETNQHLVKEMNITDAIYLYLRFTTPSLYSKVYYNVA 441
           K A EKN+ LD  GV++ S IHY +   HL+ +++I  AIYLYLR TT SL+S++Y N  
Sbjct: 349 KLADEKNLELDQYGVVILSAIHYSKNGTHLLPQIDIQSAIYLYLRCTTASLFSEIYENKF 408

Query: 442 VESVSRYWLWYAITTEPLEDVKKELKNLSVFVTKTLLHVLLQKNCIQVNQQLRMITFTLL 501
           +ES  RYWLW + T    E +K  L+ L   +T   L +LL K C + N   ++   TLL
Sbjct: 409 LESSVRYWLWVSTTETSTEKIKCALQELPGHITTAFLQMLLMKTCNESNNDTKLTEITLL 468

Query: 502 TRLLCLIPEKVAFEFILDVLKTSPLPLAKTSVLCVFKDLSRRRISTKDNDSETDLIVEKL 561
            RLL L+PE  +F FI + L   P   AK +VL + +D+  R     + D    LI ++ 
Sbjct: 469 RRLLYLMPESTSFTFIFETLLHCPYITAKIAVLDILRDMMIRSPEAANRDETVGLIEQQ- 527

Query: 562 SKLKVNDSNKAQQSNI------RHYIQLDSSKMKAVHDCCLQTIQDSFTADAKKSDILLL 615
                N  N A    I      R YI ++  +M ++H   L     +      + D+LL+
Sbjct: 528 -----NPGNTANSVPIMPTLPPRPYITINEDRMASIHSIALICFSAAKQKKRTQGDLLLV 582

Query: 616 LTYLNIFIVLKKTWDEDLLKIVCSKIDSNLKS 647
           LTY+  F+ L+  WD  LL ++  +I  + + 
Sbjct: 583 LTYMKFFVSLRNKWDLGLLTLINKEISESFQG 614

>KLLA0C05698g complement(508204..510312) weakly similar to sp|P38315
           Saccharomyces cerevisiae YBR216c, start by similarity
          Length = 702

 Score =  345 bits (886), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 222/689 (32%), Positives = 364/689 (52%), Gaps = 63/689 (9%)

Query: 14  AFKTQKEDLLELVTLIDIYGEQVNQEGSYEEKTRFIETLNTLLEDNPSTTGEIGWDLPKG 73
           AF  +K D++ LVT++D+Y E+VN +GS E+K  ++  + +LL+ N     EIGWDLPK 
Sbjct: 18  AFVEEKSDIITLVTILDLYSEEVNFKGSLEQKYEYLSEVLSLLQQNKDVVYEIGWDLPKI 77

Query: 74  LLKFLSKDNVDVNGRLGTNMIVQGVMKCFYAISIQGEPKKCLITGLELLSSL-------- 125
           L+KF+   N +  G   +   +  +MKCF  +++ G PK+C   G EL+SSL        
Sbjct: 78  LIKFIHWGNNNHLGADRSKKFLTVIMKCFNEVALFGNPKECFFAGCELMSSLRINDESLV 137

Query: 126 ---------------------CSKDFSKSDQQNKEDFVDKKANTLPPEGVIENSSNRKD- 163
                                 ++D   SD+  +E+  +   ++  P+   E+  + K+ 
Sbjct: 138 RFIVEEEPVMDPENEDSGDETYTEDEGSSDKTEEEEEKNAVKDSPTPKSANESIPDLKEG 197

Query: 164 FPSYGESKSSNEFFLKLKSYILFEFIGASLKRISTLFPSKYLGAAVSTIEKFVYSHADTF 223
           +  YG  +   E   +L+ Y + E +G++LKRI TL PSK+L  AV    +F   + +  
Sbjct: 198 YAFYG--RLPQEVITELRFYSIIELMGSTLKRIVTLHPSKFLSEAVEAFSRFNLQNNEDV 255

Query: 224 EDALFLLRRVYTFCRNYIPPDPPKDIQLNEDFTREMFDKVVEEESELQVRLLRRLCTFGI 283
           +D LF+LRR+Y+F R YIPP PP D   ++  + E  +++   E  LQ +LL  + T  +
Sbjct: 256 DDCLFILRRLYSFIRGYIPPSPPPDA--DKQVSAEELEEIKVSEEVLQRKLLCNILTSAL 313

Query: 284 STPIKTVTTNADVKYYCALNQQKFELSAYYTEYL----ELFCRYYQMAFSLDVDIEGEFQ 339
              +K  T  + + Y+  L  Q     +  +EYL    ++  RYYQ+A S D+D+  EF+
Sbjct: 314 HQLLKARTCISLLNYHSHL--QGIPTLSTSSEYLGQLTDILSRYYQLATSFDIDVSAEFK 371

Query: 340 NV-IKECRIIYKSVPQEISAVNDEAKLVLERMVYKLAYTFEVQKAAKEKNVGLDYNGVIL 398
            + + E   IY+S+P++    +DE    +   VY+LAYT+EV+K A  K + LD  G+++
Sbjct: 372 RLCVDESVRIYRSLPKDSEIKSDEELKEITNFVYQLAYTYEVEKIANVKEILLDPAGILI 431

Query: 399 ---FSGIHYLETNQHLVKEMNITDAIYLYLRFTTPSLYSKVYYNVAVESVSRYWLWYAIT 455
              FS   +L  +     ++ + +AIY+YLRF TPS++S ++ N +   ++R W+ +A+T
Sbjct: 432 LRSFSNEDFLPPSD---AKITLQEAIYMYLRFVTPSMFSALFENRSSHDLARTWILFALT 488

Query: 456 TEPLEDVKKELKNLSVFVTKTLLHVLLQKNCIQVNQQLRMITFTLLTRLLCLIPEKVAFE 515
                D+   LK+L  ++    L   L + C+Q+N  LR   F++LTR+LCL+PE  AF 
Sbjct: 489 NNSTHDLMDSLKDLPSYIITVYLQTELIRACLQINDNLRRTQFSILTRILCLLPEDFAFN 548

Query: 516 FILDVLKTSPLPLAKTSVLCVFKDLSR--RRISTKDNDSETDLIVEKLSKLKVNDSNKAQ 573
           FI D L + P   AK   L + KD+ +  R++  K   S+ D + + + KLK+ +S    
Sbjct: 549 FIRDTLLSCPYEQAKCCALAILKDMMQHERKVPQK---SDEDDLAKDMEKLKIKNSPPPL 605

Query: 574 QSNIRHYIQLDSSKMKAVHDCCLQTIQDSFTADAKKSDILLLLTYLNIFIVLKKTWDEDL 633
            S  R Y+ L+  ++  +H   L  I DS  AD +   +  LLTYLN        WD   
Sbjct: 606 PS--RAYMLLNDDRIATLHSITLLAI-DSCAADPESKKVKTLLTYLNFLNAFLTKWDSVF 662

Query: 634 LKIVCSKIDSNLKSVEPDKLPKYKEIVDK 662
           LK +C  ++        DKL K +++ DK
Sbjct: 663 LKEICDAVN--------DKLIKNEKVGDK 683

>AAR159C [347] [Homologous to ScYBR216C - SH; ScYGL060W - SH]
           (630860..632701) [1842 bp, 613 aa]
          Length = 613

 Score =  267 bits (683), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 180/642 (28%), Positives = 318/642 (49%), Gaps = 73/642 (11%)

Query: 15  FKTQKEDLLELVTLIDIYGEQVNQEGSYEEKTRFIETLNTLLEDNPSTTGEIGWDLPKGL 74
           F  Q  D++ L   I++  EQ    G+      F+E L   L ++P+  G++GWD+PK L
Sbjct: 16  FAEQAGDVISLAAGIELCAEQALASGNAGRVASFLEALWEQLREHPALVGDLGWDIPKVL 75

Query: 75  LKFLSKDNVDVNGRLGTNMIVQGVMKCFYAISIQGEPKKCLITGLELLSSLCSKDFSKSD 134
           ++ +  DN ++N  LG +M+ + ++ CF  +  +G  ++C +TG + L+ L      + D
Sbjct: 76  VRCIRADNFNLNEGLGDDMVWRLLVGCFREVGREGNARECFLTGCQQLAELSVAAEEEED 135

Query: 135 QQNKEDFVDKKANTLPPEGVIENSSNRKDFPSYGESKSSNEFFLKLKSYILFEFIGASLK 194
              +E+                                       LK ++L EF+  +L 
Sbjct: 136 ADLREEM------------------------------------FALKFHMLMEFVTTTLG 159

Query: 195 RISTLFPSKYLGAAVSTIEKFVYSHADTFEDALFLLRRVYTFCRNYIPPDPPKDIQLNED 254
           R +T +PS++LG  +  + K V  +AD   D   LLRR+YTFCR+Y  P     +  +ED
Sbjct: 160 RTTTAYPSRFLGEIIGVLVKLVERNADELCDVHLLLRRLYTFCRDYTAP-----VSSSED 214

Query: 255 FTREMFDKVVEEESELQVRLLRRLCTFGISTPIKTVTTNADVKYYCALNQQKFELSAYYT 314
                 +++  +E  LQ  L R    + ++  ++  +     +Y+   +  +F+L   + 
Sbjct: 215 ------EELRAQEDYLQRTLFRSFLAYALAQLLRRQSVRWAPEYFAKSHGLEFKLHDDHV 268

Query: 315 EYLELFCRYYQMAFSLDVDIEGEFQNVIKECRIIYKSVPQEISAVNDEAKLVLERMVYKL 374
           E  E   RY+Q+A S D+DIEG FQ   K+C +  + V   +SA  D+A      ++Y+L
Sbjct: 269 ELRETLGRYFQLAHSFDIDIEGAFQ---KQCILESRDVYACVSADADKADGA--EVIYQL 323

Query: 375 AYTFEVQKAAKEKNVGLDYNGVILFSGIHYLETNQHLVKEMNITDAIYLYLRFTTPSLYS 434
           AYT+E++K A+ +++ +D  G+ + + +H+ ET + +   + + DAIY++LRF TP +YS
Sbjct: 324 AYTYELKKIAELQSMPIDARGIFVLAVLHHFETGKPICLSLRLDDAIYMFLRFNTPEIYS 383

Query: 435 KVYYNVAVESVSRYWLWYAITTEPLEDVKKELKNLSVFVTKTLLHVLLQKNCIQVNQQLR 494
           K + N+AV   S Y++  A+     E+  K ++     V    + VLL   C   ++++ 
Sbjct: 384 KSFGNIAVTDASLYFVLLALEGNSHEENHKLVREFPQTVFAVFIQVLLLNMCRLPSREIG 443

Query: 495 MITFTLLTRLLCLIPEKVAFEFILDVLKTSPLPLAKTSVLCVFKDL---SRRRISTKDND 551
            +T ++L R+L L  E  AF+F++D L   P   AK  +L + K +    +  I T+D  
Sbjct: 444 RMTHSILARVLFLASETTAFDFVIDTLLQCPYETAKQIILEIAKIMMVSDQYTICTRDVP 503

Query: 552 SETDLIVEKLSKLKVNDSNKAQQSNIRHYIQLDSSKMKAVHDCCLQTIQ-DSFTADAKKS 610
           S T                KA     R +I+L+  +M A H   + + +  + T D K+ 
Sbjct: 504 SHT------------RTDTKAPPLPPRPFIKLNDDRMAAFHTLAMMSAKFCTETEDPKQ- 550

Query: 611 DILLLLTYLNIFIVLKKTWDEDLLKIVCSKIDSNLKSVEPDK 652
            +  LL+YLN+  VL+K WD+ LL+ +   + +    +EP K
Sbjct: 551 -LTTLLSYLNLITVLRKKWDQVLLRELTVAVSN---CIEPRK 588

>CAGL0F06985g 684832..686724 similar to sp|P53169 Saccharomyces
           cerevisiae YGL060w, hypothetical start
          Length = 630

 Score =  149 bits (375), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 156/637 (24%), Positives = 273/637 (42%), Gaps = 85/637 (13%)

Query: 26  VTLIDIYGEQVNQEGSYEEKTRFIETLNTLLED-NPSTTGEIGWDLPKGLLKFLSKDNVD 84
           +T + +  E +N     E++  F + L  LL+        E+ W LPK L+K +S  NV+
Sbjct: 24  ITYLVLLEECINGLSGSEDQALFFDELYGLLDQFGTPLNDELLWGLPKALIKNISSKNVE 83

Query: 85  VNGRLGTNMIVQGVMKCFYAISIQGEPKKCLITGLELLSSLCSKDFSKSDQQNKEDFVDK 144
                    +V+ +  C   ++  G      + G ELL    ++D +  D  N    +  
Sbjct: 84  ------DKALVKAICNCMKLVARVGTDDYNFLFGTELLRECRAEDTNIYDDSNDTYIL-- 135

Query: 145 KANTLPPEGVIENSSNRKDFPSYGESKSSNEFFLKLKSYILFEFIGASLKRISTLFPSKY 204
                                         E F      +L EFI  +LK +    PSK+
Sbjct: 136 ------------------------------EAFKVRVELLLEEFILPALKTLGQTNPSKF 165

Query: 205 LGAAVSTIEKFVYSH---ADTFEDALFLLRRVYTFCRNYIPPDP----PKDIQLNEDFTR 257
           L   VS + + + ++    +  E +  LL  +  F  +Y  P      P     N+D   
Sbjct: 166 LSVIVSALVELISNNMQCGEEIEMSNILLDVIIRFYDSYELPSAKVTTPDGAMANKD--- 222

Query: 258 EMFDKVVEEESELQVRLLRRLCTFGISTPIKTVTTNADVKYYCALNQ--------QKFEL 309
                    E ++  ++L    +F I   IK  +   +   Y  L+Q        Q+ ++
Sbjct: 223 ---------EEDIVQKILESFWSFSIGRCIKNQSCFPE---YILLSQIPRMDFVKQEIDV 270

Query: 310 SAYYTEYLELFCRYYQMAFSLDVDIEGEFQNVIKECRIIYKSVPQEISAVNDEAKLVLER 369
              +        R       L +D++   +   +E R IY+ +P     V D   L  E 
Sbjct: 271 PDDFIIKSRNIIRITNE--KLQLDLQKMMEACFEETRKIYELLPPN-PTVQDGNDLTEE- 326

Query: 370 MVYKLAYTFEVQKAAKEKN-VGLDYNGVILFSGIHYLETNQHLVKEMNITDAIYLYLRFT 428
            +Y+++Y   V    ++K  + LD  GV+  SG++Y+  +  L  ++N+ DA+ LYLRF+
Sbjct: 327 -IYQMSYVNGVTTLEEQKGKLSLDTAGVLTLSGLYYIANDNKLNVKINLYDAVLLYLRFS 385

Query: 429 TPSLYSKVYYNVAVESVSRYWLWYAITTEPLED--VKKELKNLSVFVTKTLLHVLLQKNC 486
           + SLYS ++ N  VE + R+WLW     E  +   ++ EL ++  +V K    +LL K C
Sbjct: 386 SASLYSPIFDNTFVEGICRFWLWSYTLGENRDKNTLQSELMSVPDYVLKVFFQLLLLKTC 445

Query: 487 IQVNQQLRMITFTLLTRLLCLIPEKVAFEFILDVLKTSPLPLAKTSVLCVFKDLSRRRIS 546
            + +   + I F LLT+LL     +VAF+FI+D + + P   AK ++  + KDL  ++  
Sbjct: 446 NEASTLQKRINFNLLTQLLAFSNAEVAFDFIVDTILSCPYLDAKIAIAGILKDLMAKK-- 503

Query: 547 TKDNDSETDLIVEKLSKLKVNDSNKAQQSNIRHYIQLDSSKMKAVHDCCLQTIQDSFTA- 605
                 +  L   +  K + N+ N   +   R  I +D  ++ ++H      I+D     
Sbjct: 504 ----SDDIHLKEARQVKNEPNNHNCPPKLPDRPPITVDEHRIASIHSLVKLCIEDCLKPL 559

Query: 606 -DAKKSDILLLLTYLNIFIVLKKTWDEDLLKIVCSKI 641
            +  + +++LL  Y+NI I L K WD  LLK +  +I
Sbjct: 560 NNKTQGNLILLQYYINILITLYKQWDGFLLKEINDEI 596

>Scas_707.25*
          Length = 2124

 Score = 31.6 bits (70), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 29/41 (70%), Gaps = 3/41 (7%)

Query: 196  ISTLFPS---KYLGAAVSTIEKFVYSHADTFEDALFLLRRV 233
            I+ LF S   +Y GAA++++E+F+ S+AD ++   + ++RV
Sbjct: 1784 IAKLFSSLLQRYSGAALASVEEFLKSNADEYDGLGYPIKRV 1824

>Sklu_2115.6 YGL156W, Contig c2115 5286-8525 reverse complement
          Length = 1079

 Score = 30.8 bits (68), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 22/34 (64%), Gaps = 2/34 (5%)

Query: 630 DEDLLKIVCSKI--DSNLKSVEPDKLPKYKEIVD 661
           D+DL+K+   ++  D N   V P+K P YK+++D
Sbjct: 50  DQDLVKVEWYQVPFDKNTSPVSPEKRPSYKQVID 83

>Kwal_56.24404
          Length = 491

 Score = 30.4 bits (67), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 25/101 (24%), Positives = 41/101 (40%), Gaps = 11/101 (10%)

Query: 189 IGASLKRISTLFPSKYLGAAVSTIEKFVYSHADTFEDALFLLRRVYTFCRNYIPPD---- 244
           +G      +T+ PS Y+   +   E F+    D F++     + +   CR YI  +    
Sbjct: 47  LGKKPATTATVPPSDYVKKLIEVYETFIKITRDCFQNGSLFTKALDNACRAYINVNELAI 106

Query: 245 PPKDIQLNEDFTREMFDKVVEEESELQVRLLRRLCTFGIST 285
           PP  ++     T EM  K  ++       LL+R    G ST
Sbjct: 107 PPGSLKSATSKTPEMLAKYSDQ-------LLKRSNKAGEST 140

>Kwal_34.16089
          Length = 1333

 Score = 30.4 bits (67), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 17/70 (24%), Positives = 36/70 (51%), Gaps = 6/70 (8%)

Query: 386 EKNV-GLDYNGVILFSGIHYLETNQHLVKEMNITDAIYLYLRFTTPSLYSKVYYNVAVES 444
           +KN+  +DYNG++    +   E ++   K +N+ DA++     +   L+S +  N++  +
Sbjct: 867 DKNIKSVDYNGMLFILSVKLFELHRKTQKSINVRDALWSLYSNSKSILFSTIIPNISSWN 926

Query: 445 VSR-----YW 449
            +R     YW
Sbjct: 927 QAREYKITYW 936

>YPL058C (PDR12) [5383] chr16 complement(445837..450372) Protein
           required for weak organic acid resistance, member of the
           ATP-binding cassette (ABC) superfamily of membrane
           transporters [4536 bp, 1511 aa]
          Length = 1511

 Score = 30.4 bits (67), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 23/42 (54%)

Query: 168 GESKSSNEFFLKLKSYILFEFIGASLKRISTLFPSKYLGAAV 209
           G S SS    +K KSY ++     SL+ I T FP+K++   +
Sbjct: 566 GNSFSSRPVIVKHKSYSMYHLSAESLQEIITEFPTKFVAIVI 607

>Sklu_2405.7 YPL093W, Contig c2405 13698-15644 reverse complement
          Length = 648

 Score = 30.0 bits (66), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 46/99 (46%), Gaps = 3/99 (3%)

Query: 349 YKSVPQEISAVNDEAKLVLERMVYKLAYTFEVQKAAKEKNVGLDYNGVILFSGIHYLETN 408
           +K +P  +   ND   +VL R   K      V+   K   +   Y   + F+G  ++E  
Sbjct: 5   WKDIPT-VPPANDLLDIVLNRTQRKTPTV--VRPGYKITRIRAFYMRKVKFTGEGFVEKF 61

Query: 409 QHLVKEMNITDAIYLYLRFTTPSLYSKVYYNVAVESVSR 447
           + L+K     + ++ + R    +LY K +Y V++ +VSR
Sbjct: 62  EDLLKGFPNINDVHPFHRDLMDTLYEKNHYKVSLAAVSR 100

>Scas_721.14
          Length = 646

 Score = 29.6 bits (65), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 23/99 (23%), Positives = 47/99 (47%), Gaps = 3/99 (3%)

Query: 349 YKSVPQEISAVNDEAKLVLERMVYKLAYTFEVQKAAKEKNVGLDYNGVILFSGIHYLETN 408
           +K +P  +S  ND   +VL R   K      ++   K   +   Y   + F+G  ++E  
Sbjct: 5   WKDIPT-VSPANDLLDIVLNRTQRKTPTV--IRPGFKITRIRAFYMRKVKFTGEGFVEKF 61

Query: 409 QHLVKEMNITDAIYLYLRFTTPSLYSKVYYNVAVESVSR 447
           + ++K     + ++ + R    +LY K +Y +++ +VSR
Sbjct: 62  EDILKGFPNINDVHPFHRDLMDTLYEKNHYKISLAAVSR 100

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.136    0.387 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 21,949,110
Number of extensions: 1000079
Number of successful extensions: 3494
Number of sequences better than 10.0: 43
Number of HSP's gapped: 3584
Number of HSP's successfully gapped: 45
Length of query: 662
Length of database: 16,596,109
Length adjustment: 108
Effective length of query: 554
Effective length of database: 12,857,365
Effective search space: 7122980210
Effective search space used: 7122980210
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 65 (29.6 bits)