Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YBR208C (DUR1,2)1835180294480.0
Sklu_2124.11830179872110.0
KLLA0E08107g1829180170110.0
Kwal_27.119511869179869900.0
Scas_721.401834180468610.0
CAGL0M05533g1834179563940.0
ADR051C1819179259770.0
YBR218C (PYC2)11804717221e-77
Kwal_14.180311744377141e-76
CAGL0K06787g11754487132e-76
Scas_686.1711764717096e-76
CAGL0F06941g11804826981e-74
YGL062W (PYC1)11784716927e-74
KLLA0C05764g11734596901e-73
AAR162C11714736783e-72
Scas_563.1212164326553e-69
Sklu_1458.111324256186e-65
Scas_720.7422315065542e-56
YMR207C (HFA1)21234765496e-56
CAGL0L10780g22335065471e-55
YNR016C (ACC1)22335065452e-55
AAR071W22315065442e-55
KLLA0F06072g22315065433e-55
Kwal_23.615722305085424e-55
ABR140C4632332492e-21
Scas_684.254821672421e-20
Kwal_23.42494652522358e-20
KLLA0A09845g4691682322e-19
CAGL0M13585g4671692242e-18
YMR293C4641832072e-16
Kwal_56.222955831791932e-14
Sklu_2417.115911781799e-13
Sklu_2417.105911781799e-13
Scas_721.665731631735e-12
Sklu_1884.25461941611e-10
YDR242W (AMD2)5492571611e-10
Sklu_2136.36172841386e-08
YJL130C (URA2)22143001352e-07
CAGL0L05676g22113041307e-07
KLLA0E15444g22283041307e-07
Kwal_34.157245561261298e-07
Scas_582.4*21933041272e-06
Sklu_2072.34504201216e-06
ACR263C22403041219e-06
KLLA0B08800g5701551154e-05
Sklu_2331.122203041137e-05
Kwal_33.1406122213041121e-04
Kwal_27.104385691331055e-04
KLLA0D12628g578145980.003
Sklu_2413.41122318970.005
CAGL0C04917g1113181830.24
ABR157W1113168830.26
YJR109C (CPA2)1118305820.29
Kwal_55.197831121316820.33
KLLA0F01837g73671810.39
Scas_691.191117173780.97
ABR075C14262721.5
Sklu_2439.1244763733.1
KLLA0F03190g1117171733.7
Scas_712.17793121724.9
KLLA0A02365g42239715.4
KLLA0F12452g143375716.2
YHR014W (SPO13)29151688.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YBR208C
         (1802 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YBR208C (DUR1,2) [390] chr2 complement(636660..642167) Urea amid...  3643   0.0  
Sklu_2124.1 YBR208C, Contig c2124 43-5535 reverse complement         2782   0.0  
KLLA0E08107g 730334..735823 highly similar to sp|P32528 Saccharo...  2705   0.0  
Kwal_27.11951                                                        2697   0.0  
Scas_721.40                                                          2647   0.0  
CAGL0M05533g complement(588667..594171) similar to sp|P32528 Sac...  2467   0.0  
ADR051C [1792] [Homologous to ScYBR208C (DUR12) - SH] (796213..8...  2306   0.0  
YBR218C (PYC2) [399] chr2 complement(658664..662206) Pyruvate ca...   282   1e-77
Kwal_14.1803                                                          279   1e-76
CAGL0K06787g complement(659290..662817) highly similar to sp|P32...   279   2e-76
Scas_686.17                                                           277   6e-76
CAGL0F06941g 679960..683502 highly similar to sp|P11154 Saccharo...   273   1e-74
YGL062W (PYC1) [1917] chr7 (385197..388733) Pyruvate carboxylase...   271   7e-74
KLLA0C05764g complement(512470..515991) highly similar to sp|P32...   270   1e-73
AAR162C [350] [Homologous to ScYGL062W (PYC1) - SH; ScYBR218C (P...   265   3e-72
Scas_563.12                                                           256   3e-69
Sklu_1458.1 YGL062W, Contig c1458 155-3553 reverse complement         242   6e-65
Scas_720.74                                                           218   2e-56
YMR207C (HFA1) [4163] chr13 complement(677192..683563) Protein w...   216   6e-56
CAGL0L10780g complement(1149588..1156289) highly similar to sp|Q...   215   1e-55
YNR016C (ACC1) [4599] chr14 complement(654672..661373) Acetyl-Co...   214   2e-55
AAR071W [257] [Homologous to ScYNR016C (ACC1) - SH; ScYMR207C (H...   214   2e-55
KLLA0F06072g 583276..589971 highly similar to sp|Q00955 Saccharo...   213   3e-55
Kwal_23.6157                                                          213   4e-55
ABR140C [732] [Homologous to ScYMR293C - SH] (662185..663576) [1...   100   2e-21
Scas_684.25                                                            98   1e-20
Kwal_23.4249                                                           95   8e-20
KLLA0A09845g complement(862467..863876) similar to sp|Q03557 Sac...    94   2e-19
CAGL0M13585g complement(1335488..1336891) similar to sp|Q03557 S...    91   2e-18
YMR293C (YMR293C) [4247] chr13 complement(855398..856792) Protei...    84   2e-16
Kwal_56.22295                                                          79   2e-14
Sklu_2417.11 , Contig c2417 20071-21846                                74   9e-13
Sklu_2417.10 , Contig c2417 20071-21846                                74   9e-13
Scas_721.66                                                            71   5e-12
Sklu_1884.2 YDR242W, Contig c1884 1484-3124 reverse complement         67   1e-10
YDR242W (AMD2) [1076] chr4 (946799..948448) Protein with similar...    67   1e-10
Sklu_2136.3 , Contig c2136 3336-5189 reverse complement                58   6e-08
YJL130C (URA2) [2788] chr10 complement(165641..172285) Multifunc...    57   2e-07
CAGL0L05676g 619734..626369 highly similar to sp|P07259 Saccharo...    55   7e-07
KLLA0E15444g 1370741..1377427 highly similar to sp|P07259 Saccha...    55   7e-07
Kwal_34.15724                                                          54   8e-07
Scas_582.4*                                                            54   2e-06
Sklu_2072.3 , Contig c2072 3010-4362 reverse complement                51   6e-06
ACR263C [1310] [Homologous to ScYJL130C (URA2) - SH] (827830..83...    51   9e-06
KLLA0B08800g complement(772732..774444) similar to ca|CA4426|CaA...    49   4e-05
Sklu_2331.1 YJL130C, Contig c2331 2029-8691                            48   7e-05
Kwal_33.14061                                                          48   1e-04
Kwal_27.10438                                                          45   5e-04
KLLA0D12628g 1071637..1073373 weakly similar to sp|P22580 Saccha...    42   0.003
Sklu_2413.4 YJR109C, Contig c2413 10886-14254                          42   0.005
CAGL0C04917g 457506..460847 highly similar to sp|P03965 Saccharo...    37   0.24 
ABR157W [750] [Homologous to ScYJR109C (CPA2) - SH] complement(6...    37   0.26 
YJR109C (CPA2) [3001] chr10 complement(629500..632856) Carbamoyl...    36   0.29 
Kwal_55.19783                                                          36   0.33 
KLLA0F01837g complement(168045..170255) weakly similar to sp|P38...    36   0.39 
Scas_691.19                                                            35   0.97 
ABR075C [666] [Homologous to ScYKL056C - SH] (527207..527635) [4...    32   1.5  
Sklu_2439.12 YKL082C, Contig c2439 16281-17624 reverse complement      33   3.1  
KLLA0F03190g complement(296883..300236) highly similar to sp|P03...    33   3.7  
Scas_712.17                                                            32   4.9  
KLLA0A02365g 211300..212568 similar to sgd|S0005681 Saccharomyce...    32   5.4  
KLLA0F12452g complement(1152209..1156510) some similarities with...    32   6.2  
YHR014W (SPO13) [2300] chr8 (132039..132914) Meiosis-specific pr...    31   8.9  

>YBR208C (DUR1,2) [390] chr2 complement(636660..642167) Urea
            amidolyase, contains urea carboxylase and allophanate
            hydrolase activities fused together in a single
            polypeptide [5508 bp, 1835 aa]
          Length = 1835

 Score = 3643 bits (9448), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1769/1802 (98%), Positives = 1769/1802 (98%)

Query: 1    MTVSSDTTAEISLGWSIQDWIDFHKSSSSQASLRLLESLLDSQNVAPVDNAWISLISKEN 60
            MTVSSDTTAEISLGWSIQDWIDFHKSSSSQASLRLLESLLDSQNVAPVDNAWISLISKEN
Sbjct: 1    MTVSSDTTAEISLGWSIQDWIDFHKSSSSQASLRLLESLLDSQNVAPVDNAWISLISKEN 60

Query: 61   LLHQFQILKSRENKETLPLYGVPIAVKDNIDVRGLPTTAACPSFAYEPSKDSKVVELLRN 120
            LLHQFQILKSRENKETLPLYGVPIAVKDNIDVRGLPTTAACPSFAYEPSKDSKVVELLRN
Sbjct: 61   LLHQFQILKSRENKETLPLYGVPIAVKDNIDVRGLPTTAACPSFAYEPSKDSKVVELLRN 120

Query: 121  AGAIIVGKTNLDQFATGLVGTRSPYGKTPCAFSKEHXXXXXXXXXXXXXXRGIVPIALGT 180
            AGAIIVGKTNLDQFATGLVGTRSPYGKTPCAFSKEH              RGIVPIALGT
Sbjct: 121  AGAIIVGKTNLDQFATGLVGTRSPYGKTPCAFSKEHVSGGSSAGSASVVARGIVPIALGT 180

Query: 181  DTAGSGRVPAALNNLIGLKPTKGVFSCQGVVPACKSLDCVSIFALNLSDAERCFRIMCQP 240
            DTAGSGRVPAALNNLIGLKPTKGVFSCQGVVPACKSLDCVSIFALNLSDAERCFRIMCQP
Sbjct: 181  DTAGSGRVPAALNNLIGLKPTKGVFSCQGVVPACKSLDCVSIFALNLSDAERCFRIMCQP 240

Query: 241  DPDNDEYSRPYVSNPLKKFSSNVTIAIPKNIPWYGETKNPVLFSNAVENLSRTGANVIEI 300
            DPDNDEYSRPYVSNPLKKFSSNVTIAIPKNIPWYGETKNPVLFSNAVENLSRTGANVIEI
Sbjct: 241  DPDNDEYSRPYVSNPLKKFSSNVTIAIPKNIPWYGETKNPVLFSNAVENLSRTGANVIEI 300

Query: 301  DFEPLLELARCLYEGTWVAERYQAIQSFLDSKPPKESLDPTVISIIEGAKKYSAVDCFSF 360
            DFEPLLELARCLYEGTWVAERYQAIQSFLDSKPPKESLDPTVISIIEGAKKYSAVDCFSF
Sbjct: 301  DFEPLLELARCLYEGTWVAERYQAIQSFLDSKPPKESLDPTVISIIEGAKKYSAVDCFSF 360

Query: 361  EYKRQGILQKVRRLLESVDVLCVPTCPLNPTMQQVADEPVLVNSRQGTWTNFVNLADLAA 420
            EYKRQGILQKVRRLLESVDVLCVPTCPLNPTMQQVADEPVLVNSRQGTWTNFVNLADLAA
Sbjct: 361  EYKRQGILQKVRRLLESVDVLCVPTCPLNPTMQQVADEPVLVNSRQGTWTNFVNLADLAA 420

Query: 421  LAVPAGFRDDGLPNGITLIGKKFTDYALLELANRYFQNIFPNGSRTYGTFTSSSVKPAND 480
            LAVPAGFRDDGLPNGITLIGKKFTDYALLELANRYFQNIFPNGSRTYGTFTSSSVKPAND
Sbjct: 421  LAVPAGFRDDGLPNGITLIGKKFTDYALLELANRYFQNIFPNGSRTYGTFTSSSVKPAND 480

Query: 481  QLVGPDYDPSTSIKLAVVGAHLKGLPLHWQLEKVNATYLCTTKTSKAYQLFALPKNGPVL 540
            QLVGPDYDPSTSIKLAVVGAHLKGLPLHWQLEKVNATYLCTTKTSKAYQLFALPKNGPVL
Sbjct: 481  QLVGPDYDPSTSIKLAVVGAHLKGLPLHWQLEKVNATYLCTTKTSKAYQLFALPKNGPVL 540

Query: 541  KPGLRRVQDSNGSQIELEVYSVPKELFGAFISMVPEPLGIGSVELESGEWIKSFICEESG 600
            KPGLRRVQDSNGSQIELEVYSVPKELFGAFISMVPEPLGIGSVELESGEWIKSFICEESG
Sbjct: 541  KPGLRRVQDSNGSQIELEVYSVPKELFGAFISMVPEPLGIGSVELESGEWIKSFICEESG 600

Query: 601  YKAKGTVDITKYGGFRAYFEMLXXXXXXXXXLFDTVLIANRGEIAVRIIKTLKKLGIRSV 660
            YKAKGTVDITKYGGFRAYFEML         LFDTVLIANRGEIAVRIIKTLKKLGIRSV
Sbjct: 601  YKAKGTVDITKYGGFRAYFEMLKKKESQKKKLFDTVLIANRGEIAVRIIKTLKKLGIRSV 660

Query: 661  AVYSDPDKYSQHVTDADVSVPLHGTTAAQTYLDMNKIIDAAKQTNAQAIIPGYGFLSENA 720
            AVYSDPDKYSQHVTDADVSVPLHGTTAAQTYLDMNKIIDAAKQTNAQAIIPGYGFLSENA
Sbjct: 661  AVYSDPDKYSQHVTDADVSVPLHGTTAAQTYLDMNKIIDAAKQTNAQAIIPGYGFLSENA 720

Query: 721  DFSDACTSAGITFVGPSGDIIRGLGLKHSARQIAQKAGVPLVPGSLLITSXXXXXXXXXX 780
            DFSDACTSAGITFVGPSGDIIRGLGLKHSARQIAQKAGVPLVPGSLLITS          
Sbjct: 721  DFSDACTSAGITFVGPSGDIIRGLGLKHSARQIAQKAGVPLVPGSLLITSVEEAKKVAAE 780

Query: 781  LEYPVMVKSTAGGGGIGLQKVDSEEDIEHIFETVKHQGETFFGDAGVFLERFIENARHVE 840
            LEYPVMVKSTAGGGGIGLQKVDSEEDIEHIFETVKHQGETFFGDAGVFLERFIENARHVE
Sbjct: 781  LEYPVMVKSTAGGGGIGLQKVDSEEDIEHIFETVKHQGETFFGDAGVFLERFIENARHVE 840

Query: 841  VQLMGDGFGKAIALGERDCSLQRRNQKVIEETPAPNLPEKTRLALRKAAESLGSLLNYKC 900
            VQLMGDGFGKAIALGERDCSLQRRNQKVIEETPAPNLPEKTRLALRKAAESLGSLLNYKC
Sbjct: 841  VQLMGDGFGKAIALGERDCSLQRRNQKVIEETPAPNLPEKTRLALRKAAESLGSLLNYKC 900

Query: 901  AGTVEFIYDEKKDEFYFLEVNTRLQVEHPITEMVTGLDLVEWMIRIAANDAPDFDSTKVE 960
            AGTVEFIYDEKKDEFYFLEVNTRLQVEHPITEMVTGLDLVEWMIRIAANDAPDFDSTKVE
Sbjct: 901  AGTVEFIYDEKKDEFYFLEVNTRLQVEHPITEMVTGLDLVEWMIRIAANDAPDFDSTKVE 960

Query: 961  VNGVSMEARLYAENPLKNFRPSPGLLVDVKFPDWARVDTWVKKGTNISPEYDPTLAKIIV 1020
            VNGVSMEARLYAENPLKNFRPSPGLLVDVKFPDWARVDTWVKKGTNISPEYDPTLAKIIV
Sbjct: 961  VNGVSMEARLYAENPLKNFRPSPGLLVDVKFPDWARVDTWVKKGTNISPEYDPTLAKIIV 1020

Query: 1021 HGKDRDDAISKLNQALEETKVYGCITNIDYLKSIITSDFFAKAKVSTNILNSYQYEPTAI 1080
            HGKDRDDAISKLNQALEETKVYGCITNIDYLKSIITSDFFAKAKVSTNILNSYQYEPTAI
Sbjct: 1021 HGKDRDDAISKLNQALEETKVYGCITNIDYLKSIITSDFFAKAKVSTNILNSYQYEPTAI 1080

Query: 1081 EITLPGAHTSIQDYPGRVGYWRIGVPPSGPMDAYSFRLANRIVGNDYRTPAIEVTLTGPS 1140
            EITLPGAHTSIQDYPGRVGYWRIGVPPSGPMDAYSFRLANRIVGNDYRTPAIEVTLTGPS
Sbjct: 1081 EITLPGAHTSIQDYPGRVGYWRIGVPPSGPMDAYSFRLANRIVGNDYRTPAIEVTLTGPS 1140

Query: 1141 IVFHCETVIAITGGTALCTLDGQEIPQHKPVEVKRGSTLSIGKLTSGCRAYLGIRGGIDV 1200
            IVFHCETVIAITGGTALCTLDGQEIPQHKPVEVKRGSTLSIGKLTSGCRAYLGIRGGIDV
Sbjct: 1141 IVFHCETVIAITGGTALCTLDGQEIPQHKPVEVKRGSTLSIGKLTSGCRAYLGIRGGIDV 1200

Query: 1201 PKYLGSYSTFTLGNVGGYNGRVLKLGDVLFLPSNEENKSVECLPQNIPQSLIPQISETKE 1260
            PKYLGSYSTFTLGNVGGYNGRVLKLGDVLFLPSNEENKSVECLPQNIPQSLIPQISETKE
Sbjct: 1201 PKYLGSYSTFTLGNVGGYNGRVLKLGDVLFLPSNEENKSVECLPQNIPQSLIPQISETKE 1260

Query: 1261 WRIGVTCGPHGSPDFFKPESIEEFFSEKWKVHYNSNRFGVRLIGPKPKWARSNGGEGGMH 1320
            WRIGVTCGPHGSPDFFKPESIEEFFSEKWKVHYNSNRFGVRLIGPKPKWARSNGGEGGMH
Sbjct: 1261 WRIGVTCGPHGSPDFFKPESIEEFFSEKWKVHYNSNRFGVRLIGPKPKWARSNGGEGGMH 1320

Query: 1321 PSNTHDYVYSLGAINFTGDEPVIITCDGPSLGGFVCQAVVPEAELWKVGQVKPGDSIQFV 1380
            PSNTHDYVYSLGAINFTGDEPVIITCDGPSLGGFVCQAVVPEAELWKVGQVKPGDSIQFV
Sbjct: 1321 PSNTHDYVYSLGAINFTGDEPVIITCDGPSLGGFVCQAVVPEAELWKVGQVKPGDSIQFV 1380

Query: 1381 PLSYESSRSLKESQDVAIKSLDGTKLRRLDSVSILPSFETPILAQMEKVNELSPKVVYRQ 1440
            PLSYESSRSLKESQDVAIKSLDGTKLRRLDSVSILPSFETPILAQMEKVNELSPKVVYRQ
Sbjct: 1381 PLSYESSRSLKESQDVAIKSLDGTKLRRLDSVSILPSFETPILAQMEKVNELSPKVVYRQ 1440

Query: 1441 AGDRYVLVEYGDNEMNFNISYRIECLISLVKKNKTIGIVEMSQGVRSVLIEFDGYKVTQK 1500
            AGDRYVLVEYGDNEMNFNISYRIECLISLVKKNKTIGIVEMSQGVRSVLIEFDGYKVTQK
Sbjct: 1441 AGDRYVLVEYGDNEMNFNISYRIECLISLVKKNKTIGIVEMSQGVRSVLIEFDGYKVTQK 1500

Query: 1501 ELLKVLVAYETEIQFDENWKITSNIIRLPMAFEDSKTLACVQRYQETIRSSAPWLPNNVD 1560
            ELLKVLVAYETEIQFDENWKITSNIIRLPMAFEDSKTLACVQRYQETIRSSAPWLPNNVD
Sbjct: 1501 ELLKVLVAYETEIQFDENWKITSNIIRLPMAFEDSKTLACVQRYQETIRSSAPWLPNNVD 1560

Query: 1561 FIANVNGISRNEVYDMLYSARFMVLGLGDVFLGSPCAVPLDPRHRFLGSKYNPSRTYTER 1620
            FIANVNGISRNEVYDMLYSARFMVLGLGDVFLGSPCAVPLDPRHRFLGSKYNPSRTYTER
Sbjct: 1561 FIANVNGISRNEVYDMLYSARFMVLGLGDVFLGSPCAVPLDPRHRFLGSKYNPSRTYTER 1620

Query: 1621 GAVGIGGMYMCIYAANSPGGYQLVGRTIPIWDKLCLAASSEVPWLMNPFDQVEFYPVSEE 1680
            GAVGIGGMYMCIYAANSPGGYQLVGRTIPIWDKLCLAASSEVPWLMNPFDQVEFYPVSEE
Sbjct: 1621 GAVGIGGMYMCIYAANSPGGYQLVGRTIPIWDKLCLAASSEVPWLMNPFDQVEFYPVSEE 1680

Query: 1681 DLDKMTEDCDNGVYKVNIEKSVFDHQEYLRWINANKDSITAFQEGQLGERAEEFAKLIQN 1740
            DLDKMTEDCDNGVYKVNIEKSVFDHQEYLRWINANKDSITAFQEGQLGERAEEFAKLIQN
Sbjct: 1681 DLDKMTEDCDNGVYKVNIEKSVFDHQEYLRWINANKDSITAFQEGQLGERAEEFAKLIQN 1740

Query: 1741 ANSELKESVTVKPDEEEDFPEGAEIVYSEYSGRFWKSIASVGDVIEAGQGLLIIEAMKAE 1800
            ANSELKESVTVKPDEEEDFPEGAEIVYSEYSGRFWKSIASVGDVIEAGQGLLIIEAMKAE
Sbjct: 1741 ANSELKESVTVKPDEEEDFPEGAEIVYSEYSGRFWKSIASVGDVIEAGQGLLIIEAMKAE 1800

Query: 1801 MI 1802
            MI
Sbjct: 1801 MI 1802

>Sklu_2124.1 YBR208C, Contig c2124 43-5535 reverse complement
          Length = 1830

 Score = 2782 bits (7211), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1315/1798 (73%), Positives = 1512/1798 (84%), Gaps = 9/1798 (0%)

Query: 12   SLGWSIQDWIDFHKSSSSQASLRLLESLLDSQNVAPVDNAWISLISKENLLHQFQILKSR 71
            +LGWS QDWIDFH  S+ + S   L SLL SQ  AP D AWISLI++ NL HQ+++L+S+
Sbjct: 5    TLGWSAQDWIDFHGKSTPEHSYNTLLSLLKSQKSAPEDPAWISLINEANLAHQWKVLQSK 64

Query: 72   ENKETLPLYGVPIAVKDNIDVRGLPTTAACPSFAYEPSKDSKVVELLRNAGAIIVGKTNL 131
             NK+ LPLYGVPIAVKDNID +G PTTAACP+F Y PS DS VV LL++AGAI++GKTNL
Sbjct: 65   ANKQQLPLYGVPIAVKDNIDSKGSPTTAACPAFEYNPSADSTVVALLKDAGAIVIGKTNL 124

Query: 132  DQFATGLVGTRSPYGKTPCAFSKEHXXXXXXXXXXXXXXRGIVPIALGTDTAGSGRVPAA 191
            DQFATGLVGTRSPYGKTPC FS +H              RGIVPIALGTDTAGSGRVPAA
Sbjct: 125  DQFATGLVGTRSPYGKTPCVFSDKHVSGGSSAGSASAVGRGIVPIALGTDTAGSGRVPAA 184

Query: 192  LNNLIGLKPTKGVFSCQGVVPACKSLDCVSIFALNLSDAERCFRIMCQPDPDNDEYSRPY 251
            LNNLIGLKPTKG+FSC GVVPACKSLDCVS+FA+NLSDAERCF++M +PD +NDEYSRP 
Sbjct: 185  LNNLIGLKPTKGLFSCSGVVPACKSLDCVSVFAMNLSDAERCFKVMAKPDLENDEYSRPL 244

Query: 252  VSNPLKKFSSNVTIAIPKNIPWYGETKNPVLFSNAVENLSRTGANVIEIDFEPLLELARC 311
             SNPL+K+  NVTIAIPK +PWYGET+NP L++ A+ENL   GA+++ IDFEPLL LARC
Sbjct: 245  PSNPLQKYPKNVTIAIPKEVPWYGETENPKLYAKAIENLKVAGASIVTIDFEPLLALARC 304

Query: 312  LYEGTWVAERYQAIQSFLDSKPPKESLDPTVISIIEGAKKYSAVDCFSFEYKRQGILQKV 371
            LYEG WVAERY+A + F  + PP+ SLDPTV SII+ A KY A D F +EY+RQGILQKV
Sbjct: 305  LYEGAWVAERYEATKDFFATNPPESSLDPTVTSIIKTATKYDAADSFRYEYQRQGILQKV 364

Query: 372  RRLLESVDVLCVPTCPLNPTMQQVADEPVLVNSRQGTWTNFVNLADLAALAVPAGFRDDG 431
             + L+ +DVLCVPTCPLNPT ++VA EPVLVNSRQGTWTNFVNLAD+AALAVPAGFR DG
Sbjct: 365  DQTLKDIDVLCVPTCPLNPTFEEVAAEPVLVNSRQGTWTNFVNLADMAALAVPAGFRPDG 424

Query: 432  LPNGITLIGKKFTDYALLELANRYFQNIFPNGSRTYGTFTSSSVKPANDQLVGPDYDPST 491
            LP G+TLIGKKFTD+ALLELANRYF+  FP GSRT+G F    V   +D+L GPD  P  
Sbjct: 425  LPQGVTLIGKKFTDFALLELANRYFKVAFPQGSRTFGKFIDRQVTTKDDELRGPDISPED 484

Query: 492  SIKLAVVGAHLKGLPLHWQLEKVNATYLCTTKTSKAYQLFALPKNGPVLKPGLRRVQDSN 551
            S+KLAVVGAHLKGLPL+WQLEKVNATYL + KTSK Y+L+ALPK GP+LKPGLRRV +  
Sbjct: 485  SVKLAVVGAHLKGLPLYWQLEKVNATYLGSPKTSKNYKLYALPKTGPILKPGLRRVGEET 544

Query: 552  GSQIELEVYSVPKELFGAFISMVPEPLGIGSVELESGEWIKSFICEESGYKAKGTVDITK 611
            GSQI+LEVYSVPKE FG FISMVPEPLGIGSVELESGEW+KSFICEE GY  KGTVDITK
Sbjct: 545  GSQIQLEVYSVPKENFGEFISMVPEPLGIGSVELESGEWVKSFICEEFGYTQKGTVDITK 604

Query: 612  YGGFRAYFEMLXXXXXXXXXLFDTVLIANRGEIAVRIIKTLKKLGIRSVAVYSDPDKYSQ 671
            YGGF+ Y + L          F+TVLIANRGEIAVRIIKTLKKL IRSVAVYSDPDKYSQ
Sbjct: 605  YGGFKKYIDFLKQEEAKVKKPFETVLIANRGEIAVRIIKTLKKLNIRSVAVYSDPDKYSQ 664

Query: 672  HVTDADVSVPLHGTTAAQTYLDMNKIIDAAKQTNAQAIIPGYGFLSENADFSDACTSAGI 731
            HV DAD+ V L+G TAA+TYLD++KII AAK TNAQAIIPGYGFLSENA+F+D C   GI
Sbjct: 665  HVIDADLGVALNGRTAAETYLDIDKIIKAAKDTNAQAIIPGYGFLSENAEFADKCVEEGI 724

Query: 732  TFVGPSGDIIRGLGLKHSARQIAQKAGVPLVPGSLLITSXXXXXXXXXXLEYPVMVKSTA 791
             FVGPSG+ IR LGLKHSAR+IA+KAGVPLVPGS L+TS          LEYPVMVKSTA
Sbjct: 725  VFVGPSGEAIRKLGLKHSAREIAEKAGVPLVPGSGLVTSAKEAKEIANKLEYPVMVKSTA 784

Query: 792  GGGGIGLQKVDSEEDIEHIFETVKHQGETFFGDAGVFLERFIENARHVEVQLMGDGFGKA 851
            GGGGIGLQKVDSE +IE +FETV+HQG+ +FGD+GVFLERF+ENARHVE+Q+MGDG+GKA
Sbjct: 785  GGGGIGLQKVDSENEIERVFETVQHQGKAYFGDSGVFLERFVENARHVEIQMMGDGYGKA 844

Query: 852  IALGERDCSLQRRNQKVIEETPAPNLPEKTRLALRKAAESLGSLLNYKCAGTVEFIYDEK 911
            IA+GERDCSLQRRNQK+IEETPAPNL E TR  +R+AAESLGSLL YKCAGTVEFIYDE+
Sbjct: 845  IAIGERDCSLQRRNQKIIEETPAPNLGETTRTKMRQAAESLGSLLKYKCAGTVEFIYDER 904

Query: 912  KDEFYFLEVNTRLQVEHPITEMVTGLDLVEWMIRIAANDAPDFDSTKVEVNGVSMEARLY 971
            +DEFYFLEVN RLQVEHPITEMVTGLDLVEWM+RIAA+DAPDF+S  + V G S+EARLY
Sbjct: 905  RDEFYFLEVNARLQVEHPITEMVTGLDLVEWMLRIAADDAPDFESANIVVTGASIEARLY 964

Query: 972  AENPLKNFRPSPGLLVDVKFPDWARVDTWVKKGTNISPEYDPTLAKIIVHGKDRDDAISK 1031
            AENP K+FRPSPGLL DV FP+WARVDTWV KGT +S EYDPTLAKIIVHGKDR+DAI K
Sbjct: 965  AENPAKDFRPSPGLLTDVHFPEWARVDTWVSKGTTVSAEYDPTLAKIIVHGKDRNDAIMK 1024

Query: 1032 LNQALEETKVYGCITNIDYLKSIITSDFFAKAKVSTNILNSYQYEPTAIEITLPGAHTSI 1091
            +N+AL ET VYGCITNIDYL+SI +S+ F  AKV+T IL+SY Y+P A E+T PGA+T++
Sbjct: 1025 MNKALNETVVYGCITNIDYLRSIASSEMFKTAKVATKILDSYDYKPCAFEVTSPGAYTTV 1084

Query: 1092 QDYPGRVGYWRIGVPPSGPMDAYSFRLANRIVGNDYRTPAIEVTLTGPSIVFHCETVIAI 1151
            QDYPGRVGYWRIGVPPSGPMDAYSFRLANRIVGN Y+ PAIE+TL GP I+FH ET+IAI
Sbjct: 1085 QDYPGRVGYWRIGVPPSGPMDAYSFRLANRIVGNHYKAPAIELTLNGPKILFHTETIIAI 1144

Query: 1152 TGGTALCTLDGQEIPQHKPVEVKRGSTLSIGKLTSGCRAYLGIRGGIDVPKYLGSYSTFT 1211
            +GG A C+L+ + I Q+KP++V RG  L+IGKL+ GCRAYL IRGGIDVP+YLGS STF 
Sbjct: 1145 SGGIAACSLNDKPIEQNKPIQVNRGDHLAIGKLSVGCRAYLAIRGGIDVPEYLGSRSTFA 1204

Query: 1212 LGNVGGYNGRVLKLGDVLFLPSNEENKSVECL------PQNIPQSLIPQISETKEWRIGV 1265
            LGN+GGYNGRVLKLGDVLFL  N+   +   L      PQ  P +L+P+IS+ KEW IGV
Sbjct: 1205 LGNMGGYNGRVLKLGDVLFL--NQPELASSSLPGPAYEPQAPPANLLPKISDDKEWTIGV 1262

Query: 1266 TCGPHGSPDFFKPESIEEFFSEKWKVHYNSNRFGVRLIGPKPKWARSNGGEGGMHPSNTH 1325
            TCGPHGSPDFFKPES+EEFFSEKWKVHYNSNRFGVRLIGPKPKWAR +GGEGG+HPSN H
Sbjct: 1263 TCGPHGSPDFFKPESVEEFFSEKWKVHYNSNRFGVRLIGPKPKWARKDGGEGGLHPSNAH 1322

Query: 1326 DYVYSLGAINFTGDEPVIITCDGPSLGGFVCQAVVPEAELWKVGQVKPGDSIQFVPLSYE 1385
            DYVYSLGAINFTGDEPVIIT DGPSLGGFVCQAVVPEAELWKVGQVKPGDSIQFVP+SY+
Sbjct: 1323 DYVYSLGAINFTGDEPVIITSDGPSLGGFVCQAVVPEAELWKVGQVKPGDSIQFVPISYQ 1382

Query: 1386 SSRSLKESQDVAIKSLDGTKLRRLDSVSILPSFETPILAQMEKVNELSPKVVYRQAGDRY 1445
             +R LKESQD AI++L+  KL+ L S  ILP++E P+L Q+ K + LSPKV YRQAGDRY
Sbjct: 1383 VARQLKESQDAAIETLEDGKLQTLTSDLILPTYEDPVLVQLPKKSNLSPKVTYRQAGDRY 1442

Query: 1446 VLVEYGDNEMNFNISYRIECLISLVKKNKTIGIVEMSQGVRSVLIEFDGYKVTQKELLKV 1505
            +LVEYG+N+M+ NI+YRI  LI+LV K+KT+GIVEMSQGVRSVLIE+DGYK++Q  LL  
Sbjct: 1443 ILVEYGENQMDLNIAYRINQLINLVGKHKTVGIVEMSQGVRSVLIEYDGYKISQGALLDT 1502

Query: 1506 LVAYETEIQFDENWKITSNIIRLPMAFEDSKTLACVQRYQETIRSSAPWLPNNVDFIANV 1565
            LVAYE+EIQFD+NW I S I +LP+AFEDSKTL CV RYQETIRS APWLPNNVDF+A V
Sbjct: 1503 LVAYESEIQFDKNWSIKSKIFKLPLAFEDSKTLECVTRYQETIRSKAPWLPNNVDFVAEV 1562

Query: 1566 NGISRNEVYDMLYSARFMVLGLGDVFLGSPCAVPLDPRHRFLGSKYNPSRTYTERGAVGI 1625
            N I+  +V +MLYSARF+VLGLGDVFLG+PCAVPLDPRHRFLGSKYNPSRTYT+ G VGI
Sbjct: 1563 NDITHKDVENMLYSARFLVLGLGDVFLGAPCAVPLDPRHRFLGSKYNPSRTYTKNGVVGI 1622

Query: 1626 GGMYMCIYAANSPGGYQLVGRTIPIWDKLCLAA-SSEVPWLMNPFDQVEFYPVSEEDLDK 1684
            GGMYMCIYA +SPGGYQLVGRTIPIWDKL L + S E PWL+ PFDQVEFYPVSEE+LD+
Sbjct: 1623 GGMYMCIYAMDSPGGYQLVGRTIPIWDKLKLGSHSQEHPWLLTPFDQVEFYPVSEEELDR 1682

Query: 1685 MTEDCDNGVYKVNIEKSVFDHQEYLRWINANKDSITAFQEGQLGERAEEFAKLIQNANSE 1744
             TEDC+NG + V +E+SVFDH+ YL+WIN N +SIT FQ+ Q G +A+EFA+LIQ AN E
Sbjct: 1683 FTEDCENGKFPVQVEESVFDHKNYLKWINENIESITEFQKSQGGAKADEFARLIQVANQE 1742

Query: 1745 LKESVTVKPDEEEDFPEGAEIVYSEYSGRFWKSIASVGDVIEAGQGLLIIEAMKAEMI 1802
            L+ S T K   EE++PE AE+VYSEYSGRFWK + S GD +  G GL+I+EAMK EM+
Sbjct: 1743 LESSTTNKSAVEEEYPEDAEMVYSEYSGRFWKPMVSAGDTVTKGDGLVIVEAMKTEMV 1800

>KLLA0E08107g 730334..735823 highly similar to sp|P32528 Saccharomyces
            cerevisiae YBR208c DUR1_2 urea amidolyase, start by
            similarity
          Length = 1829

 Score = 2705 bits (7011), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1279/1801 (71%), Positives = 1499/1801 (83%), Gaps = 11/1801 (0%)

Query: 10   EISLGWSIQDWIDFHKSSSSQASLRLLESLLDSQNVAPVDNAWISLISKENLLHQFQILK 69
            E +LGWS+QDW+ FH  S+   SL LLE+LL SQ  AP D AWISLI  E+L HQ+ IL+
Sbjct: 2    ESTLGWSVQDWLSFHSKSTPTKSLELLENLLKSQKPAPEDPAWISLIPVEDLHHQWNILQ 61

Query: 70   SRENKETLPLYGVPIAVKDNIDVRGLPTTAACPSFAYEPSKDSKVVELLRNAGAIIVGKT 129
            S+ NKE LPLYGVPIAVKDNID +GLPTTAACPS+ Y+P++DS VVELLR+AGA+++GKT
Sbjct: 62   SKSNKEELPLYGVPIAVKDNIDYKGLPTTAACPSYLYQPTRDSYVVELLRDAGAVVIGKT 121

Query: 130  NLDQFATGLVGTRSPYGKTPCAFSKEHXXXXXXXXXXXXXXRGIVPIALGTDTAGSGRVP 189
            NLDQFATGLVGTRSPYGKTPC F+ ++              RGIVP++LGTDTAGSGRVP
Sbjct: 122  NLDQFATGLVGTRSPYGKTPCVFNDKYVSGGSSAGSASVVGRGIVPLSLGTDTAGSGRVP 181

Query: 190  AALNNLIGLKPTKGVFSCQGVVPACKSLDCVSIFALNLSDAERCFRIMCQPDPDNDEYSR 249
            AALNNLIGLKPTKG FSC+GVVPACKSLDCVS+FALNLSDAE  F++M +PD   DEYSR
Sbjct: 182  AALNNLIGLKPTKGAFSCRGVVPACKSLDCVSVFALNLSDAEIAFKVMNKPDLLEDEYSR 241

Query: 250  PYVSNPLKKFSSNVTIAIPKNIPWYGETKNPVLFSNAVENLSRTGANVIEIDFEPLLELA 309
             +  NP+ ++  ++TIAIPK +PW+GET+NP L++ AV +L  TGA ++ +DFEPLLELA
Sbjct: 242  EFPKNPISQYPKDLTIAIPKEVPWFGETENPKLYTKAVASLKNTGAKIVVVDFEPLLELA 301

Query: 310  RCLYEGTWVAERYQAIQSFLDSKPPKESLDPTVISIIEGAKKYSAVDCFSFEYKRQGILQ 369
            RCLYEG WVAERY A + FL + PP+ SLD TV++II+GA K+ A D F FEYKRQGILQ
Sbjct: 302  RCLYEGAWVAERYCATRDFLATNPPESSLDETVVNIIKGAVKFDAADAFKFEYKRQGILQ 361

Query: 370  KVRRLLESVDVLCVPTCPLNPTMQQVADEPVLVNSRQGTWTNFVNLADLAALAVPAGFRD 429
            KV  LL+ +DVLCVPTCPLNP +++VA EPVLVNSRQGTWTNFVNLADLAALAVP+GFR 
Sbjct: 362  KVNLLLKDIDVLCVPTCPLNPKLEEVAQEPVLVNSRQGTWTNFVNLADLAALAVPSGFRS 421

Query: 430  DGLPNGITLIGKKFTDYALLELANRYFQNIFPNGSRTYGTFTSSSVKPANDQLVGPDYDP 489
            DGLPNGITLIGKKF+DYALL+LA R+F   FPN SRTYG F    +    D+L GP  D 
Sbjct: 422  DGLPNGITLIGKKFSDYALLDLAKRFFSVAFPNNSRTYGKFVDRRIT-VEDELDGPSKDT 480

Query: 490  STSIKLAVVGAHLKGLPLHWQLEKVNATYLCTTKTSKAYQLFALPKNGPVLKPGLRRVQD 549
               +KLAVVGAHLKGLPLHWQL+K NATYL + KTS  Y+L+ALPK GPVLKPGLRRV D
Sbjct: 481  LNGVKLAVVGAHLKGLPLHWQLQKCNATYLSSPKTSNNYKLYALPKVGPVLKPGLRRVND 540

Query: 550  SNGSQIELEVYSVPKELFGAFISMVPEPLGIGSVELESGEWIKSFICEESGYKAKGTVDI 609
              GSQI+LEVYSVP + FG FI+MVPEPLGIGSVELESGEW+KSFICEE GY  +GTVDI
Sbjct: 541  GTGSQIQLEVYSVPYDRFGDFIAMVPEPLGIGSVELESGEWVKSFICEEFGYTQQGTVDI 600

Query: 610  TKYGGFRAYFEMLXXXXXXXXXLFDTVLIANRGEIAVRIIKTLKKLGIRSVAVYSDPDKY 669
            TK+GGF+ Y E +          F+TVLIANRGEIAVRI+KTLK++GI+SVAVYSDPDKY
Sbjct: 601  TKFGGFKPYIEHIQVTEAQKKKPFETVLIANRGEIAVRIMKTLKRMGIKSVAVYSDPDKY 660

Query: 670  SQHVTDADVSVPLHGTTAAQTYLDMNKIIDAAKQTNAQAIIPGYGFLSENADFSDACTSA 729
            SQHVTDAD SV LHG TAA+TYLD++KII+AAK+T AQAIIPGYGFLSENADFSD C+  
Sbjct: 661  SQHVTDADFSVALHGRTAAETYLDIDKIINAAKKTGAQAIIPGYGFLSENADFSDRCSQE 720

Query: 730  GITFVGPSGDIIRGLGLKHSARQIAQKAGVPLVPGSLLITSXXXXXXXXXXLEYPVMVKS 789
             I FVGPSGD IR LGLKHSAR+IA++A VPLVPGS LI            LEYPVMVKS
Sbjct: 721  NIVFVGPSGDAIRKLGLKHSAREIAERAKVPLVPGSGLIKDAKEAKEVAKKLEYPVMVKS 780

Query: 790  TAGGGGIGLQKVDSEEDIEHIFETVKHQGETFFGDAGVFLERFIENARHVEVQLMGDGFG 849
            TAGGGGIGLQKVDSE+DIE +FETV+HQG+++FGDAGVF+ERF+ NARHVE+Q+MGDGFG
Sbjct: 781  TAGGGGIGLQKVDSEDDIERVFETVQHQGKSYFGDAGVFMERFVNNARHVEIQMMGDGFG 840

Query: 850  KAIALGERDCSLQRRNQKVIEETPAPNLPEKTRLALRKAAESLGSLLNYKCAGTVEFIYD 909
            KAIA+GERDCSLQRRNQKVIEETPAPNLPE TR  +R A+E LGSLL YKCAGTVEFIYD
Sbjct: 841  KAIAIGERDCSLQRRNQKVIEETPAPNLPEATRAKMRAASERLGSLLKYKCAGTVEFIYD 900

Query: 910  EKKDEFYFLEVNTRLQVEHPITEMVTGLDLVEWMIRIAANDAPDFDSTKVEVNGVSMEAR 969
            E++DEFYFLEVN RLQVEHPITEMVTGLDLVEWM+RIAAND+PDFD+TK+EV+G S+EAR
Sbjct: 901  EQRDEFYFLEVNARLQVEHPITEMVTGLDLVEWMLRIAANDSPDFDNTKIEVSGASIEAR 960

Query: 970  LYAENPLKNFRPSPGLLVDVKFPDWARVDTWVKKGTNISPEYDPTLAKIIVHGKDRDDAI 1029
            LYAENP+K+FRPSPG L  V FP WARVDTWVKKGTN+S EYDPTLAKIIVHGKDR+DAI
Sbjct: 961  LYAENPVKDFRPSPGQLTSVSFPSWARVDTWVKKGTNVSAEYDPTLAKIIVHGKDRNDAI 1020

Query: 1030 SKLNQALEETKVYGCITNIDYLKSIITSDFFAKAKVSTNILNSYQYEPTAIEITLPGAHT 1089
             KLNQAL ET VYGCITNIDYL+SI +S  F +AKV+T +L+S+ Y+P A E+  PGA+T
Sbjct: 1021 MKLNQALNETAVYGCITNIDYLRSIASSKMFKEAKVATKVLDSFDYKPCAFEVLAPGANT 1080

Query: 1090 SIQDYPGRVGYWRIGVPPSGPMDAYSFRLANRIVGNDYRTPAIEVTLTGPSIVFHCETVI 1149
            S+QDYPGR GYWRIGVPPSGPMD+YSFRLANR+VGN+ ++PA+E+TL GP ++FH ETVI
Sbjct: 1081 SVQDYPGRTGYWRIGVPPSGPMDSYSFRLANRVVGNNSKSPALEITLNGPKLLFHTETVI 1140

Query: 1150 AITGGTALCTLDGQEIPQHKPVEVKRGSTLSIGKLTSGCRAYLGIRGGIDVPKYLGSYST 1209
            A++GGT  CTL+  +I Q++P+EVKRG  LS+GK+T GCRAYL IRGGIDVP+YLGS ST
Sbjct: 1141 AVSGGTVSCTLNDAQIAQNEPIEVKRGDILSVGKVTVGCRAYLSIRGGIDVPEYLGSRST 1200

Query: 1210 FTLGNVGGYNGRVLKLGDVLFLPSNEENKSVECL------PQNIPQSLIPQISETKEWRI 1263
            F +GN+GGYNGR+LKLGDVLFL  N+   SV  L      PQ  P+SL+P +S  K+W+I
Sbjct: 1201 FAMGNMGGYNGRILKLGDVLFL--NQPELSVSSLPAPDFEPQAAPKSLLPTLSTNKDWKI 1258

Query: 1264 GVTCGPHGSPDFFKPESIEEFFSEKWKVHYNSNRFGVRLIGPKPKWARSNGGEGGMHPSN 1323
            GVTCGPHGS D FK E IE+FF++KWKVHYNSNRFGVRLIGPKPKWARS+GGE G+HPSN
Sbjct: 1259 GVTCGPHGSIDLFKEEYIEQFFNDKWKVHYNSNRFGVRLIGPKPKWARSDGGEAGLHPSN 1318

Query: 1324 THDYVYSLGAINFTGDEPVIITCDGPSLGGFVCQAVVPEAELWKVGQVKPGDSIQFVPLS 1383
             HDYVYSLGAINFTGDEPVIITCDGPSLGGFVCQAVV EAELWKVGQ+ PGD+IQFVPLS
Sbjct: 1319 AHDYVYSLGAINFTGDEPVIITCDGPSLGGFVCQAVVAEAELWKVGQLTPGDTIQFVPLS 1378

Query: 1384 YESSRSLKESQDVAIKSLDGTKLRRLDSVSILPSFETPILAQMEKVNELSPKVVYRQAGD 1443
            Y  +R LKESQD +I + +   L  L    ILP +E PILA + K ++LSPKV YRQAGD
Sbjct: 1379 YGVARQLKESQDKSIDNFEEGSLLELSDDKILPKYENPILAVLPKKSDLSPKVTYRQAGD 1438

Query: 1444 RYVLVEYGDNEMNFNISYRIECLISLVKKNKTIGIVEMSQGVRSVLIEFDGYKVTQKELL 1503
            RY+LVEYG+ E + NI YRI  LI  V++++T+GIVEMSQGVRSVLIEFDG K+ QK LL
Sbjct: 1439 RYILVEYGELEFDLNICYRINRLIHQVERHQTVGIVEMSQGVRSVLIEFDGSKINQKALL 1498

Query: 1504 KVLVAYETEIQFDENWKITSNIIRLPMAFEDSKTLACVQRYQETIRSSAPWLPNNVDFIA 1563
            K L+AYE+EIQFD+NW + S I +LPMAFEDSKTL CV RY+ETIRS APWLPNNVDFIA
Sbjct: 1499 KCLIAYESEIQFDKNWNVKSKIFKLPMAFEDSKTLDCVTRYRETIRSEAPWLPNNVDFIA 1558

Query: 1564 NVNGISRNEVYDMLYSARFMVLGLGDVFLGSPCAVPLDPRHRFLGSKYNPSRTYTERGAV 1623
            +VN I RN+V +MLYSA+FMVLGLGDVFLGSPCAVPLDPRHR+LG+KYNPSRTYT RG V
Sbjct: 1559 DVNDIDRNDVKNMLYSAKFMVLGLGDVFLGSPCAVPLDPRHRYLGTKYNPSRTYTARGVV 1618

Query: 1624 GIGGMYMCIY-AANSPGGYQLVGRTIPIWDKLCLAASS-EVPWLMNPFDQVEFYPVSEED 1681
            GIGGMYMCIY A  SPGGYQLVGRTI  WDKL +     + PWL+ PFDQVEFYPV+EE+
Sbjct: 1619 GIGGMYMCIYNAEGSPGGYQLVGRTITAWDKLVIGDHPIDHPWLLTPFDQVEFYPVTEEE 1678

Query: 1682 LDKMTEDCDNGVYKVNIEKSVFDHQEYLRWINANKDSITAFQEGQLGERAEEFAKLIQNA 1741
            L+ + ED DNG +K+++E+S+FDH+EYL WIN N DSI AFQE Q GE+A+EFA+LIQ A
Sbjct: 1679 LEVIIEDNDNGKFKIDVEESIFDHKEYLAWINENIDSIVAFQEAQGGEKADEFARLIQVA 1738

Query: 1742 NSELKESVTVKPDEEEDFPEGAEIVYSEYSGRFWKSIASVGDVIEAGQGLLIIEAMKAEM 1801
            N+ELK+S   KP + E++P+ AE++YSEY+GRFWK +A+VGD +EAG G++IIEAMK EM
Sbjct: 1739 NAELKKSGDDKPQDVEEYPDDAELLYSEYTGRFWKPVAAVGDHVEAGDGVIIIEAMKTEM 1798

Query: 1802 I 1802
            +
Sbjct: 1799 V 1799

>Kwal_27.11951
          Length = 1869

 Score = 2697 bits (6990), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1282/1798 (71%), Positives = 1491/1798 (82%), Gaps = 10/1798 (0%)

Query: 12   SLGWSIQDWIDFHKSSSSQASLRLLESLLDSQNVAPVDNAWISLISKENLLHQFQILKSR 71
            +LGWS+QDW+ FH  ++ +ASL  L +L+ +Q  AP D AWISL+S+E+L HQ++IL+S+
Sbjct: 45   TLGWSVQDWLGFHAEATPEASLAALSALIGAQKSAPEDPAWISLVSQEHLEHQWRILQSK 104

Query: 72   ENKETLPLYGVPIAVKDNIDVRGLPTTAACPSFAYEPSKDSKVVELLRNAGAIIVGKTNL 131
             +K+ LPLYGVPIAVKDNID  G  TTAACP FAY PS DS VV LLR+AGAI++GKTNL
Sbjct: 105  GDKKELPLYGVPIAVKDNIDATGCETTAACPEFAYTPSNDSTVVALLRDAGAIVIGKTNL 164

Query: 132  DQFATGLVGTRSPYGKTPCAFSKEHXXXXXXXXXXXXXXRGIVPIALGTDTAGSGRVPAA 191
            DQFATGLVGTRSPYGKTPC FS EH              RGIVP+ALGTDTAGSGRVPAA
Sbjct: 165  DQFATGLVGTRSPYGKTPCVFSNEHVSGGSSAGSASVVGRGIVPLALGTDTAGSGRVPAA 224

Query: 192  LNNLIGLKPTKGVFSCQGVVPACKSLDCVSIFALNLSDAERCFRIMCQPDPDNDEYSRPY 251
            LNNLIGLKP+KGVFSC GVVPACKSLDCVSIFALNL DAERCF++M QPD + DEYSR  
Sbjct: 225  LNNLIGLKPSKGVFSCSGVVPACKSLDCVSIFALNLGDAERCFKVMAQPDTEKDEYSRAM 284

Query: 252  VSNPLKKFSSNVTIAIPKNIPWYGETKNPVLFSNAVENLSRTGANVIEIDFEPLLELARC 311
             +NPL+K++ + TIA+P  +PWY ET+N V ++ A+ENL +TGA V+E+DFEPLLELARC
Sbjct: 285  PANPLQKYAKDATIAVPTKLPWYDETENFVHYAAAIENLKKTGAKVVEVDFEPLLELARC 344

Query: 312  LYEGTWVAERYQAIQSFLDSKPPKESLDPTVISIIEGAKKYSAVDCFSFEYKRQGILQKV 371
            LYEG WVAERY+A + F    P + SLDPTV  II+G   Y A D F +EYKRQGILQKV
Sbjct: 345  LYEGAWVAERYEATRDFFAKNPSESSLDPTVTKIIKGGANYDAADAFRYEYKRQGILQKV 404

Query: 372  RRLLESVDVLCVPTCPLNPTMQQVADEPVLVNSRQGTWTNFVNLADLAALAVPAGFRDDG 431
             +LLE++DVLCVPTCP NPT  Q+   PV +NSRQGTWTNFVNLADLAALAVP GFR DG
Sbjct: 405  SKLLETIDVLCVPTCPHNPTFAQLEAMPVEMNSRQGTWTNFVNLADLAALAVPCGFRSDG 464

Query: 432  LPNGITLIGKKFTDYALLELANRYFQNIFPNGSRTYGTFTSSSVKPANDQLVGPDYDPST 491
            LP GITLIGK FTDYALLELANRYFQ  FPN SRTYG F  + +    D L GP +    
Sbjct: 465  LPTGITLIGKTFTDYALLELANRYFQIAFPNNSRTYGKFLETPIT-TQDNLQGPPFSTED 523

Query: 492  SIKLAVVGAHLKGLPLHWQLEKVNATYLCTTKTSKAYQLFALPKNGPVLKPGLRRVQDSN 551
            SIKLAVVGAHLKGLPLHWQLEKVNA Y+ + KTS  Y+L+ALPK GPVLKPGLRRV    
Sbjct: 524  SIKLAVVGAHLKGLPLHWQLEKVNAQYIGSPKTSPNYRLYALPKTGPVLKPGLRRVDSEG 583

Query: 552  GSQIELEVYSVPKELFGAFISMVPEPLGIGSVELESGEWIKSFICEESGYKAKGTVDITK 611
            G+QI+LEVYSVPK+ FG FISMVPEPLGIGSVELESGEW+KSFICEE GY   GT DIT+
Sbjct: 584  GAQIQLEVYSVPKDQFGTFISMVPEPLGIGSVELESGEWVKSFICEEFGYTQDGTKDITE 643

Query: 612  YGGFRAYFEMLXXXXXXXXXLFDTVLIANRGEIAVRIIKTLKKLGIRSVAVYSDPDKYSQ 671
             G F+ Y + L          F+TVL+ANRGEIAVRIIKTLKKL I+SVAVYSDPDKYSQ
Sbjct: 644  LGSFKTYVDQLAREESEKKKPFETVLVANRGEIAVRIIKTLKKLKIKSVAVYSDPDKYSQ 703

Query: 672  HVTDADVSVPLHGTTAAQTYLDMNKIIDAAKQTNAQAIIPGYGFLSENADFSDACTSAGI 731
            HVTDADV+V L G TAA+TYLD++KII AAK+T  +AIIPGYGFLSENADFSD C S GI
Sbjct: 704  HVTDADVAVALKGRTAAETYLDIDKIIAAAKETGTEAIIPGYGFLSENADFSDRCASEGI 763

Query: 732  TFVGPSGDIIRGLGLKHSARQIAQKAGVPLVPGSLLITSXXXXXXXXXXLEYPVMVKSTA 791
             FVGP+GD IR LGLKHSAR+IA+KAGVPLVPGS L+ +          LEYPVMVKSTA
Sbjct: 764  VFVGPAGDAIRKLGLKHSAREIAEKAGVPLVPGSGLVKTPQEAREIAKALEYPVMVKSTA 823

Query: 792  GGGGIGLQKVDSEEDIEHIFETVKHQGETFFGDAGVFLERFIENARHVEVQLMGDGFGKA 851
            GGGGIGLQKVDSEEDIE +FETV+HQG+ +FGD+GVFLERF+ENARHVE+Q+MGDG GKA
Sbjct: 824  GGGGIGLQKVDSEEDIERVFETVQHQGKAYFGDSGVFLERFVENARHVEIQMMGDGKGKA 883

Query: 852  IALGERDCSLQRRNQKVIEETPAPNLPEKTRLALRKAAESLGSLLNYKCAGTVEFIYDEK 911
            IA+GERDCSLQRRNQKVIEETPAPNL EKTR  +R+A+E+LGSLL Y+CAGTVEFIYDE+
Sbjct: 884  IAIGERDCSLQRRNQKVIEETPAPNLSEKTRARMREASENLGSLLKYRCAGTVEFIYDER 943

Query: 912  KDEFYFLEVNTRLQVEHPITEMVTGLDLVEWMIRIAANDAPDFDSTKVEVNGVSMEARLY 971
            +DEFYFLEVN RLQVEHPITEMVTGLDLVEWM+ IAA   PDFD+TK+ V G S+EARLY
Sbjct: 944  RDEFYFLEVNARLQVEHPITEMVTGLDLVEWMLLIAAGTPPDFDATKITVTGASIEARLY 1003

Query: 972  AENPLKNFRPSPGLLVDVKFPDWARVDTWVKKGTNISPEYDPTLAKIIVHGKDRDDAISK 1031
            AENP+K+FRPSPG L DV FP+WARVDTWV KGT IS EYDPTLAKIIVHGKDRD+AI K
Sbjct: 1004 AENPVKDFRPSPGQLTDVSFPEWARVDTWVSKGTTISAEYDPTLAKIIVHGKDRDEAIQK 1063

Query: 1032 LNQALEETKVYGCITNIDYLKSIITSDFFAKAKVSTNILNSYQYEPTAIEITLPGAHTSI 1091
            LNQAL ET +YGCITNIDYL+SI +S+ F  AKV+T +L+SY Y P+A EIT PGA+T++
Sbjct: 1064 LNQALNETSIYGCITNIDYLRSIASSEMFKTAKVATKVLDSYDYRPSAFEITSPGAYTTV 1123

Query: 1092 QDYPGRVGYWRIGVPPSGPMDAYSFRLANRIVGNDYRTPAIEVTLTGPSIVFHCETVIAI 1151
            QDYPGRV +WRIGVPPSGPMD+YSFRLANRIVGN Y+ PAIE+TL GP ++FH + VIAI
Sbjct: 1124 QDYPGRVRHWRIGVPPSGPMDSYSFRLANRIVGNHYKAPAIEITLNGPKLLFHTDAVIAI 1183

Query: 1152 TGGTALCTLDGQEIPQHKPVEVKRGSTLSIGKLTSGCRAYLGIRGGIDVPKYLGSYSTFT 1211
            TG  A CT++G ++ Q+KP+ VK+G  L++GKL+ GCRAYL IRGGIDVP+YLGS STF 
Sbjct: 1184 TGAKAPCTINGSDVSQNKPLSVKKGDQLTVGKLSDGCRAYLAIRGGIDVPEYLGSRSTFA 1243

Query: 1212 LGNVGGYNGRVLKLGDVLFLPSNEENKSVECLPQNI------PQSLIPQISETKEWRIGV 1265
            LGN+GGYNGRVLKLGDVLFL  N+       +P  +      P SL+P IS +KEW+IGV
Sbjct: 1244 LGNMGGYNGRVLKLGDVLFL--NQPELPSSGIPAPVYDPSEPPASLLPAISGSKEWKIGV 1301

Query: 1266 TCGPHGSPDFFKPESIEEFFSEKWKVHYNSNRFGVRLIGPKPKWARSNGGEGGMHPSNTH 1325
            TCGPHGSPDFFKPES+EEFFSE+WKVHYNSNRFGVRLIGPKPKWAR +GGEGG+HPSN H
Sbjct: 1302 TCGPHGSPDFFKPESVEEFFSEQWKVHYNSNRFGVRLIGPKPKWARKDGGEGGLHPSNAH 1361

Query: 1326 DYVYSLGAINFTGDEPVIITCDGPSLGGFVCQAVVPEAELWKVGQVKPGDSIQFVPLSYE 1385
            DYVYSLGAINFTGDEPVIIT DGPSLGGFVCQAVVPE ELWKVGQVKPGD IQFVP+SYE
Sbjct: 1362 DYVYSLGAINFTGDEPVIITADGPSLGGFVCQAVVPEGELWKVGQVKPGDLIQFVPVSYE 1421

Query: 1386 SSRSLKESQDVAIKSLDGTKLRRLDSVSILPSFETPILAQMEKVNELSPKVVYRQAGDRY 1445
            ++R LKESQD AI++ +   LR L S  +LP+ E P+LAQ+ + +E SPKV YRQAGDRY
Sbjct: 1422 TARVLKESQDQAIETFENGSLRTLTSELVLPAAENPVLAQLPRYSEFSPKVTYRQAGDRY 1481

Query: 1446 VLVEYGDNEMNFNISYRIECLISLVKKNKTIGIVEMSQGVRSVLIEFDGYKVTQKELLKV 1505
            VLVEYG+NEM+ NISYR+  LI+LV+KNKTIGIVEMSQGVRSVL+EFDGYK++QK LL+ 
Sbjct: 1482 VLVEYGENEMDLNISYRVNRLINLVEKNKTIGIVEMSQGVRSVLVEFDGYKISQKALLET 1541

Query: 1506 LVAYETEIQFDENWKITSNIIRLPMAFEDSKTLACVQRYQETIRSSAPWLPNNVDFIANV 1565
            L+AYE EI+FD NW I S + +LP+AFEDS+TL CV+RYQETIRS APWLPNNVDFIA+V
Sbjct: 1542 LIAYEGEIKFDRNWSIKSKVFKLPLAFEDSETLECVKRYQETIRSKAPWLPNNVDFIADV 1601

Query: 1566 NGISRNEVYDMLYSARFMVLGLGDVFLGSPCAVPLDPRHRFLGSKYNPSRTYTERGAVGI 1625
            NGIS ++V DMLY ARF+VLGLGDVFLG+PCAVPL+P HRFLGSKYNPSRTYT+ G VGI
Sbjct: 1602 NGISHSDVEDMLYQARFLVLGLGDVFLGAPCAVPLNPTHRFLGSKYNPSRTYTKNGTVGI 1661

Query: 1626 GGMYMCIYAANSPGGYQLVGRTIPIWDKLCLAA-SSEVPWLMNPFDQVEFYPVSEEDLDK 1684
            GGMYMCIYA +SPGGYQLVGRTIPIWDKL L A SS+ PWL+ PFDQVE+Y V+E++L+K
Sbjct: 1662 GGMYMCIYAMDSPGGYQLVGRTIPIWDKLQLGAHSSQHPWLLTPFDQVEYYQVTEDELNK 1721

Query: 1685 MTEDCDNGVYKVNIEKSVFDHQEYLRWINANKDSITAFQEGQLGERAEEFAKLIQNANSE 1744
             TE+C+NG + V +E+S FDH EYL+WI+AN + I  FQ  Q GE+AEEFAKLIQ +N+E
Sbjct: 1722 FTEECENGQFPVQVEESTFDHGEYLKWIDANSEIIKEFQNKQNGEKAEEFAKLIQESNAE 1781

Query: 1745 LKESVTVKPDEEEDFPEGAEIVYSEYSGRFWKSIASVGDVIEAGQGLLIIEAMKAEMI 1802
            L+++   +   EE+FPE AE+VYSEYSGRFWK + SVGDV++AG GL+++EAMK EM+
Sbjct: 1782 LEKAPDSQGAVEEEFPEDAEMVYSEYSGRFWKPLVSVGDVVKAGDGLIVVEAMKTEMM 1839

>Scas_721.40
          Length = 1834

 Score = 2647 bits (6861), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1248/1804 (69%), Positives = 1494/1804 (82%), Gaps = 11/1804 (0%)

Query: 5    SDTTAEISLGWSIQDWIDFHKSSSSQASLRLLESLLDSQNVAPVDNAWISLISKENLLHQ 64
            ++  A+ +LGWSI+DWI+FH+S ++  S + L+ L++ Q +AP D AW+SL S + L  Q
Sbjct: 2    TNNIAKKTLGWSIKDWIEFHQSVTADESFKQLQYLVECQQIAPTDPAWLSLCSADTLKKQ 61

Query: 65   FQILKSRENKETLPLYGVPIAVKDNIDVRGLPTTAACPSFAYEPSKDSKVVELLRNAGAI 124
            +QIL+ R  KE+LPLYGVP+A+KDNID RG PTTAACPSF YEP KDSKVV+LLRNAGAI
Sbjct: 62   WQILQHRSGKESLPLYGVPVAIKDNIDARGFPTTAACPSFLYEPEKDSKVVKLLRNAGAI 121

Query: 125  IVGKTNLDQFATGLVGTRSPYGKTPCAFSKEHXXXXXXXXXXXXXXRGIVPIALGTDTAG 184
            I+GKTNLDQFATGLVGTRSPYGKTPC FS +H              RGIVPIALGTDTAG
Sbjct: 122  IIGKTNLDQFATGLVGTRSPYGKTPCVFSDKHVSGGSSAGSASVVARGIVPIALGTDTAG 181

Query: 185  SGRVPAALNNLIGLKPTKGVFSCQGVVPACKSLDCVSIFALNLSDAERCFRIMCQPDPDN 244
            SGRVPAALNNLIGLKPTKG FSCQGVVPACKSLDCVS+F+LNLSDAE CF+I+C+ D +N
Sbjct: 182  SGRVPAALNNLIGLKPTKGTFSCQGVVPACKSLDCVSVFSLNLSDAECCFKILCESDLEN 241

Query: 245  DEYSRPYVSNPLKKFSSNVTIAIPKNIPWYGETKNPVLFSNAVENLSRTGANVIEIDFEP 304
            DEYSR Y  +PL+KFS +VTI IPK++ WYGE +NPVL+ NA++ L ++GAN+ +IDFEP
Sbjct: 242  DEYSRTYPRSPLRKFSDSVTIGIPKDLLWYGEEENPVLYDNAIKQLEKSGANITKIDFEP 301

Query: 305  LLELARCLYEGTWVAERYQAIQSFLDSKPPKESLDPTVISIIEGAKKYSAVDCFSFEYKR 364
            LLELARCLYEG WVAERY A++ FL   P  +  D  V SII+ AKK+SAVD F FEYKR
Sbjct: 302  LLELARCLYEGPWVAERYSAVKDFLQKNPSSKGFDHVVKSIIDSAKKFSAVDAFQFEYKR 361

Query: 365  QGILQKVRRLLESVDVLCVPTCPLNPTMQQVADEPVLVNSRQGTWTNFVNLADLAALAVP 424
            QG+LQK+ +LLE++D LCVPTCPLNPT + V++EP+LVNSRQGTWTNFVNLAD+AALA+P
Sbjct: 362  QGLLQKIDKLLENIDALCVPTCPLNPTFEDVSNEPILVNSRQGTWTNFVNLADMAALAIP 421

Query: 425  AGFRDDGLPNGITLIGKKFTDYALLELANRYFQNIFPNGSRTYGTFTSSSVKPANDQLVG 484
            +GFR DGLP GITLIGKKFTD+ALL+LA  YFQ  +PN SRT+G FT   V+  +D++ G
Sbjct: 422  SGFRSDGLPTGITLIGKKFTDFALLDLAQMYFQIAYPNNSRTFGIFTEG-VEINDDKVSG 480

Query: 485  PDYDPSTSIKLAVVGAHLKGLPLHWQLEKVNATYLCTTKTSKAYQLFALPKNGPVLKPGL 544
            P    S SIKLAVVGAHLKGLPLHWQLEKVNAT++ +TKTSK Y+L+ALP+ GP+LKPGL
Sbjct: 481  PVISSSDSIKLAVVGAHLKGLPLHWQLEKVNATFISSTKTSKNYELYALPRTGPILKPGL 540

Query: 545  RRVQDSNGSQIELEVYSVPKELFGAFISMVPEPLGIGSVELESGEWIKSFICEESGYKAK 604
            RRV +  G  I++E YS+P E FG FISMVPEPLGIGSVELE+GEW+KSFICEESGY AK
Sbjct: 541  RRVNEE-GFAIQVETYSIPVENFGTFISMVPEPLGIGSVELENGEWVKSFICEESGYTAK 599

Query: 605  GTVDITKYGGFRAYFEMLXXXXXXXXXLFDTVLIANRGEIAVRIIKTLKKLGIRSVAVYS 664
            G+V+ITKYGGF+ Y + L          F TVL+ANRGEIAVRIIKTLKK+ I+SVA++S
Sbjct: 600  GSVNITKYGGFKTYLKFLETNTKTKKP-FTTVLVANRGEIAVRIIKTLKKMEIQSVAIFS 658

Query: 665  DPDKYSQHVTDADVSVPLHGTTAAQTYLDMNKIIDAAKQTNAQAIIPGYGFLSENADFSD 724
             PD+YSQHV DAD++V L G +AA TYL++ KIIDAAK+T AQAIIPGYGFLSENADFS+
Sbjct: 659  TPDRYSQHVIDADLTVDLKGVSAADTYLNIEKIIDAAKKTGAQAIIPGYGFLSENADFSE 718

Query: 725  ACTSAGITFVGPSGDIIRGLGLKHSARQIAQKAGVPLVPGSLLITSXXXXXXXXXXLEYP 784
             C + GITFVGPSGD++RGLGLKHSAR+IA+KA VPLVPGS LIT+          LEYP
Sbjct: 719  RCDAEGITFVGPSGDVMRGLGLKHSAREIAKKANVPLVPGSSLITTAHEAKEIAAKLEYP 778

Query: 785  VMVKSTAGGGGIGLQKVDSEEDIEHIFETVKHQGETFFGDAGVFLERFIENARHVEVQLM 844
            +MVKSTAGGGGIGLQKV+SE+DIE IFETVKHQG  +FGD+GVF+ERFIENARHVEVQ+M
Sbjct: 779  IMVKSTAGGGGIGLQKVESEDDIERIFETVKHQGAAYFGDSGVFMERFIENARHVEVQIM 838

Query: 845  GDGFGKAIALGERDCSLQRRNQKVIEETPAPNLPEKTRLALRKAAESLGSLLNYKCAGTV 904
            GDG G A+A+GERDCSLQRRNQK+IEETPAPNLPE TR  LR+AA+ LGSLL YKCAGTV
Sbjct: 839  GDGLGNALAIGERDCSLQRRNQKIIEETPAPNLPETTRQKLREAAQRLGSLLKYKCAGTV 898

Query: 905  EFIYDEKKDEFYFLEVNTRLQVEHPITEMVTGLDLVEWMIRIAANDAPDFDSTKVEVNGV 964
            EFIYDE +DEFYFLEVNTRLQVEHPITEMVTG+DLVEWM+ IAA+ APDF+  K++VNGV
Sbjct: 899  EFIYDEIRDEFYFLEVNTRLQVEHPITEMVTGIDLVEWMLVIAADMAPDFNQLKIDVNGV 958

Query: 965  SMEARLYAENPLKNFRPSPGLLVDVKFPDWARVDTWVKKGTNISPEYDPTLAKIIVHGKD 1024
            +MEARLYAENP+ +F+PSPG LV+V+FP WAR+DTWV KGT ++PEYDPTLAKIIVHGKD
Sbjct: 959  AMEARLYAENPVHDFKPSPGQLVEVEFPKWARIDTWVSKGTIVTPEYDPTLAKIIVHGKD 1018

Query: 1025 RDDAISKLNQALEETKVYGCITNIDYLKSIITSDFFAKAKVSTNILNSYQYEPTAIEITL 1084
            R DA+ KLN+AL ETKV GCITNIDYL+SI +S+ F  AKVSTNILNSY Y+P+A+EI L
Sbjct: 1019 RHDALEKLNKALVETKVSGCITNIDYLRSISSSEMFRDAKVSTNILNSYDYKPSAMEIIL 1078

Query: 1085 PGAHTSIQDYPGRVGYWRIGVPPSGPMDAYSFRLANRIVGNDYRTPAIEVTLTGPSIVFH 1144
            PG+HTSIQDYPGR G WRIGVPPSGPMDA+SFRLAN+IVGN+++ PA E+TL GP+I+FH
Sbjct: 1079 PGSHTSIQDYPGRKGCWRIGVPPSGPMDAFSFRLANKIVGNNHKAPAFEITLNGPTILFH 1138

Query: 1145 CETVIAITGGTALCTLDGQEIPQHKPVEVKRGSTLSIGKLTSGCRAYLGIRGGIDVPKYL 1204
             + +I ITGG  +C L+  +I Q KP+ V  G  LSIGKL +GCRAYL IRGG+DVP+YL
Sbjct: 1139 IDAIIGITGGACVCQLNNTQIEQFKPIHVTSGDKLSIGKLLTGCRAYLAIRGGVDVPEYL 1198

Query: 1205 GSYSTFTLGNVGGYNGRVLKLGDVLFLPSNEENKSVECLP------QNIPQSLIPQISET 1258
            GS STFTLGN GGY+GR LK+GD LF+  N+ NK V  LP      Q +  SL+P +   
Sbjct: 1199 GSKSTFTLGNFGGYSGRCLKMGDTLFIDQNKLNKYV--LPGHNYSDQPLSYSLLPDMPTD 1256

Query: 1259 KEWRIGVTCGPHGSPDFFKPESIEEFFSEKWKVHYNSNRFGVRLIGPKPKWARSNGGEGG 1318
            K+W+IGV CGPHGSPDFFKPE ++ FFSEKWKVHYNSNRFGVRL GPKP WAR +GGEGG
Sbjct: 1257 KQWKIGVLCGPHGSPDFFKPEYVDSFFSEKWKVHYNSNRFGVRLSGPKPVWARKDGGEGG 1316

Query: 1319 MHPSNTHDYVYSLGAINFTGDEPVIITCDGPSLGGFVCQAVVPEAELWKVGQVKPGDSIQ 1378
            +HPSN HDYVYSLGAINFTGDEPVI+TCDGPSLGGFVC AVV E+ELWKVGQVKPGD IQ
Sbjct: 1317 LHPSNAHDYVYSLGAINFTGDEPVIVTCDGPSLGGFVCHAVVAESELWKVGQVKPGDYIQ 1376

Query: 1379 FVPLSYESSRSLKESQDVAIKSLDGTKLRRLDSVSILPSFETPILAQMEKVNELSPKVVY 1438
            FVP+S+ES+R L +SQDVAI +L+   L+ LD +  LP+ E P+L  + +   +SP++ Y
Sbjct: 1377 FVPISFESARELMKSQDVAINTLEPKSLKTLDDIITLPTPEDPVLRLLPERPGISPRITY 1436

Query: 1439 RQAGDRYVLVEYGDNEMNFNISYRIECLISLVKKNKTIGIVEMSQGVRSVLIEFDGYKVT 1498
            RQAGDRY+LVEYG+N M+ NI YRI  LI LV    T GIVEMSQGVRSVLIEFD Y ++
Sbjct: 1437 RQAGDRYILVEYGENIMDLNICYRIHSLIGLVDDYNTAGIVEMSQGVRSVLIEFDPYVIS 1496

Query: 1499 QKELLKVLVAYETEIQFDENWKITSNIIRLPMAFEDSKTLACVQRYQETIRSSAPWLPNN 1558
            Q +LL +L+AYE E+ + ENW + S +IRLPMAFEDSKT+ACV RYQETIRSSAPWLPNN
Sbjct: 1497 QTQLLTLLLAYEEELPYTENWTVNSKVIRLPMAFEDSKTMACVARYQETIRSSAPWLPNN 1556

Query: 1559 VDFIANVNGISRNEVYDMLYSARFMVLGLGDVFLGSPCAVPLDPRHRFLGSKYNPSRTYT 1618
             DF+AN+NGI+  +VYD++YSARFMVLGLGDVFLGSPCAVPLDPRHR LGSKYNPSRT+T
Sbjct: 1557 ADFVANINGITHKDVYDLVYSARFMVLGLGDVFLGSPCAVPLDPRHRLLGSKYNPSRTFT 1616

Query: 1619 ERGAVGIGGMYMCIYAANSPGGYQLVGRTIPIWDKLCLAASSEVPWLMNPFDQVEFYPVS 1678
            ERGAVG+GGM+MCIYAA+SPGGYQL+GRTIPIWDKL L +SSE PWL+NPFDQ+EFYPVS
Sbjct: 1617 ERGAVGLGGMFMCIYAASSPGGYQLMGRTIPIWDKLLLLSSSEQPWLLNPFDQIEFYPVS 1676

Query: 1679 EEDLDKMTEDCDNGVYKVNIEKSVFDHQEYLRWINANKDSITAFQEGQLGERAEEFAKLI 1738
            E++LD++T+D D G Y V+  K  F+H +YL+W++ N  SIT FQ  Q GE AE+FAKLI
Sbjct: 1677 EKELDRLTDDFDYGKYIVDSRKEKFNHMDYLKWVDENSKSITEFQLLQEGENAEKFAKLI 1736

Query: 1739 QNANSELKESVTVKPDEEEDFPEGAEIVYSEYSGRFWKSIASVGDVIEAGQGLLIIEAMK 1798
            + +N+EL E+  ++ D+  D+PE + ++YSEYSGRFWK + + G+ +++GQGL+IIEAMK
Sbjct: 1737 ELSNAELDENDEIEKDQVNDYPENSVMIYSEYSGRFWKPLVTEGEFVKSGQGLIIIEAMK 1796

Query: 1799 AEMI 1802
             EM+
Sbjct: 1797 TEML 1800

>CAGL0M05533g complement(588667..594171) similar to sp|P32528
            Saccharomyces cerevisiae YBR208c DUR1 urea amidolyase,
            hypothetical start
          Length = 1834

 Score = 2467 bits (6394), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1156/1795 (64%), Positives = 1420/1795 (79%), Gaps = 5/1795 (0%)

Query: 12   SLGWSIQDWIDFHKSSSSQASLRLLESLLDSQNVAPVDNAWISLISKENLLHQFQILKSR 71
            S+GWSIQDWIDFH  S+ + S   L  L+ +Q +AP D AWIS+ ++  L  Q+Q+L+SR
Sbjct: 9    SIGWSIQDWIDFHFKSTPKDSYESLLELVKNQRIAPEDPAWISVATESLLEQQWQLLQSR 68

Query: 72   ENKETLPLYGVPIAVKDNIDVRGLPTTAACPSFAYEPSKDSKVVELLRNAGAIIVGKTNL 131
              KE LPLYGVPIAVKDNID +G PTTAACPSF+Y P++DS VVELL+ AGAII+GKTNL
Sbjct: 69   HEKEKLPLYGVPIAVKDNIDAKGFPTTAACPSFSYMPTRDSTVVELLKQAGAIIIGKTNL 128

Query: 132  DQFATGLVGTRSPYGKTPCAFSKEHXXXXXXXXXXXXXXRGIVPIALGTDTAGSGRVPAA 191
            DQFATGLVGTRSPYG+TPC FS +H              RGIVPIALGTDTAGSGRVPAA
Sbjct: 129  DQFATGLVGTRSPYGRTPCVFSDKHVSGGSSAGSASVVARGIVPIALGTDTAGSGRVPAA 188

Query: 192  LNNLIGLKPTKGVFSCQGVVPACKSLDCVSIFALNLSDAERCFRIMCQPDPDNDEYSRPY 251
            LNN+IGLKPT+G+FSC GVVPACKSLDCVS+F++NLSDAE+C +IM + D +NDEYSR +
Sbjct: 189  LNNIIGLKPTRGIFSCSGVVPACKSLDCVSVFSMNLSDAEKCLKIMTKLDIENDEYSRSF 248

Query: 252  VSNPLKKFSSNVTIAIPKNIPWYGETKNPVLFSNAVENLSRTGANVIEIDFEPLLELARC 311
             +NPL+ F+ N+T+AIPKN+ WYGE +NP+L+  A++N  + GA +  IDFEPLLELARC
Sbjct: 249  PANPLQSFNKNLTVAIPKNVMWYGEKENPLLYDRAIDNFKQLGAQIKIIDFEPLLELARC 308

Query: 312  LYEGTWVAERYQAIQSFLDSKPPKESLDPTVISIIEGAKKYSAVDCFSFEYKRQGILQKV 371
            LYEGTWVAERY A + FL++ P + +LDP V  II+ A K+ A D F +EYKRQGIL+KV
Sbjct: 309  LYEGTWVAERYAATRKFLETSPQQSTLDPVVYGIIKSATKFDAADAFEYEYKRQGILRKV 368

Query: 372  RRLLESVDVLCVPTCPLNPTMQQVADEPVLVNSRQGTWTNFVNLADLAALAVPAGFRDDG 431
              LL+ +DVLCVPTCPLNP+ ++V  EP+LVNSRQGTWTNFVNLADL+ALA+P GFR DG
Sbjct: 369  EVLLQDIDVLCVPTCPLNPSFEEVDKEPILVNSRQGTWTNFVNLADLSALAIPVGFRSDG 428

Query: 432  LPNGITLIGKKFTDYALLELANRYFQNIFPNGSRTYGTFTSSSVKPANDQLVGPDYDPST 491
            LPNG+TLI KKF DYALL+LA R+   ++P+G+R YG F    V   +D L GP      
Sbjct: 429  LPNGVTLIAKKFEDYALLQLAKRFLAQLYPSGTRPYGMFLDRYVGLKDDSLEGPIVSSDD 488

Query: 492  SIKLAVVGAHLKGLPLHWQLEKVNATYLCTTKTSKAYQLFALPKNGPVLKPGLRRVQDSN 551
            SI LAVVGAHL+GLPLHWQLEKVNAT++C+TKT+K Y+L+ALPKNGPVLKPGLRR+    
Sbjct: 489  SIVLAVVGAHLRGLPLHWQLEKVNATFICSTKTAKKYELYALPKNGPVLKPGLRRITSGT 548

Query: 552  GSQIELEVYSVPKELFGAFISMVPEPLGIGSVELESGEWIKSFICEESGYKAKGTVDITK 611
            GSQIELE+YSVPKE FG FIS VPEPLGIGSVELE+G+W+KSFICEESGY + G++DI+ 
Sbjct: 549  GSQIELELYSVPKEKFGEFISFVPEPLGIGSVELENGKWVKSFICEESGYNSTGSIDISH 608

Query: 612  YGGFRAYFEMLXXXXXXXXXLFDTVLIANRGEIAVRIIKTLKKLGIRSVAVYSDPDKYSQ 671
            YGGFRAY E +          F TVL+ANRGEIAVRIIKTLK + I+S+A+YS  DKYSQ
Sbjct: 609  YGGFRAYIESIIPSNESKKGHFKTVLVANRGEIAVRIIKTLKSMQIKSLAIYSATDKYSQ 668

Query: 672  HVTDADVSVPLHGTTAAQTYLDMNKIIDAAKQTNAQAIIPGYGFLSENADFSDACTSAGI 731
            HV D D++  L G T  +TYL + KII  AK+ +  AIIPGYGFLSENA F+D C   GI
Sbjct: 669  HVLDVDMAQALDGHTVEETYLHVEKIISIAKKYDVDAIIPGYGFLSENASFADRCEQEGI 728

Query: 732  TFVGPSGDIIRGLGLKHSARQIAQKAGVPLVPGSLLITSXXXXXXXXXXLEYPVMVKSTA 791
             F+GP G+ IR LGLKHSAR++A+ AGVPLVPGS L+ +          + YPVMVKSTA
Sbjct: 729  QFIGPRGETIRKLGLKHSAREVAKSAGVPLVPGSPLVKNADEAFTIAKNIGYPVMVKSTA 788

Query: 792  GGGGIGLQKVDSEEDIEHIFETVKHQGETFFGDAGVFLERFIENARHVEVQLMGDGFGKA 851
            GGGGIGLQKVD+E+D+   FETVKHQG ++FGD+GVF+E+FI+NARHVEVQ+MGDG GK 
Sbjct: 789  GGGGIGLQKVDNEQDMRKAFETVKHQGSSYFGDSGVFMEKFIDNARHVEVQIMGDGKGKT 848

Query: 852  IALGERDCSLQRRNQKVIEETPAPNLPEKTRLALRKAAESLGSLLNYKCAGTVEFIYDEK 911
            +ALGERDCSLQRRNQKVIEETPAPNLP +TR  +  AAE LG+ LNY+ AGTVEFIYDE+
Sbjct: 849  LALGERDCSLQRRNQKVIEETPAPNLPRETRQKMLTAAERLGAYLNYRGAGTVEFIYDEQ 908

Query: 912  KDEFYFLEVNTRLQVEHPITEMVTGLDLVEWMIRIAANDAPDFDSTKVEVNGVSMEARLY 971
            +D+FYFLEVNTRLQVEHPITEMVTGLDLVEWMI+I+A   P  D   +  NG S+E R+Y
Sbjct: 909  RDQFYFLEVNTRLQVEHPITEMVTGLDLVEWMIKISAGVMPSLDEFNISQNGASIEVRVY 968

Query: 972  AENPLKNFRPSPGLLVDVKFPDWARVDTWVKKGTNISPEYDPTLAKIIVHGKDRDDAISK 1031
            AENPLK+FRPSPG LVDV+FP+  RVDTWVKKGT ISPE+DPTLAKIIVHGKDR++AI K
Sbjct: 969  AENPLKDFRPSPGELVDVQFPNDCRVDTWVKKGTKISPEFDPTLAKIIVHGKDRNEAILK 1028

Query: 1032 LNQALEETKVYGCITNIDYLKSIITSDFFAKAKVSTNILNSYQYEPTAIEITLPGAHTSI 1091
            + +AL ETK+YGC+TN+DYLKS+I+S+ F  A++STN LN+Y+Y P+A+EI  PGA T+I
Sbjct: 1029 MKKALNETKIYGCVTNVDYLKSLISSEMFRNAQLSTNYLNTYEYSPSAVEIIEPGALTTI 1088

Query: 1092 QDYPGRVGYWRIGVPPSGPMDAYSFRLANRIVGNDYRTPAIEVTLTGPSIVFHCETVIAI 1151
            QDYPGRV YWRIGVPP GPMD YSFRLANRIVGND RTP IE+TLTGP+I F+ +++++I
Sbjct: 1089 QDYPGRVNYWRIGVPPCGPMDNYSFRLANRIVGNDERTPGIEITLTGPTIKFYSDSLVSI 1148

Query: 1152 TGGTALCTLDGQEIPQHKPVEVKRGSTLSIGKLTSGCRAYLGIRGGIDVPKYLGSYSTFT 1211
             GG   C LD ++IP  +P+ VK GS LSIGK+  G RAYL IRGGIDVPKY+GS+STFT
Sbjct: 1149 AGGEVCCKLDEKKIPMFEPISVKTGSVLSIGKIVKGSRAYLAIRGGIDVPKYMGSFSTFT 1208

Query: 1212 LGNVGGYNGRVLKLGDVLFLPS---NEENKSVECL-PQNIPQSLIPQISETKEWRIGVTC 1267
            +GN+GG+NGR LK GDVL LP    +E      C  P+  P  + P I     W IGV  
Sbjct: 1209 MGNLGGFNGRALKRGDVLSLPQQFDSEHGIPSPCFSPEKAPIYVRPDIPNDGVWTIGVLA 1268

Query: 1268 GPHGSPDFFKPESIEEFFSEKWKVHYNSNRFGVRLIGPKPKWARSNGGEGGMHPSNTHDY 1327
            GPHG+PD F+ E + EFF  +WKVHYNSNRFGVRLIGPKPKW+R++GGEGG+HPSNTHDY
Sbjct: 1269 GPHGAPDIFESEGMMEFFKSEWKVHYNSNRFGVRLIGPKPKWSRTDGGEGGLHPSNTHDY 1328

Query: 1328 VYSLGAINFTGDEPVIITCDGPSLGGFVCQAVVPEAELWKVGQVKPGDSIQFVPLSYESS 1387
            VYSLGAINFTGDEPVIITCDGPSLGGFVCQAVV EAE+WKVGQ+KPGD+I F P+ ++S+
Sbjct: 1329 VYSLGAINFTGDEPVIITCDGPSLGGFVCQAVVSEAEMWKVGQLKPGDTINFTPIDWQSA 1388

Query: 1388 RSLKESQDVAIKSLDGTKLRRLDSVSILPSFETPILAQMEKVNELSPKVVYRQAGDRYVL 1447
            R+LKE+QDV I  +    L++L    +L S E PIL Q +     SPKVVYRQAGDRY+L
Sbjct: 1389 RNLKENQDVIINDMSSCALQKLSDQPLLKSPEDPILFQKDGQELQSPKVVYRQAGDRYIL 1448

Query: 1448 VEYGDNEMNFNISYRIECLISLVKKNKTIGIVEMSQGVRSVLIEFDGYKVTQKELLKVLV 1507
            +EYGD+    N+ YRI+ LI ++ +  T GI EMSQGVRSVL+E+DGY+++QKELLK L+
Sbjct: 1449 IEYGDDIFELNLCYRIKSLIDIISQRNTKGIKEMSQGVRSVLVEYDGYEISQKELLKTLI 1508

Query: 1508 AYETEIQFDENWKITSNIIRLPMAFEDSKTLACVQRYQETIRSSAPWLPNNVDFIANVNG 1567
            AYE ++  ++NW + S I RLPMAFED +TLACV+RYQETIRS APWLPNNVDF+A VN 
Sbjct: 1509 AYEEQLPQEKNWSVKSRIFRLPMAFEDKETLACVKRYQETIRSKAPWLPNNVDFVAEVNN 1568

Query: 1568 ISRNEVYDMLYSARFMVLGLGDVFLGSPCAVPLDPRHRFLGSKYNPSRTYTERGAVGIGG 1627
            ++ +++  ++Y+ R+MVLG+GDVFLGSPCA+PLDPR+R LGSKYNPSRT+T+RG VGIGG
Sbjct: 1569 LTHDDIRQLIYTTRYMVLGVGDVFLGSPCAIPLDPRNRLLGSKYNPSRTFTKRGVVGIGG 1628

Query: 1628 MYMCIYAANSPGGYQLVGRTIPIWDKLCLAASSEVPWLMNPFDQVEFYPVSEEDLDKMTE 1687
             YMCIYAA+SPGGYQLVGRTIPIWD+L L +  + PWL++PFDQ+EFYPVSEE +D+ T+
Sbjct: 1629 SYMCIYAADSPGGYQLVGRTIPIWDRLMLQSKKDEPWLLSPFDQIEFYPVSEEQIDEYTD 1688

Query: 1688 DCDNGVYKVNIEKSVFDHQEYLRWINANKDSITAFQEGQLGERAEEFAKLIQNANSELKE 1747
            + DNG YK++++  VFDH  YL+W+  N ++I   Q  Q G+   +FA+ IQ AN++LK+
Sbjct: 1689 EWDNGNYKIDVDDVVFDHGSYLKWVQDNIEAIEEHQRAQRGDNYSKFAQKIQEANADLKQ 1748

Query: 1748 SVTVKPDEEEDFPEGAEIVYSEYSGRFWKSIASVGDVIEAGQGLLIIEAMKAEMI 1802
            + T +  E+    +  E ++SEY+GRFWK I  +G  IE  QG+ +IEAMK EMI
Sbjct: 1749 T-TTEVIEQNILEDDCEYIFSEYAGRFWKPIVEIGASIEKDQGVAVIEAMKTEMI 1802

>ADR051C [1792] [Homologous to ScYBR208C (DUR12) - SH]
            (796213..801672) [5460 bp, 1819 aa]
          Length = 1819

 Score = 2306 bits (5977), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1100/1792 (61%), Positives = 1390/1792 (77%), Gaps = 12/1792 (0%)

Query: 12   SLGWSIQDWIDFHKSSSSQASLRLLESLLDSQNVAPVDNAWISLISKENLLHQFQILKSR 71
            ++GW+ Q W +FH+ +S+ ASL  L +L  ++  A    AWIS+ S E++ HQ+++L+SR
Sbjct: 7    TVGWTSQQWREFHRRASADASLARLLALAHAERDA--GAAWISVASDEHIEHQWRVLQSR 64

Query: 72   ENKETLPLYGVPIAVKDNIDVRGLPTTAACPSFAYEPSKDSKVVELLRNAGAIIVGKTNL 131
             +++ LPLYGVP+AVKDNIDVRGL TTAACPSFAY  ++D+  V LLR+AGA+I+GKTN+
Sbjct: 65   GDRQRLPLYGVPVAVKDNIDVRGLATTAACPSFAYTAAQDATAVRLLRDAGAVILGKTNM 124

Query: 132  DQFATGLVGTRSPYGKTPCAFSKEHXXXXXXXXXXXXXXRGIVPIALGTDTAGSGRVPAA 191
            DQFATGLVGTRSPYG    AFS  H              RG VP+ LGTDTAGSGRVPAA
Sbjct: 125  DQFATGLVGTRSPYGSVASAFSSAHAAGGSSSGSAVVVARGAVPLTLGTDTAGSGRVPAA 184

Query: 192  LNNLIGLKPTKGVFSCQGVVPACKSLDCVSIFALNLSDAERCFRIMCQPDPDNDEYSRPY 251
            LNNL+G+KPT+G  SC GVVPAC+SLDCVS+FA +++DA RC RI+ +PD  +D YSRP 
Sbjct: 185  LNNLVGVKPTRGTVSCTGVVPACRSLDCVSVFARDVADAHRCLRILARPD-GSDPYSRPS 243

Query: 252  VSNPLKKFSSNVTIAIPKNIPWYGETKNPVLFSNAVENLSRTGANVIEIDFEPLLELARC 311
             ++  ++ S+   + +P+   W+GE++N  LF+ A + +  TGA V+++D +PLL+L R 
Sbjct: 244  PADAPRRLSTCPVVGVPREPEWFGESQNAKLFATACQRMRATGARVVKVDPQPLLDLGRS 303

Query: 312  LYEGTWVAERYQAIQSFLDSKPPKESLDPTVISIIEGAKKYSAVDCFSFEYKRQGILQKV 371
            LYEG WVAERY A+++F   +PP+++LDPTV  II  A  YSA D F    +RQ ++  +
Sbjct: 304  LYEGPWVAERYAAMRAFYSGQPPRDTLDPTVTGIITSAGGYSAADVFDHGLRRQKLVAAI 363

Query: 372  RRLLESVDVLCVPTCPLNPTMQQVADEPVLVNSRQGTWTNFVNLADLAALAVPAGFRDDG 431
               L  VD L VPTCPLNPT+  +A EP+LVN+RQG WTNFVNLADLAA+A+PAGFR DG
Sbjct: 364  EAELAGVDALLVPTCPLNPTLAAIAAEPLLVNARQGMWTNFVNLADLAAVAIPAGFRRDG 423

Query: 432  LPNGITLIGKKFTDYALLELANRYFQNIFPNGSRTYGTFTSSSVKPANDQLVGPDYDPST 491
            LP G+TL+G+KF+D ALLEL +R  + +     R  G   +       D++V    +  +
Sbjct: 424  LPQGVTLVGRKFSDLALLELGSRLLR-VEDAEPRRCGALPAGQAL-CEDEVVSGSEERDS 481

Query: 492  SIKLAVVGAHLKGLPLHWQLEKVNATYLCTTKTSKAYQLFALPKNGPVLKPGLRRVQDSN 551
            ++ LAVVGAHL+GL LHWQL++V A ++   +T+ +Y+L+ALPK GPVLKP LRRV    
Sbjct: 482  TVLLAVVGAHLRGLALHWQLDEVQAEFVREARTAPSYRLYALPKTGPVLKPALRRVCAGK 541

Query: 552  GSQIELEVYSVPKELFGAFISMVPEPLGIGSVELESGEWIKSFICEESGYKAKGTVDITK 611
            G+ IELE YSVP+  FG F++MVP PL IGSVELESGE+IKSF+CEE GY   GTVDIT 
Sbjct: 542  GAAIELEAYSVPEATFGRFVAMVPAPLAIGSVELESGEYIKSFVCEEDGYIQDGTVDITH 601

Query: 612  YGGFRAYFEMLXXXXXXXXXLFDTVLIANRGEIAVRIIKTLKKLGIRSVAVYSDPDKYSQ 671
             GGFR Y E L          FDTVL+ANRGEIAVRII+TLK+LGIRSVAVYSDPD++SQ
Sbjct: 602  LGGFRRYVEHLRRQRDVDKP-FDTVLVANRGEIAVRIIRTLKRLGIRSVAVYSDPDRHSQ 660

Query: 672  HVTDADVSVPLHGTTAAQTYLDMNKIIDAAKQTNAQAIIPGYGFLSENADFSDACTSAGI 731
            HV DADV+V L G++AA+TYLD++KI+ AAK+T+ QAIIPGYGFLSENA F++ C + GI
Sbjct: 661  HVRDADVAVALGGSSAAETYLDIDKILAAAKKTDTQAIIPGYGFLSENATFAERCGAEGI 720

Query: 732  TFVGPSGDIIRGLGLKHSARQIAQKAGVPLVPGSLLITSXXXXXXXXXXLEYPVMVKSTA 791
             FVGPSGD IR LGLKH AR++A  AGVPL  G+ L+ S          + YP+MVKSTA
Sbjct: 721  VFVGPSGDSIRKLGLKHWARELAASAGVPLTKGTGLLQSASAALEAGEEIGYPLMVKSTA 780

Query: 792  GGGGIGLQKVDSEEDIEHIFETVKHQGETFFGDAGVFLERFIENARHVEVQLMGDGFGKA 851
            GGGGIGLQ+VDS  ++   FE V+ QGE +F D+GVFLE FI  ARHVEVQ+MGDG G+ 
Sbjct: 781  GGGGIGLQRVDSAAELAAAFEQVQRQGELYFTDSGVFLESFIARARHVEVQIMGDGHGRT 840

Query: 852  IALGERDCSLQRRNQKVIEETPAPNLPEKTRLALRKAAESLGSLLNYKCAGTVEFIYDEK 911
            +ALGERDCSLQRRNQK+IEETPAPNLP  TR  +R+AA+ L S + YKCAGTVEF+YDE+
Sbjct: 841  VALGERDCSLQRRNQKIIEETPAPNLPAHTRQKMRQAAQRLCSAVKYKCAGTVEFMYDEQ 900

Query: 912  KDEFYFLEVNTRLQVEHPITEMVTGLDLVEWMIRIAANDAPDFDSTKVEVNGVSMEARLY 971
            KDEFYFLEVNTRLQVEHPITEMVTGLDLVEWM+RIAAN  PDFD+  VE+ GVSMEAR+Y
Sbjct: 901  KDEFYFLEVNTRLQVEHPITEMVTGLDLVEWMLRIAANTPPDFDA-GVEIEGVSMEARVY 959

Query: 972  AENPLKNFRPSPGLLVDVKFPDWARVDTWVKKGTNISPEYDPTLAKIIVHGKDRDDAISK 1031
             ENP+K F PSPGLL +V FP WARVDTW+ KGT ++ EYDPTLAKIIVHGKDR+DA+SK
Sbjct: 960  VENPVKGFTPSPGLLTEVVFPSWARVDTWILKGTRVAAEYDPTLAKIIVHGKDREDAVSK 1019

Query: 1032 LNQALEETKVYGCITNIDYLKSIITSDFFAKAKVSTNILNSYQYEPTAIEITLPGAHTSI 1091
            L  AL ET++ GC+TN+DYLKSI +S+ F KA V T +LN ++Y PTA E+ +PGA+T+I
Sbjct: 1020 LLLALSETRIAGCMTNLDYLKSIASSEEFRKASVFTRLLNDFEYTPTAFEVKIPGAYTTI 1079

Query: 1092 QDYPGRVGYWRIGVPPSGPMDAYSFRLANRIVGNDYRTPAIEVTLTGPSIVFHCETVIAI 1151
            QDYPGRVGYWRIGVPPSGPMD+YSFRLANR+VGND +  A+E+TL GP + FH + VIA+
Sbjct: 1080 QDYPGRVGYWRIGVPPSGPMDSYSFRLANRVVGNDSKAAALEITLNGPELKFHSDAVIAV 1139

Query: 1152 TGGTALCTLDGQEIPQHKPVEVKRGSTLSIGKLTSGCRAYLGIRGGIDVPKYLGSYSTFT 1211
            TGG    TL+G+ + Q+ P+ +++G  L IGKL SG RAYL +RGGIDVP++LGS STF 
Sbjct: 1140 TGGAVPVTLNGKPVLQYVPLTLEKGDVLKIGKLESGSRAYLAVRGGIDVPEFLGSRSTFA 1199

Query: 1212 LGNVGGYNGRVLKLGDVLFLPSNEENKSVECLPQNIPQSLIPQISETKEWRIGVTCGPHG 1271
            +G +GG+NGRVL  GDVLF+  N+++         IP  L P I   + W+IG+ CGPHG
Sbjct: 1200 MGGIGGHNGRVLAPGDVLFI--NKDSSVAVGDTVTIPSGLQPVIPR-ESWKIGLVCGPHG 1256

Query: 1272 SPDFFKPESIEEFFSEKWKVHYNSNRFGVRLIGPKPKWARSNGGEGGMHPSNTHDYVYSL 1331
            SPDFFK E++EEFFS  WKVHYNSNRFG+RLIGPKPKWARS+GGE G+HPSNTHDYVYS+
Sbjct: 1257 SPDFFKREALEEFFSSPWKVHYNSNRFGIRLIGPKPKWARSDGGEAGLHPSNTHDYVYSV 1316

Query: 1332 GAINFTGDEPVIITCDGPSLGGFVCQAVVPEAELWKVGQVKPGDSIQFVPLSYESSRSLK 1391
            GAINFTGDEPVII  +GPSLGGFVC AVVPEAELWKVGQ+KPGD+I+FVP+S +++R+LK
Sbjct: 1317 GAINFTGDEPVIIAAEGPSLGGFVCAAVVPEAELWKVGQLKPGDTIKFVPISVDTARALK 1376

Query: 1392 ESQDVAIKSLDGTKLRRLDSVSILPSFETPILAQMEKVNELSPKVVYRQAGDRYVLVEYG 1451
             SQD A+ +LD     +LD   +LPS++ P+L ++ K + L PKV +RQ+GDRY+L+EYG
Sbjct: 1377 RSQDAAVDALDILSSIKLDDSMVLPSYQDPVLLRLAKRSGLCPKVTFRQSGDRYILIEYG 1436

Query: 1452 DNEMNFNISYRIECLISLVKKNKTIGIVEMSQGVRSVLIEFDGYKVTQKELLKVLVAYET 1511
            +NEM+ NISYRI+ L  +V KNK  GIVEMSQG+RS+L+E++GY ++Q++LL VL AYE 
Sbjct: 1437 ENEMDINISYRIKQLQEMVTKNKVTGIVEMSQGIRSLLVEYNGYTISQEDLLSVLSAYEL 1496

Query: 1512 EIQFDENWKITSNIIRLPMAFEDSKTLACVQRYQETIRSSAPWLPNNVDFIANVNGISRN 1571
            EI FD +WK+ + + RLPMAFEDSKTL  V+RYQETIRS APWLP+N DF+ANVNGI+R 
Sbjct: 1497 EINFDVDWKVKAKLFRLPMAFEDSKTLEAVRRYQETIRSDAPWLPSNADFVANVNGITRA 1556

Query: 1572 EVYDMLYSARFMVLGLGDVFLGSPCAVPLDPRHRFLGSKYNPSRTYTERGAVGIGGMYMC 1631
            +V D+LYSA FMVLGLGDVFLG+PCAVPLDPR R LG+KYNPSRTYT  G VGIGGMYMC
Sbjct: 1557 DVRDLLYSATFMVLGLGDVFLGAPCAVPLDPRQRLLGTKYNPSRTYTPNGVVGIGGMYMC 1616

Query: 1632 IYAANSPGGYQLVGRTIPIWDKLCLA-ASSEVPWLMNPFDQVEFYPVSEEDLDKMTEDCD 1690
            IY  +SPGGYQL+GRTIPIW++L L  A  + PWL+ PFDQVEFYPVSEE ++++TE+ +
Sbjct: 1617 IYCTDSPGGYQLMGRTIPIWNRLQLGEAWKDHPWLLTPFDQVEFYPVSEERINELTEEVE 1676

Query: 1691 NGVYKVNIEKSVFDHQEYLRWINANKDSITAFQEGQLGERAEEFAKLIQNANSELKESVT 1750
            NG +++ ++++VFD+  Y RW+  N++SI AF+EGQ GERA EFA+LI+ ANS+L+ +V 
Sbjct: 1677 NGTFELEVKETVFDNGAYNRWLEDNRESIQAFKEGQSGERAAEFARLIKVANSDLETAVR 1736

Query: 1751 VKPDEEEDFPEGAEIVYSEYSGRFWKSIASVGDVIEAGQGLLIIEAMKAEMI 1802
             K  E  ++PE A +VYSEY+GRFWK + SVGD ++ G  L+IIEAMK EM+
Sbjct: 1737 -KEAEPVEYPEDAHMVYSEYAGRFWKQVVSVGDKVKEGDKLVIIEAMKTEMV 1787

>YBR218C (PYC2) [399] chr2 complement(658664..662206) Pyruvate
            carboxylase 2 [3543 bp, 1180 aa]
          Length = 1180

 Score =  282 bits (722), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 173/471 (36%), Positives = 260/471 (55%), Gaps = 19/471 (4%)

Query: 611  KYGGFRAYFEMLXXXXXXXXXLFDTVLIANRGEIAVRIIKTLKKLGIRSVAVYSDPDKYS 670
            K  G R  F +L           + +L+ANRGEI +RI ++  +L +R++A+YS  D+ S
Sbjct: 6    KLAGLRDNFSLLGEK--------NKILVANRGEIPIRIFRSAHELSMRTIAIYSHEDRLS 57

Query: 671  QHVTDADVSVPLHGT---TAAQTYLDMNKIIDAAKQTNAQAIIPGYGFLSENADFSDACT 727
             H   AD +  +      T    YL M++II+ AK+     I PGYGFLSEN++F+D   
Sbjct: 58   MHRLKADEAYVIGEEGQYTPVGAYLAMDEIIEIAKKHKVDFIHPGYGFLSENSEFADKVV 117

Query: 728  SAGITFVGPSGDIIRGLGLKHSARQIAQKAGVPLVPGSL-LITSXXXXXXXXXXLEYPVM 786
             AGIT++GP  ++I  +G K SAR +A +A VP VPG+   I +            YPV+
Sbjct: 118  KAGITWIGPPAEVIDSVGDKVSARHLAARANVPTVPGTPGPIETVQEALDFVNEYGYPVI 177

Query: 787  VKSTAGGGGIGLQKVDSEEDIEHIFETVKHQGETFFGDAGVFLERFIENARHVEVQLMGD 846
            +K+  GGGG G++ V   +D+   F+    +  T FG+   F+ERF++  +H+EVQL+ D
Sbjct: 178  IKAAFGGGGRGMRVVREGDDVADAFQRATSEARTAFGNGTCFVERFLDKPKHIEVQLLAD 237

Query: 847  GFGKAIALGERDCSLQRRNQKVIEETPAPNLPEKTRLALRKAAESLGSLLNYKCAGTVEF 906
              G  + L ERDCS+QRR+QKV+E  PA  LP + R A+   A  L  +  Y+ AGT EF
Sbjct: 238  NHGNVVHLFERDCSVQRRHQKVVEVAPAKTLPREVRDAILTDAVKLAKVCGYRNAGTAEF 297

Query: 907  IYDEKKDEFYFLEVNTRLQVEHPITEMVTGLDLVEWMIRIAANDAPD---FDSTKVEVNG 963
            + D  ++  YF+E+N R+QVEH ITE +TG+D+V   I+IAA            K+   G
Sbjct: 298  LVD-NQNRHYFIEINPRIQVEHTITEEITGIDIVSAQIQIAAGATLTQLGLLQDKITTRG 356

Query: 964  VSMEARLYAENPLKNFRPSPGLLVDVKFP--DWARVDTW-VKKGTNISPEYDPTLAKIIV 1020
             S++ R+  E+P KNF+P  G L   +    +  R+D      G  ISP YD  L K   
Sbjct: 357  FSIQCRITTEDPSKNFQPDTGRLEVYRSAGGNGVRLDGGNAYAGATISPHYDSMLVKCSC 416

Query: 1021 HGKDRDDAISKLNQALEETKVYGCITNIDYLKSIITSDFFAKAKVSTNILN 1071
             G   +    K+ +AL E ++ G  TNI +L +++T+  F +    T  ++
Sbjct: 417  SGSTYEIVRRKMIRALIEFRIRGVKTNIPFLLTLLTNPVFIEGTYWTTFID 467

>Kwal_14.1803
          Length = 1174

 Score =  279 bits (714), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 170/437 (38%), Positives = 259/437 (59%), Gaps = 11/437 (2%)

Query: 634  DTVLIANRGEIAVRIIKTLKKLGIRSVAVYSDPDKYSQHVTDADVSVPLHGT---TAAQT 690
            + +L+ANRGEI +RI ++  +L +++VA+YS  D+ S H   AD +  +      T    
Sbjct: 18   NKILVANRGEIPIRIFRSAHELSMKTVAIYSHEDRLSMHRLKADEAYMIGKQGKYTPVGA 77

Query: 691  YLDMNKIIDAAKQTNAQAIIPGYGFLSENADFSDACTSAGITFVGPSGDIIRGLGLKHSA 750
            YL +++I++ AK+ N   I PGYGFLSEN++F+     AGIT++GPS ++I  +G K SA
Sbjct: 78   YLAIDEILEIAKEHNVDFIHPGYGFLSENSEFARKVEEAGITWIGPSAEVIDSVGDKVSA 137

Query: 751  RQIAQKAGVPLVPGSL-LITSXXXXXXXXXXLEYPVMVKSTAGGGGIGLQKVDSEEDIEH 809
            R +A KA VP+VPG+   I S            YPV++K+  GGGG G++ V   +DI  
Sbjct: 138  RNLAAKANVPVVPGTPGPIDSVEEAQAFVAEYGYPVIIKAAFGGGGRGMRVVREGDDIAD 197

Query: 810  IFETVKHQGETFFGDAGVFLERFIENARHVEVQLMGDGFGKAIALGERDCSLQRRNQKVI 869
             F+    + +T FG+   F+ERF+   +H+EVQL+ DG+G  + L ERDCS+QRR+QKV+
Sbjct: 198  AFQRATSEAKTSFGNGTCFIERFLNKPKHIEVQLLADGYGNVVHLFERDCSVQRRHQKVV 257

Query: 870  EETPAPNLPEKTRLALRKAAESLGSLLNYKCAGTVEFIYDEKKDEFYFLEVNTRLQVEHP 929
            E  PA  LP+  R A+   A  L S+ NYK AGT EF+ D+ ++  YF+E+N R+QVEH 
Sbjct: 258  EVAPAKTLPKDVRDAILTDAVKLASVANYKNAGTAEFLVDD-QNRHYFIEINPRIQVEHT 316

Query: 930  ITEMVTGLDLVEWMIRIAANDAPD---FDSTKVEVNGVSMEARLYAENPLKNFRPSPGLL 986
            ITE +TG+D+V   I+IAA  +         ++   G +++ R+  E+P KNF+P  G +
Sbjct: 317  ITEEITGIDIVAAQIQIAAGASLQQLGLLQDRITTRGFAIQCRITTEDPAKNFQPDTGRI 376

Query: 987  VDVKFP--DWARVDTW-VKKGTNISPEYDPTLAKIIVHGKDRDDAISKLNQALEETKVYG 1043
               +    +  R+D      G+ ISP YD  L K    G   +    K+ +AL E ++ G
Sbjct: 377  EVYRSAGGNGVRLDGGNAYAGSIISPHYDSMLVKCSCSGSTYEIVRRKMLRALIEFRIRG 436

Query: 1044 CITNIDYLKSIITSDFF 1060
              TNI +L +++T+  F
Sbjct: 437  VKTNIPFLLTLLTNPVF 453

>CAGL0K06787g complement(659290..662817) highly similar to sp|P32327
            Saccharomyces cerevisiae YBR218c PYC2 Pyruvate
            carboxylase 2, start by similarity
          Length = 1175

 Score =  279 bits (713), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 171/448 (38%), Positives = 254/448 (56%), Gaps = 11/448 (2%)

Query: 634  DTVLIANRGEIAVRIIKTLKKLGIRSVAVYSDPDKYSQHVTDADVSVPLHGT---TAAQT 690
            + +L+ANRGEI +RI ++  +L +R+VA+YS  D+ S H   AD +  +      T    
Sbjct: 21   NKILVANRGEIPIRIFRSAHELSMRTVAIYSHEDRLSTHRLKADEAYVIGKEGEYTPVGA 80

Query: 691  YLDMNKIIDAAKQTNAQAIIPGYGFLSENADFSDACTSAGITFVGPSGDIIRGLGLKHSA 750
            YL +++IID AK+     I PGYGFLSENA+F+D    AGIT++GP  ++I  +G K SA
Sbjct: 81   YLAIDEIIDIAKKHGVDFIHPGYGFLSENAEFADKVQKAGITWIGPPPEVIESVGDKVSA 140

Query: 751  RQIAQKAGVPLVPGSL-LITSXXXXXXXXXXLEYPVMVKSTAGGGGIGLQKVDSEEDIEH 809
            R +A KA VP VPG+   I +            YPV++K+  GGGG G++ V   +D+  
Sbjct: 141  RNLAAKANVPTVPGTPGPIETVEEAQDFVNKYGYPVIIKAAYGGGGRGMRVVREGDDVAD 200

Query: 810  IFETVKHQGETFFGDAGVFLERFIENARHVEVQLMGDGFGKAIALGERDCSLQRRNQKVI 869
             F+  K +  T FG+   F+ERF++  +H+EVQL+ D  G  + L ERDCS+QRR+QKV+
Sbjct: 201  AFQRAKSEAITAFGNGTCFVERFLDKPKHIEVQLLADNHGNVVHLFERDCSVQRRHQKVV 260

Query: 870  EETPAPNLPEKTRLALRKAAESLGSLLNYKCAGTVEFIYDEKKDEFYFLEVNTRLQVEHP 929
            E  PA  LP + R ++   A  L     Y+ AGT EF+ D  ++  YF+E+N R+QVEH 
Sbjct: 261  EVAPAKTLPREVRDSILTDAVRLAKEAGYRNAGTAEFLVD-NQNRHYFIEINPRIQVEHT 319

Query: 930  ITEMVTGLDLVEWMIRIAANDA-PDFD--STKVEVNGVSMEARLYAENPLKNFRPSPGLL 986
            ITE +TG+DLV   I+IAA  + P       ++   G +++ R+  E+P KNF+P  G L
Sbjct: 320  ITEEITGIDLVSAQIQIAAGASLPQLGLLQDRITTRGFAIQCRITTEDPAKNFQPDTGRL 379

Query: 987  VDVKFP--DWARVDTWVK-KGTNISPEYDPTLAKIIVHGKDRDDAISKLNQALEETKVYG 1043
               +    +  R+D      G  ISP YD  L K    G   +    K+ +AL E ++ G
Sbjct: 380  EVYRSAGGNGVRLDGGTAYAGAVISPHYDSMLVKCSCSGSTYEIVRRKMLRALIEFRIRG 439

Query: 1044 CITNIDYLKSIITSDFFAKAKVSTNILN 1071
              TNI +L +++T   F      T  ++
Sbjct: 440  VKTNIPFLLTLLTHPVFISGDYWTTFID 467

>Scas_686.17
          Length = 1176

 Score =  277 bits (709), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 178/471 (37%), Positives = 262/471 (55%), Gaps = 19/471 (4%)

Query: 611  KYGGFRAYFEMLXXXXXXXXXLFDTVLIANRGEIAVRIIKTLKKLGIRSVAVYSDPDKYS 670
            K  G R  F +L           + +L+ANRGEI +RI ++  +L +R+VA+YS  D+ S
Sbjct: 5    KLSGLRDNFSLLGEK--------NKILVANRGEIPIRIFRSAHELSMRTVAIYSHEDRLS 56

Query: 671  QHVTDADVSVPLHGT---TAAQTYLDMNKIIDAAKQTNAQAIIPGYGFLSENADFSDACT 727
             H   AD S  +      T    YL +++II+ AK+     I PGYGFLSEN++F+D   
Sbjct: 57   THRLKADESYVIGEEGQFTPVGAYLAIDEIINIAKKHKVDFIHPGYGFLSENSEFADKVA 116

Query: 728  SAGITFVGPSGDIIRGLGLKHSARQIAQKAGVPLVPGSL-LITSXXXXXXXXXXLEYPVM 786
             AGIT++GP  ++I  +G K SAR +A +A VP VPG+   I S            YPV+
Sbjct: 117  KAGITWIGPPAEVIDSVGDKVSARYLAARADVPTVPGTPGPIKSVKEAEDFVAQYGYPVI 176

Query: 787  VKSTAGGGGIGLQKVDSEEDIEHIFETVKHQGETFFGDAGVFLERFIENARHVEVQLMGD 846
            +K+  GGGG G++ V   EDI   F+    +  T FGD   F+ERF+++ +H+EVQL+GD
Sbjct: 177  IKAAFGGGGRGMRVVREGEDINDAFQRASSEALTAFGDGTCFVERFLDHPKHIEVQLLGD 236

Query: 847  GFGKAIALGERDCSLQRRNQKVIEETPAPNLPEKTRLALRKAAESLGSLLNYKCAGTVEF 906
             +G  + L ERDCS+QRR+QKV+E  PA N+P + R A+   A  L     Y+ AGT EF
Sbjct: 237  NYGNVVHLFERDCSVQRRHQKVVEVAPAKNIPREVRDAILTDAVKLAKECGYRNAGTAEF 296

Query: 907  IYDEKKDEFYFLEVNTRLQVEHPITEMVTGLDLVEWMIRIAANDA---PDFDSTKVEVNG 963
            + D  ++  YF+E+N R+QVEH ITE +TG+DLV   I+IAA  +         ++   G
Sbjct: 297  LVD-NQNRHYFIEINPRIQVEHTITEEITGIDLVAAQIQIAAGASLAQLGLLQDRITTRG 355

Query: 964  VSMEARLYAENPLKNFRPSPGLLVDVKFP--DWARVDTW-VKKGTNISPEYDPTLAKIIV 1020
             +++ R+  E+P KNF+P  G L   +    +  R+D      G  ISP YD  L K   
Sbjct: 356  FAIQCRITTEDPAKNFQPDTGRLEVYRSAGGNGVRLDGGNAYAGAVISPHYDSMLVKCSC 415

Query: 1021 HGKDRDDAISKLNQALEETKVYGCITNIDYLKSIITSDFFAKAKVSTNILN 1071
             G   +    K+ +AL E ++ G  TNI +L +++T   F      T  ++
Sbjct: 416  SGSTYEIVRRKMIRALIEFRIRGVKTNIPFLLTLLTHPVFISGDYWTTFID 466

>CAGL0F06941g 679960..683502 highly similar to sp|P11154 Saccharomyces
            cerevisiae YGL062w PYC1 pyruvate carboxylase or sp|P32327
            Saccharomyces cerevisiae YBR218c PYC2, hypothetical start
          Length = 1180

 Score =  273 bits (698), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 178/482 (36%), Positives = 259/482 (53%), Gaps = 41/482 (8%)

Query: 611  KYGGFRAYFEMLXXXXXXXXXLFDTVLIANRGEIAVRIIKTLKKLGIRSVAVYSDPDKYS 670
            K  G RA F +L           D +L+ANRGEI +RI +T  +L +R+VA+YS  D+ S
Sbjct: 9    KLAGLRANFNILGEK--------DKILVANRGEIPIRIFRTAHELSMRTVAIYSHEDRLS 60

Query: 671  QHVTDADVSVPLHGT---TAAQTYLDMNKIIDAAKQTNAQAIIPGYGFLSENADFSDACT 727
             H   AD +  +      T    YL +++IID AK+     I PGYGFLSEN++F+D   
Sbjct: 61   THRLKADEAYVIGEEGQYTPVGAYLAIDEIIDIAKKHGVDFIHPGYGFLSENSEFADKVQ 120

Query: 728  SAGITFVGPSGDIIRGLGLKHSARQIAQKAGVPLVPGSL-LITSXXXXXXXXXXLEYPVM 786
             AGIT++GP  ++I  +G K SAR +A KA VP VPG+   I +            YPV+
Sbjct: 121  KAGITWIGPPPEVIESVGDKVSARNLAAKAKVPTVPGTPGPIKTVEEAEAFVAEYGYPVI 180

Query: 787  VKSTAGGGGIGLQKVDSEEDIEHIFETVKHQGETFFGDAGVFLERFIENARHVEVQLMGD 846
            +K+  GGGG G++ V   EDI   F+    + +T FG+   F+ERF++  +H+EVQL+ D
Sbjct: 181  IKAAYGGGGRGMRVVREGEDIGDAFQRATSEAKTAFGNGTCFVERFLDKPKHIEVQLLAD 240

Query: 847  GFGKAIALGERDCSLQRRNQKVIEETPAPNLPEKTRLALRKAAESLGSLLNYKCAGTVEF 906
              G  I L ERDCS+QRR+QKV+E  PA  LP   R A+   A  L     Y+ AGT EF
Sbjct: 241  NHGNVIHLFERDCSVQRRHQKVVEVAPAKTLPRDVRDAILTDAVKLAKEAGYRNAGTAEF 300

Query: 907  IYDEKKDEFYFLEVNTRLQVEHPITEMVTGLDLVEWMIRIAANDAPD---FDSTKVEVNG 963
            + D  ++  YF+E+N R+QVEH ITE +TG+D+V   I+IAA  +         ++   G
Sbjct: 301  LVD-NQNRHYFIEINPRIQVEHTITEEITGIDIVAAQIQIAAGASLTELGLLQDRITTRG 359

Query: 964  VSMEARLYAENPLKNFRPSPGLLVDVKFPDWARVDTWVKKGTN--------------ISP 1009
             +++ R+  E+P KNF+P  G           R++ +   G N              ISP
Sbjct: 360  FAIQCRITTEDPAKNFQPDTG-----------RIEVYGSTGGNGVRLDGGNAYAGAVISP 408

Query: 1010 EYDPTLAKIIVHGKDRDDAISKLNQALEETKVYGCITNIDYLKSIITSDFFAKAKVSTNI 1069
             YD  L K    G   +    K+ +AL E ++ G  TNI +L +++T   F   +  T  
Sbjct: 409  HYDSMLVKCSCSGSTYEIVRRKIIRALIEFRIRGVKTNIPFLLTLLTHPVFISGQYWTTF 468

Query: 1070 LN 1071
            ++
Sbjct: 469  ID 470

>YGL062W (PYC1) [1917] chr7 (385197..388733) Pyruvate carboxylase 1,
            catalyzes conversion of pyruvate to oxaloacetate in the
            gluconeogenesis pathway [3537 bp, 1178 aa]
          Length = 1178

 Score =  271 bits (692), Expect = 7e-74,   Method: Compositional matrix adjust.
 Identities = 174/471 (36%), Positives = 262/471 (55%), Gaps = 19/471 (4%)

Query: 611  KYGGFRAYFEMLXXXXXXXXXLFDTVLIANRGEIAVRIIKTLKKLGIRSVAVYSDPDKYS 670
            K+ G R  F +L           + +L+ANRGEI +RI +T  +L +++VA+YS  D+ S
Sbjct: 5    KFAGLRDNFNLLGEK--------NKILVANRGEIPIRIFRTAHELSMQTVAIYSHEDRLS 56

Query: 671  QHVTDAD---VSVPLHGTTAAQTYLDMNKIIDAAKQTNAQAIIPGYGFLSENADFSDACT 727
             H   AD   V   +   T    YL +++II  A++     I PGYGFLSEN++F+D   
Sbjct: 57   THKQKADEAYVIGEVGQYTPVGAYLAIDEIISIAQKHQVDFIHPGYGFLSENSEFADKVV 116

Query: 728  SAGITFVGPSGDIIRGLGLKHSARQIAQKAGVPLVPGSL-LITSXXXXXXXXXXLEYPVM 786
             AGIT++GP  ++I  +G K SAR +A KA VP VPG+   I +            YPV+
Sbjct: 117  KAGITWIGPPAEVIDSVGDKVSARNLAAKANVPTVPGTPGPIETVEEALDFVNEYGYPVI 176

Query: 787  VKSTAGGGGIGLQKVDSEEDIEHIFETVKHQGETFFGDAGVFLERFIENARHVEVQLMGD 846
            +K+  GGGG G++ V   +D+   F+    +  T FG+   F+ERF++  +H+EVQL+ D
Sbjct: 177  IKAAFGGGGRGMRVVREGDDVADAFQRATSEARTAFGNGTCFVERFLDKPKHIEVQLLAD 236

Query: 847  GFGKAIALGERDCSLQRRNQKVIEETPAPNLPEKTRLALRKAAESLGSLLNYKCAGTVEF 906
              G  + L ERDCS+QRR+QKV+E  PA  LP + R A+   A  L     Y+ AGT EF
Sbjct: 237  NHGNVVHLFERDCSVQRRHQKVVEVAPAKTLPREVRDAILTDAVKLAKECGYRNAGTAEF 296

Query: 907  IYDEKKDEFYFLEVNTRLQVEHPITEMVTGLDLVEWMIRIAANDA-PDFD--STKVEVNG 963
            + D  ++  YF+E+N R+QVEH ITE +TG+D+V   I+IAA  + P       K+   G
Sbjct: 297  LVD-NQNRHYFIEINPRIQVEHTITEEITGIDIVAAQIQIAAGASLPQLGLFQDKITTRG 355

Query: 964  VSMEARLYAENPLKNFRPSPGLLVDVKFP--DWARVDTW-VKKGTNISPEYDPTLAKIIV 1020
             +++ R+  E+P KNF+P  G +   +    +  R+D      GT ISP YD  L K   
Sbjct: 356  FAIQCRITTEDPAKNFQPDTGRIEVYRSAGGNGVRLDGGNAYAGTIISPHYDSMLVKCSC 415

Query: 1021 HGKDRDDAISKLNQALEETKVYGCITNIDYLKSIITSDFFAKAKVSTNILN 1071
             G   +    K+ +AL E ++ G  TNI +L +++T+  F +    T  ++
Sbjct: 416  SGSTYEIVRRKMIRALIEFRIRGVKTNIPFLLTLLTNPVFIEGTYWTTFID 466

>KLLA0C05764g complement(512470..515991) highly similar to sp|P32327
            Saccharomyces cerevisiae YBR218c PYC2 pyruvate
            carboxylase 2, start by similarity
          Length = 1173

 Score =  270 bits (690), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 169/459 (36%), Positives = 256/459 (55%), Gaps = 33/459 (7%)

Query: 634  DTVLIANRGEIAVRIIKTLKKLGIRSVAVYSDPDKYSQHVTDADVSVPLHGT---TAAQT 690
            + +L+ANRGEI +RI +T  +L +++VA+YS  D+ S H   AD +  +      T    
Sbjct: 19   NKLLVANRGEIPIRIFRTAHELSMKTVAIYSHEDRLSMHRLKADEAYVIGEQGKYTPVGA 78

Query: 691  YLDMNKIIDAAKQTNAQAIIPGYGFLSENADFSDACTSAGITFVGPSGDIIRGLGLKHSA 750
            YL +++II+ AK      I PGYGFLSEN++F++   ++GIT+VGP   +I  +G K SA
Sbjct: 79   YLAIDEIINIAKSHGVNFIHPGYGFLSENSEFAEKVAASGITWVGPPAAVIDSVGDKVSA 138

Query: 751  RQIAQKAGVPLVPGSL-LITSXXXXXXXXXXLEYPVMVKSTAGGGGIGLQKVDSEEDIEH 809
            R +A+KA VP+VPG+   I +            +PV++K+  GGGG G++ V   +DI  
Sbjct: 139  RNLAEKANVPVVPGTPGPIETVEEAQAFVDKYGFPVIIKAAFGGGGRGMRVVREGDDISD 198

Query: 810  IFETVKHQGETFFGDAGVFLERFIENARHVEVQLMGDGFGKAIALGERDCSLQRRNQKVI 869
             F+  K +  T FG+   F+ERF++  +H+EVQL+ D +G  + L ERDCS+QRR+QKV+
Sbjct: 199  AFQRAKSEAITAFGNGTCFIERFLDKPKHIEVQLLADNYGNVVHLFERDCSVQRRHQKVV 258

Query: 870  EETPAPNLPEKTRLALRKAAESLGSLLNYKCAGTVEFIYDEKKDEFYFLEVNTRLQVEHP 929
            E  PA  LPE+ R A+   A  L     Y+ AGT EF+ D  ++  YF+E+N R+QVEH 
Sbjct: 259  EVAPAKTLPEEVRDAILTDAVKLAKEAGYRNAGTAEFLVD-NQNRHYFIEINPRIQVEHT 317

Query: 930  ITEMVTGLDLVEWMIRIAANDAPD---FDSTKVEVNGVSMEARLYAENPLKNFRPSPGLL 986
            ITE +TG+D+V   I+IAA    +       K+   G +++ R+  E+P KNF+      
Sbjct: 318  ITEEITGIDIVAAQIQIAAGATLEQLGLMQDKITTRGFAIQCRITTEDPSKNFQ------ 371

Query: 987  VDVKFPDWARVDTWVKKGTN--------------ISPEYDPTLAKIIVHGKDRDDAISKL 1032
                 PD  R+D +   G N              ISP YD  L K    G   +    K+
Sbjct: 372  -----PDTGRIDVYRSAGGNGVRLDGGNAFAGSVISPHYDSMLVKCSCSGSTYEIVRRKM 426

Query: 1033 NQALEETKVYGCITNIDYLKSIITSDFFAKAKVSTNILN 1071
             +AL E ++ G  TNI +L +++T   F   +  T  ++
Sbjct: 427  LRALIEFRIRGVKTNIPFLLTLLTHPVFKSGEYWTTFID 465

>AAR162C [350] [Homologous to ScYGL062W (PYC1) - SH; ScYBR218C (PYC2)
            - SH] (634067..637582) [3516 bp, 1171 aa]
          Length = 1171

 Score =  265 bits (678), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 176/473 (37%), Positives = 263/473 (55%), Gaps = 21/473 (4%)

Query: 610  TKYGGFRAYFEMLXXXXXXXXXLFDTVLIANRGEIAVRIIKTLKKLGIRSVAVYSDPDKY 669
            ++  GFR +  +L           + VL+ANRGEI +RI +T  +L + +VAVYS  D+ 
Sbjct: 3    SQLAGFRRHSNLLGEK--------NKVLVANRGEIPIRIFRTAHELSMATVAVYSYEDRL 54

Query: 670  SQHVTDADVS--VPLHGT-TAAQTYLDMNKIIDAAKQTNAQAIIPGYGFLSENADFSDAC 726
            S H   AD +  +   G  T    YL +++I+  A+  +   I PGYGFLSENA+F+   
Sbjct: 55   SMHRQKADEAYMIGREGQYTPVGAYLAIDEILRIARDHDVDFIHPGYGFLSENAEFAAKV 114

Query: 727  TSAGITFVGPSGDIIRGLGLKHSARQIAQKAGVPLVPGSL-LITSXXXXXXXXXXLEYPV 785
              AGIT++GP   +I  +G K SAR +A  A VP VPG+   I+S            YPV
Sbjct: 115  EGAGITWIGPPASVIEAVGDKVSARNLAAVADVPTVPGTEGPISSVEEAEEFVQKYGYPV 174

Query: 786  MVKSTAGGGGIGLQKVDSEEDIEHIFETVKHQGETFFGDAGVFLERFIENARHVEVQLMG 845
            ++K+  GGGG G++ V   +DI   F+  + + ET FG+   F+ERF++  +H+EVQL+ 
Sbjct: 175  IIKAAFGGGGRGMRVVREGDDIRDAFQRARSEAETAFGNGTCFVERFLDQPKHIEVQLLA 234

Query: 846  DGFGKAIALGERDCSLQRRNQKVIEETPAPNLPEKTRLALRKAAESLGSLLNYKCAGTVE 905
            D +G  + L ERDCS+QRR+QKV+E  PA  L ++ R A+   A  L     Y+ AGT E
Sbjct: 235  DNYGNVVHLFERDCSVQRRHQKVVEVAPAKTLSKEVRDAILTDAVKLAKASGYRNAGTAE 294

Query: 906  FIYDEKKDEFYFLEVNTRLQVEHPITEMVTGLDLVEWMIRIAANDAPD---FDSTKVEVN 962
            F+ D K++  YF+E+N R+QVEH ITE +TG+D+V   I+IAA  + +       ++   
Sbjct: 295  FLVD-KQNRHYFIEINPRIQVEHTITEEITGVDIVAAQIQIAAGASLEQLGLMQDRITTR 353

Query: 963  GVSMEARLYAENPLKNFRPSPGLLVDVKFP---DWARVDTW-VKKGTNISPEYDPTLAKI 1018
            G +++ R+  E+P KNF+P  G L DV      +  R+D      G  ISP YD  L K 
Sbjct: 354  GFAIQCRITTEDPSKNFQPDTGRL-DVYRSAGGNGVRLDGGNAFAGAVISPHYDSMLVKC 412

Query: 1019 IVHGKDRDDAISKLNQALEETKVYGCITNIDYLKSIITSDFFAKAKVSTNILN 1071
               G   +    K+ +AL E ++ G  TNI +L +++T   F      T  ++
Sbjct: 413  SCSGSTYEIVRRKMLRALIEFRIRGVKTNIPFLLTLLTHPVFISGDYWTTFID 465

>Scas_563.12
          Length = 1216

 Score =  256 bits (655), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 163/432 (37%), Positives = 241/432 (55%), Gaps = 11/432 (2%)

Query: 650  KTLKKLGIRSVAVYSDPDKYSQHVTDADVSVPL---HGTTAAQTYLDMNKIIDAAKQTNA 706
            ++  +L +++VA+YS  D+ S H   AD S  +   H  T    YL +++II+ AK+   
Sbjct: 77   RSAHELSMQTVAIYSHEDRLSTHRLKADESYVIGEPHQFTPVGAYLAIDEIINIAKRHGV 136

Query: 707  QAIIPGYGFLSENADFSDACTSAGITFVGPSGDIIRGLGLKHSARQIAQKAGVPLVPGSL 766
              I PGYGFLSEN++F+D    AGIT++GP   +I  +G K SAR +A KA VP VPG+ 
Sbjct: 137  DYIHPGYGFLSENSEFADKVAKAGITWIGPPASVIDSVGDKVSARNLATKANVPTVPGTP 196

Query: 767  -LITSXXXXXXXXXXLEYPVMVKSTAGGGGIGLQKVDSEEDIEHIFETVKHQGETFFGDA 825
              I +            YPV++K+  GGGG G++ V+  +D+   F+    +  T FGD 
Sbjct: 197  GPIRTVQDAQDFVNEYGYPVIIKAAFGGGGRGMRVVNEGDDLADAFQRASSEALTAFGDG 256

Query: 826  GVFLERFIENARHVEVQLMGDGFGKAIALGERDCSLQRRNQKVIEETPAPNLPEKTRLAL 885
              F+ERF+   +H+EVQL+ D  G  I L ERDCS+QRR+QKV+E  PA  LP + R A+
Sbjct: 257  TCFVERFLNKPKHIEVQLLADTHGNVIHLFERDCSVQRRHQKVVEVAPAKTLPREVRDAI 316

Query: 886  RKAAESLGSLLNYKCAGTVEFIYDEKKDEFYFLEVNTRLQVEHPITEMVTGLDLVEWMIR 945
               A  L     Y+ AGT EF+ D+ ++  YF+E+N R+QVEH ITE +TG+D+V   I+
Sbjct: 317  LTDAVKLAKECGYQNAGTAEFLVDD-QNRHYFIEINPRIQVEHTITEEITGIDIVAAQIQ 375

Query: 946  IAANDAPD---FDSTKVEVNGVSMEARLYAENPLKNFRPSPGLL--VDVKFPDWARVDTW 1000
            IAA  + +       K+   G +++ R+  E+P KNF+P  G L   D    +  R+D  
Sbjct: 376  IAAGASLEQLGLLQDKITTRGFAIQCRITTEDPAKNFQPDTGRLEVYDSAGGNGVRLDGG 435

Query: 1001 -VKKGTNISPEYDPTLAKIIVHGKDRDDAISKLNQALEETKVYGCITNIDYLKSIITSDF 1059
                G  ISP YD  L K    G   +    K+ +AL E ++ G  TNI +L +++T   
Sbjct: 436  NAYAGAIISPHYDSMLVKCSCSGSTYEVVRRKMIRALIEFRIRGVKTNIPFLLTLLTHPV 495

Query: 1060 FAKAKVSTNILN 1071
            F      T  ++
Sbjct: 496  FIAGDYWTTFID 507

>Sklu_1458.1 YGL062W, Contig c1458 155-3553 reverse complement
          Length = 1132

 Score =  242 bits (618), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 158/425 (37%), Positives = 238/425 (56%), Gaps = 11/425 (2%)

Query: 657  IRSVAVYSDPDKYSQHVTDADVSVPLH---GTTAAQTYLDMNKIIDAAKQTNAQAIIPGY 713
            +++VA+YS+ D+ S H   AD +  +      T    YL +++II  AK+     I PGY
Sbjct: 1    MKTVAIYSNEDRLSMHRLKADEAYMIGEGGKYTPVGAYLAIDEIISIAKEHGVSFIHPGY 60

Query: 714  GFLSENADFSDACTSAGITFVGPSGDIIRGLGLKHSARQIAQKAGVPLVPGSL-LITSXX 772
            GFLSENA+F+     AGIT++GP  ++I  +G K SAR +A KA VP VPG+   I S  
Sbjct: 61   GFLSENAEFAAKVIDAGITWIGPPPEVINSVGDKVSARDLAAKANVPTVPGTPGPIESVE 120

Query: 773  XXXXXXXXLEYPVMVKSTAGGGGIGLQKVDSEEDIEHIFETVKHQGETFFGDAGVFLERF 832
                      YPV++K+  GGGG G++ V   +DI   F+    + +T FG+   F+ERF
Sbjct: 121  EAEAFVAEYGYPVIIKAAFGGGGRGMRVVREGDDIGDAFQRATSEAKTAFGNGTCFVERF 180

Query: 833  IENARHVEVQLMGDGFGKAIALGERDCSLQRRNQKVIEETPAPNLPEKTRLALRKAAESL 892
            ++  +H+EVQL+ D +G  I L ERDCS+QRR+QKV+E  PA  LP++ R ++   A  L
Sbjct: 181  LDKPKHIEVQLLADNYGNVIHLFERDCSVQRRHQKVVEVAPAKTLPKEVRDSILTDAVKL 240

Query: 893  GSLLNYKCAGTVEFIYDEKKDEFYFLEVNTRLQVEHPITEMVTGLDLVEWMIRIAANDAP 952
                 Y+ AGT EF+ D  ++  YF+E+N R+QVEH ITE +TG+D+V   I+IAA  + 
Sbjct: 241  AKEAKYRNAGTAEFLVD-AQNRHYFIEINPRIQVEHTITEEITGVDVVAAQIQIAAGASL 299

Query: 953  D---FDSTKVEVNGVSMEARLYAENPLKNFRPSPGLLVDVKFP--DWARVDTW-VKKGTN 1006
                    K+   G +++ R+  E+P KNF+P  G +   +    +  R+D      G  
Sbjct: 300  QQLGLLQDKITTRGFAIQCRITTEDPSKNFQPDTGRIEVYRSAGGNGVRLDGGNAYAGAV 359

Query: 1007 ISPEYDPTLAKIIVHGKDRDDAISKLNQALEETKVYGCITNIDYLKSIITSDFFAKAKVS 1066
            ISP YD  L K    G   +    K+ +AL E ++ G  TNI +L +++T   F   +  
Sbjct: 360  ISPHYDSMLVKCSCSGSTYEIVRRKMLRALIEFRIRGVKTNIPFLLTLLTHSVFKSGEYW 419

Query: 1067 TNILN 1071
            T  ++
Sbjct: 420  TTFID 424

>Scas_720.74
          Length = 2231

 Score =  218 bits (554), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 152/506 (30%), Positives = 245/506 (48%), Gaps = 74/506 (14%)

Query: 636  VLIANRGEIAVRIIKTLKK-----------LGIRSVAVYSDPDKYSQHVTDADVSVPLHG 684
            +LIAN G  AV+ I++++K           +   ++A   D +  ++++  AD  V + G
Sbjct: 62   ILIANNGIAAVKEIRSVRKWAYETFGNERTIQFVAMATPEDLEANAEYIRMADQYVEVPG 121

Query: 685  TTAAQTYLDMNKIIDAAKQTNAQAIIPGYGFLSENADFSD--ACTSAGITFVGPSGDIIR 742
             T  + Y +++ I+D A++ +  A+  G+G  SEN    +  A +   + F+GP G  +R
Sbjct: 122  GTNNKNYANVDLIVDIAERADVDAVWAGWGHASENPHLPEKLAMSKRKVVFIGPPGSAMR 181

Query: 743  GLGLKHSARQIAQKAGVPLVPGSLL-------------------------ITSXXXXXXX 777
             LG K S+  +AQ A VP +P S                            +S       
Sbjct: 182  SLGDKISSTIVAQSAHVPCIPWSGTGIDKVQVDKDTGLVSVADEVYAQGCCSSPEDGLEK 241

Query: 778  XXXLEYPVMVKSTAGGGGIGLQKVDSEEDIEHIFETVKHQGETFFGDAGVFLERFIENAR 837
               + +PVM+K++ GGGG G+++V+ EED    F  + HQ       + +F+ +    AR
Sbjct: 242  AKKIGFPVMIKASEGGGGKGIRQVEREED----FIALYHQAANEIPGSPIFIMKLAGKAR 297

Query: 838  HVEVQLMGDGFGKAIALGERDCSLQRRNQKVIEETPAPNLPEKTRLALRKAAESLGSLLN 897
            H+EVQL+ D +G  I+L  RDCS+QRR+QK+IEE P      +T   + K+A  LG L+ 
Sbjct: 298  HLEVQLLADQYGNNISLFGRDCSVQRRHQKIIEEAPVTIAAPETFAMMEKSAVRLGKLVG 357

Query: 898  YKCAGTVEFIYDEKKDEFYFLEVNTRLQVEHPITEMVTGLDLVEWMIRIAAN-------- 949
            Y  AGTVE++Y  +  +FYFLE+N RLQVEHP TEMVTG++L    ++IA          
Sbjct: 358  YVSAGTVEYLYSHEDKKFYFLELNPRLQVEHPTTEMVTGVNLPATQLQIAMGIPMHRISD 417

Query: 950  ------------DAPDFDSTKVEV---------NGVSMEARLYAENPLKNFRPSPGLLVD 988
                           DFD +  E           G     R+ +E+P + F+PS G L +
Sbjct: 418  IRVFYGMNPHTASEIDFDFSTEESLKTQRKPVPKGHCTACRITSEDPDEGFKPSGGSLHE 477

Query: 989  VKFPDWARVDTWVKKGTN--ISPEYDPTLAKIIVHGKDRDDAISKLNQALEETKVYGCI- 1045
            + F   + V  +   G N  I    D     I   G++R  +   +  AL+E  + G   
Sbjct: 478  LNFRSSSNVWGYFSVGNNGGIHSFSDSQFGHIFAFGENRQASRKHMVVALKELSIRGDFR 537

Query: 1046 TNIDYLKSIITSDFFAKAKVSTNILN 1071
            T ++YL  ++ ++ F    ++T  L+
Sbjct: 538  TTVEYLIKLLETEDFEDNTITTGWLD 563

>YMR207C (HFA1) [4163] chr13 complement(677192..683563) Protein with
            similarity to acetyl-CoA carboxylase [6372 bp, 2123 aa]
          Length = 2123

 Score =  216 bits (549), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 152/476 (31%), Positives = 234/476 (49%), Gaps = 58/476 (12%)

Query: 650  KTLKKLGIRSVAVYSDPDKY---SQHVTDADVSVPLHGTTAAQTYLDMNKIIDAAKQTNA 706
            +T     I    V + PD     S+++  AD  V + G T    Y +++ I+D A+QT+ 
Sbjct: 10   ETFNDEKIIQFVVMATPDDLHANSEYIRMADQYVQVPGGTNNNNYANIDLILDVAEQTDV 69

Query: 707  QAIIPGYGFLSENADFSD--ACTSAGITFVGPSGDIIRGLGLKHSARQIAQKAGVPLVP- 763
             A+  G+G  SEN    +  A +   I F+GP G  +R LG K S+  +AQ A +P +P 
Sbjct: 70   DAVWAGWGHASENPCLPELLASSQRKILFIGPPGRAMRSLGDKISSTIVAQSAKIPCIPW 129

Query: 764  -GSLLIT-----------------------SXXXXXXXXXXLEYPVMVKSTAGGGGIGLQ 799
             GS + T                       S          + +PVM+K++ GGGG G++
Sbjct: 130  SGSHIDTIHIDNKTNFVSVPDDVYVRGCCSSPEDALEKAKLIGFPVMIKASEGGGGKGIR 189

Query: 800  KVDSEEDIEHIFETVKHQGETFFGDAGVFLERFIENARHVEVQLMGDGFGKAIALGERDC 859
            +VD+E+D    F  +  Q       + +F+ + + +ARH+EVQL+ D +G  I L  RDC
Sbjct: 190  RVDNEDD----FIALYRQAVNETPGSPMFVMKVVTDARHLEVQLLADQYGTNITLFGRDC 245

Query: 860  SLQRRNQKVIEETPAPNLPEKTRLALRKAAESLGSLLNYKCAGTVEFIYDEKKDEFYFLE 919
            S+QRR+QK+IEE P      +T   + +AA  LG L+ Y  AGTVE++Y  K D+FYFLE
Sbjct: 246  SIQRRHQKIIEEAPVTITKPETFQRMERAAIRLGELVGYVSAGTVEYLYSPKDDKFYFLE 305

Query: 920  VNTRLQVEHPITEMVTGLDLVEWMIRIA--------------------ANDAPDFDSTKV 959
            +N RLQVEHP TEM++G++L    ++IA                         DF + K 
Sbjct: 306  LNPRLQVEHPTTEMISGVNLPATQLQIAMGIPMHMISDIRKLYGLDPTGTSYIDFKNLKR 365

Query: 960  -EVNGVSMEARLYAENPLKNFRPSPGLLVDVKFPDWARVDTWVKKGTN--ISPEYDPTLA 1016
                G  +  R+ +E+P + F+PS G + ++ F   + V  +   G N  I    D    
Sbjct: 366  PSPKGHCISCRITSEDPNEGFKPSTGKIHELNFRSSSNVWGYFSVGNNGAIHSFSDSQFG 425

Query: 1017 KIIVHGKDRDDAISKLNQALEETKVYGCI-TNIDYLKSIITSDFFAKAKVSTNILN 1071
             I   G DR DA   +  AL++  + G   T I+YL  ++ +  F    +ST  L+
Sbjct: 426  HIFAVGNDRQDAKQNMVLALKDFSIRGEFKTPIEYLIELLETRDFESNNISTGWLD 481

>CAGL0L10780g complement(1149588..1156289) highly similar to sp|Q00955
            Saccharomyces cerevisiae YNR016c ACC1 or sp|P32874
            Saccharomyces cerevisiae YMR207c HFA1, start by
            similarity
          Length = 2233

 Score =  215 bits (547), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 155/506 (30%), Positives = 246/506 (48%), Gaps = 74/506 (14%)

Query: 636  VLIANRGEIAVRIIKTLKKLGIRS-----------VAVYSDPDKYSQHVTDADVSVPLHG 684
            VLIAN G  AV+ I++++K    +           +A   D +  ++++  AD  V + G
Sbjct: 62   VLIANNGIAAVKEIRSVRKWAYETFGDEKIVQFVAMATPEDLEANAEYIRMADQYVEVPG 121

Query: 685  TTAAQTYLDMNKIIDAAKQTNAQAIIPGYGFLSENADFSD--ACTSAGITFVGPSGDIIR 742
             T    Y +++ I+D A++ +  A+  G+G  SEN    +  A +   I F+GP G+ +R
Sbjct: 122  GTNNNNYANVDLIVDIAERADVDAVWAGWGHASENPLLPEKLARSKRKILFIGPPGNAMR 181

Query: 743  GLGLKHSARQIAQKAGVPLVPGSLL-------------------------ITSXXXXXXX 777
             LG K S+  +AQ A VP +P S                            +S       
Sbjct: 182  SLGDKISSTIVAQHAKVPCIPWSGTGVDTVHIDEKNGLVSVDDDIYQKGCCSSPEDGLEK 241

Query: 778  XXXLEYPVMVKSTAGGGGIGLQKVDSEEDIEHIFETVKHQGETFFGDAGVFLERFIENAR 837
               + +PVM+K++ GGGG G+++V  EED  +++    HQ       + +F+ +    AR
Sbjct: 242  AKKIGFPVMIKASEGGGGKGIRQVTREEDFINLY----HQAANEIPGSPIFIMKLAGKAR 297

Query: 838  HVEVQLMGDGFGKAIALGERDCSLQRRNQKVIEETPAPNLPEKTRLALRKAAESLGSLLN 897
            H+EVQL+ D +G  I+L  RDCS+QRR+QK+IEE P      +T   + KAA  LG L+ 
Sbjct: 298  HLEVQLLADQYGTNISLFGRDCSVQRRHQKIIEEAPVTIAGPETFGEMEKAAVRLGKLVG 357

Query: 898  YKCAGTVEFIYDEKKDEFYFLEVNTRLQVEHPITEMVTGLDLVEWMIRIA---------- 947
            Y  AGTVE++Y    ++FYFLE+N RLQVEHP TEMVTG++L    ++IA          
Sbjct: 358  YVSAGTVEYLYSHDDNKFYFLELNPRLQVEHPTTEMVTGVNLPAAQLQIAMGIPMHRISD 417

Query: 948  ----------ANDAPDF-----DSTKVEV----NGVSMEARLYAENPLKNFRPSPGLLVD 988
                       +   DF     DS K +      G     R+ +E+P   F+PS G L +
Sbjct: 418  IRIFYGLNPRGSSEIDFEFKSEDSLKTQRKPIPKGHCTACRITSEDPNDGFKPSGGTLNE 477

Query: 989  VKFPDWARVDTWVKKGTN--ISPEYDPTLAKIIVHGKDRDDAISKLNQALEETKVYGCI- 1045
            + F   + V  +   G N  I    D     I   G++R  +   +  AL+E  + G   
Sbjct: 478  LNFRSSSNVWGYFSVGNNGGIHSFSDSQFGHIFAFGENRQASRKHMVVALKELSIRGDFR 537

Query: 1046 TNIDYLKSIITSDFFAKAKVSTNILN 1071
            T ++YL  ++ ++ F +  ++T  L+
Sbjct: 538  TTVEYLIKLLETEDFEENTITTGWLD 563

>YNR016C (ACC1) [4599] chr14 complement(654672..661373) Acetyl-CoA
            carboxylase, first and rate-limiting step in fatty acid
            biosynthesis pathway [6702 bp, 2233 aa]
          Length = 2233

 Score =  214 bits (545), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 152/506 (30%), Positives = 245/506 (48%), Gaps = 74/506 (14%)

Query: 636  VLIANRGEIAVRIIKTLKKLGIRS-----------VAVYSDPDKYSQHVTDADVSVPLHG 684
            +LIAN G  AV+ I++++K    +           +A   D +  ++++  AD  + + G
Sbjct: 62   ILIANNGIAAVKEIRSVRKWAYETFGDDRTVQFVAMATPEDLEANAEYIRMADQYIEVPG 121

Query: 685  TTAAQTYLDMNKIIDAAKQTNAQAIIPGYGFLSENADFSDACTSAG--ITFVGPSGDIIR 742
             T    Y +++ I+D A++ +  A+  G+G  SEN    +  + +   + F+GP G+ +R
Sbjct: 122  GTNNNNYANVDLIVDIAERADVDAVWAGWGHASENPLLPEKLSQSKRKVIFIGPPGNAMR 181

Query: 743  GLGLKHSARQIAQKAGVPLVPGSLL-------------------------ITSXXXXXXX 777
             LG K S+  +AQ A VP +P S                            TS       
Sbjct: 182  SLGDKISSTIVAQSAKVPCIPWSGTGVDTVHVDEKTGLVSVDDDIYQKGCCTSPEDGLQK 241

Query: 778  XXXLEYPVMVKSTAGGGGIGLQKVDSEEDIEHIFETVKHQGETFFGDAGVFLERFIENAR 837
               + +PVM+K++ GGGG G+++V+ EED    F  + HQ       + +F+ +    AR
Sbjct: 242  AKRIGFPVMIKASEGGGGKGIRQVEREED----FIALYHQAANEIPGSPIFIMKLAGRAR 297

Query: 838  HVEVQLMGDGFGKAIALGERDCSLQRRNQKVIEETPAPNLPEKTRLALRKAAESLGSLLN 897
            H+EVQL+ D +G  I+L  RDCS+QRR+QK+IEE P      +T   + KAA  LG L+ 
Sbjct: 298  HLEVQLLADQYGTNISLFGRDCSVQRRHQKIIEEAPVTIAKAETFHEMEKAAVRLGKLVG 357

Query: 898  YKCAGTVEFIYDEKKDEFYFLEVNTRLQVEHPITEMVTGLDLVEWMIRIA---------- 947
            Y  AGTVE++Y     +FYFLE+N RLQVEHP TEMV+G++L    ++IA          
Sbjct: 358  YVSAGTVEYLYSHDDGKFYFLELNPRLQVEHPTTEMVSGVNLPAAQLQIAMGIPMHRISD 417

Query: 948  ----------ANDAPDF-----DSTKVEV----NGVSMEARLYAENPLKNFRPSPGLLVD 988
                      +    DF     D+TK +      G     R+ +E+P   F+PS G L +
Sbjct: 418  IRTLYGMNPHSASEIDFEFKTQDATKKQRRPIPKGHCTACRITSEDPNDGFKPSGGTLHE 477

Query: 989  VKFPDWARVDTWVKKGT--NISPEYDPTLAKIIVHGKDRDDAISKLNQALEETKVYGCI- 1045
            + F   + V  +   G   NI    D     I   G++R  +   +  AL+E  + G   
Sbjct: 478  LNFRSSSNVWGYFSVGNNGNIHSFSDSQFGHIFAFGENRQASRKHMVVALKELSIRGDFR 537

Query: 1046 TNIDYLKSIITSDFFAKAKVSTNILN 1071
            T ++YL  ++ ++ F    ++T  L+
Sbjct: 538  TTVEYLIKLLETEDFEDNTITTGWLD 563

>AAR071W [257] [Homologous to ScYNR016C (ACC1) - SH; ScYMR207C (HFA1)
            - SH] complement(466791..473486) [6696 bp, 2231 aa]
          Length = 2231

 Score =  214 bits (544), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 153/506 (30%), Positives = 245/506 (48%), Gaps = 74/506 (14%)

Query: 636  VLIANRGEIAVRIIKTLKKLGIRS-----------VAVYSDPDKYSQHVTDADVSVPLHG 684
            +LIAN G  AV+ I++++K    +           +A   D +  ++++  AD  V + G
Sbjct: 62   ILIANNGIAAVKEIRSVRKWAYETFGDGKVVQFVVMATPEDLEANTEYIRMADQYVEVPG 121

Query: 685  TTAAQTYLDMNKIIDAAKQTNAQAIIPGYGFLSENADFSD--ACTSAGITFVGPSGDIIR 742
             T    Y +++ I+D A++ +  A+  G+G  SEN    +  A +   + F+GP G  +R
Sbjct: 122  GTNNNNYANVDLIVDVAERADVDAVWAGWGHASENPLLPEKLARSKRKVVFIGPPGSAMR 181

Query: 743  GLGLKHSARQIAQKAGVPLVPGS-------------LLIT------------SXXXXXXX 777
             LG K S+  +AQ A VP +P S              L++            S       
Sbjct: 182  SLGDKISSTIVAQHAKVPCIPWSGTGVDQVEIDPHTKLVSVADDIYQKGCCLSPEDGLNK 241

Query: 778  XXXLEYPVMVKSTAGGGGIGLQKVDSEEDIEHIFETVKHQGETFFGDAGVFLERFIENAR 837
               + +PVMVK++ GGGG G++KV  EED    F ++  Q       + +F+ +    AR
Sbjct: 242  AKQIGFPVMVKASEGGGGKGIRKVVREED----FISLYQQAANEIPGSPIFIMKLAGKAR 297

Query: 838  HVEVQLMGDGFGKAIALGERDCSLQRRNQKVIEETPAPNLPEKTRLALRKAAESLGSLLN 897
            H+EVQL+ D +G  I+L  RDCS+QRR+QK+IEE P       T   + +AA  LG L+ 
Sbjct: 298  HLEVQLLADQYGTNISLFGRDCSVQRRHQKIIEEAPVTIAKPDTFAEMERAAVRLGKLVG 357

Query: 898  YKCAGTVEFIYDEKKDEFYFLEVNTRLQVEHPITEMVTGLDLVEWMIRIAAN-------- 949
            Y  AGTVE++Y  ++D+FYFLE+N RLQVEHP TEMVTG++L    ++IA          
Sbjct: 358  YVSAGTVEYLYSHEEDKFYFLELNPRLQVEHPTTEMVTGVNLPAAQLQIAMGIPLHRIRD 417

Query: 950  ------------DAPDFDSTKVEV---------NGVSMEARLYAENPLKNFRPSPGLLVD 988
                           DF+ +  +           G     R+ +E+P + F+PS G L +
Sbjct: 418  IRLFYGLDPHTATEIDFEFSSADALQTQRRPIPKGHCTACRITSEDPNEGFKPSGGSLHE 477

Query: 989  VKFPDWARVDTWVKKGTN--ISPEYDPTLAKIIVHGKDRDDAISKLNQALEETKVYGCI- 1045
            + F   + V  +   G N  I    D     I   G++R  +   +  AL+E  + G   
Sbjct: 478  LNFRSSSNVWGYFSVGNNGGIHSFSDSQFGHIFAFGENRQASRKHMVVALKELSIRGDFR 537

Query: 1046 TNIDYLKSIITSDFFAKAKVSTNILN 1071
            T ++YL  ++ ++ F    ++T  L+
Sbjct: 538  TTVEYLIKLLETEDFEDNTITTGWLD 563

>KLLA0F06072g 583276..589971 highly similar to sp|Q00955 Saccharomyces
            cerevisiae YNR016c ACC1 acetyl-CoA carboxylase, start by
            similarity
          Length = 2231

 Score =  213 bits (543), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 151/506 (29%), Positives = 246/506 (48%), Gaps = 74/506 (14%)

Query: 636  VLIANRGEIAVRIIKTLKKLGIRS-----------VAVYSDPDKYSQHVTDADVSVPLHG 684
            VLIAN G  AV+ I++++K    +           +A   D +  ++++  AD  + + G
Sbjct: 63   VLIANNGIAAVKEIRSVRKWAYETFGDERTVQFVAMATPEDLEANAEYIRMADQYIEVPG 122

Query: 685  TTAAQTYLDMNKIIDAAKQTNAQAIIPGYGFLSENADFSD--ACTSAGITFVGPSGDIIR 742
             T    Y +++ I++ A++ +  A+  G+G  SEN    +  A +   I F+GP G+ +R
Sbjct: 123  GTNNNNYANVDLIVEVAERADVDAVWAGWGHASENPLLPERLAASHRKIIFIGPPGNAMR 182

Query: 743  GLGLKHSARQIAQKAGVPLVPGSLL-------------------------ITSXXXXXXX 777
             LG K S+  +AQ A VP +P S                            +S       
Sbjct: 183  SLGDKISSTIVAQHAKVPCIPWSGTGVDEVHVDKETNLVSVEDKVYQEGCCSSPEDGLKK 242

Query: 778  XXXLEYPVMVKSTAGGGGIGLQKVDSEEDIEHIFETVKHQGETFFGDAGVFLERFIENAR 837
               + +P+MVK++ GGGG G++KV++E++    F ++  Q       + +F+ +    AR
Sbjct: 243  AKEIGFPIMVKASEGGGGKGIRKVENEDE----FLSLYQQAANEIPGSPIFIMKLAGKAR 298

Query: 838  HVEVQLMGDGFGKAIALGERDCSLQRRNQKVIEETPAPNLPEKTRLALRKAAESLGSLLN 897
            H+EVQL+ D +G  I+L  RDCS+QRR+QK+IEE P       T   + KAA  LG L+ 
Sbjct: 299  HLEVQLLADQYGTNISLFGRDCSVQRRHQKIIEEAPVTIAKPDTFTEMEKAAVRLGQLVG 358

Query: 898  YKCAGTVEFIYDEKKDEFYFLEVNTRLQVEHPITEMVTGLDLVEWMIRIA---------- 947
            Y  AGTVE++Y   +D+FYFLE+N RLQVEHP TEMVTG++L    ++IA          
Sbjct: 359  YVSAGTVEYLYSHDEDKFYFLELNPRLQVEHPTTEMVTGVNLPSAQLQIAMGIPMHRIRD 418

Query: 948  ----------ANDAPDFDSTKVEV---------NGVSMEARLYAENPLKNFRPSPGLLVD 988
                      +    DF+ +  E           G     R+ +E+P + F+PS G L +
Sbjct: 419  IRLLYGVDPKSASEIDFNFSTPESAKTQRKPTPKGHCTACRITSEDPNEGFKPSGGALHE 478

Query: 989  VKFPDWARVDTWVKKGTN--ISPEYDPTLAKIIVHGKDRDDAISKLNQALEETKVYGCI- 1045
            + F   + V  +   G N  I    D     I   G++R  +   +  AL+E  + G   
Sbjct: 479  LNFRSSSNVWGYFSVGNNGGIHSFSDSQFGHIFAFGENRQASRKHMVVALKELSIRGDFR 538

Query: 1046 TNIDYLKSIITSDFFAKAKVSTNILN 1071
            T ++YL  ++ ++ F    ++T  L+
Sbjct: 539  TTVEYLIKLLETEDFEDNTITTGWLD 564

>Kwal_23.6157
          Length = 2230

 Score =  213 bits (542), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 154/508 (30%), Positives = 246/508 (48%), Gaps = 78/508 (15%)

Query: 636  VLIANRGEIAVRIIKTLKKLGIRS-----------VAVYSDPDKYSQHVTDADVSVPLHG 684
            VLIAN G  AV+ I++++K    +           +A   D +  ++++  AD  V + G
Sbjct: 63   VLIANNGIAAVKEIRSVRKWAYETFGNERAVQFVAMATPEDLEANAEYLRMADQYVEVPG 122

Query: 685  TTAAQTYLDMNKIIDAAKQTNAQAIIPGYGFLSENADFSD--ACTSAGITFVGPSGDIIR 742
             T    Y +++ I++ A++ +  A+  G+G  SEN    +  A +   + F+GP G+ +R
Sbjct: 123  GTNNNNYANVDLIVELAERADVDAVWAGWGHASENPLLPERLAASPRKVIFIGPPGNAMR 182

Query: 743  GLGLKHSARQIAQKAGVPLVP---------------GSLLIT----------SXXXXXXX 777
             LG K S+  +AQ A VP +P               G + +T          S       
Sbjct: 183  SLGDKISSTIVAQHAKVPCIPWSGTGVDQVHLDEENGLVSVTDDIYQKGCCDSPEDGLAK 242

Query: 778  XXXLEYPVMVKSTAGGGGIGLQKVDSEEDIEHIFETVKHQGETFFGDAGVFLERFIENAR 837
               + +PVMVK++ GGGG G++KV+ E+D    F  +  Q       + +F+ +   NAR
Sbjct: 243  AKKIGFPVMVKASEGGGGKGIRKVEREQD----FIPLYKQAANEIPGSPIFIMKLAGNAR 298

Query: 838  HVEVQLMGDGFGKAIALGERDCSLQRRNQKVIEETPAPNLPEKTRLALRKAAESLGSLLN 897
            H+EVQL+ D +G  I+L  RDCS+QRR+QK+IEE P       T   + ++A  LG L+ 
Sbjct: 299  HLEVQLLADQYGTNISLFGRDCSVQRRHQKIIEEAPVTIAKPDTFTEMERSAVRLGKLVG 358

Query: 898  YKCAGTVEFIYDEKKDEFYFLEVNTRLQVEHPITEMVTGLDLVEWMIRIAAN-------- 949
            Y  AGTVE++Y    D+FYFLE+N RLQVEHP TEMV+G++L    ++IA          
Sbjct: 359  YVSAGTVEYLYSHDDDKFYFLELNPRLQVEHPTTEMVSGVNLPAAQLQIAMGIPMHRIKD 418

Query: 950  -----------------DAPDFDSTKVEV----NGVSMEARLYAENPLKNFRPSPGLLVD 988
                             D    DSTK++      G     R+ +E+P + F+PS G L +
Sbjct: 419  IRLMYGVDPHTATEIDFDFSSKDSTKIQRRPTPKGHCTACRITSEDPNEGFKPSGGSLHE 478

Query: 989  VKFPDWARVDTW----VKKGTNISPEYDPTLAKIIVHGKDRDDAISKLNQALEETKVYGC 1044
            + F   + V  W    V     I    D     I   G++R  +   +  AL+E  + G 
Sbjct: 479  LNFRSSSNV--WGYFSVSSSGGIHSFSDSQFGHIFAFGENRQASRKHMVVALKELSIRGD 536

Query: 1045 I-TNIDYLKSIITSDFFAKAKVSTNILN 1071
              T ++YL  ++ ++ F    ++T  L+
Sbjct: 537  FRTTVEYLIKLLETEDFEGNSITTGWLD 564

>ABR140C [732] [Homologous to ScYMR293C - SH] (662185..663576) [1392
           bp, 463 aa]
          Length = 463

 Score =  100 bits (249), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 76/233 (32%), Positives = 113/233 (48%), Gaps = 15/233 (6%)

Query: 47  PVDNAWISLISKENLLHQFQILKSRENKETLPLYGVPIAVKDNIDVRGLPTTAACPSFA- 105
           P  N   ++ +  NL    Q++ S +     PL  + + +KDNI  + LPTT +    A 
Sbjct: 12  PRANERFNIFNSVNLSAAQQVMPSEK-----PLGNLVVGIKDNIVTKKLPTTCSSGVLAG 66

Query: 106 YEPSKDSKVVELLRNAGAIIVGKTNLDQFATGLVGTRSPYGKT--PCAFSKEHXXXXXXX 163
           Y    D+ VVELL  AGA+  GKTN+D+F  G  G  S +G T  P    +         
Sbjct: 67  YMSPYDATVVELLDEAGAVTAGKTNMDEFGMGSGGIHSFFGPTLNPAFPERPTVAGGSSS 126

Query: 164 XXXXXXXRGIVPIALGTDTAGSGRVPAALNNLIGLKPTKGVFSCQGVVPACKSLDCVSIF 223
                   G+V  ALGTDT GS R+PAA  + +G KP+ G  S  GV+   +SLD V I 
Sbjct: 127 GSAAAVAAGVVDFALGTDTGGSVRMPAAYTSTVGFKPSYGRVSRHGVIAYAQSLDTVGIG 186

Query: 224 ALNLSDAERCFRIMCQPDPDN-----DEYSRPYVSNPLKKFSSNVTIAIPKNI 271
           A ++    R F ++ + DP +     DE  +   +  L++   ++ I IP  +
Sbjct: 187 ARDVGLVRRVFEVLDRHDPKDPTSLPDELRQQAAA--LRREKKHLKIGIPAEL 237

>Scas_684.25
          Length = 482

 Score = 97.8 bits (242), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 64/167 (38%), Positives = 85/167 (50%), Gaps = 3/167 (1%)

Query: 78  PLYGVPIAVKDNIDVRGLPTTAACPSFA-YEPSKDSKVVELLRNAGAIIVGKTNLDQFAT 136
           PL     AVKDNI    +PTT +    + Y+   D+ VV+LLR +G  IVGKTN+D+FA 
Sbjct: 48  PLSNTLCAVKDNIATNDMPTTCSSSMLSNYQSPFDATVVKLLRESGTTIVGKTNMDEFAM 107

Query: 137 GLVGTRSPYGK--TPCAFSKEHXXXXXXXXXXXXXXRGIVPIALGTDTAGSGRVPAALNN 194
           G +G  S YG    P     +                G+V  ALGTDT GS R+PA   +
Sbjct: 108 GSLGIHSHYGPALNPLFHDVDTVSGGSSSGSAGSVTSGVVHFALGTDTGGSVRLPACYCS 167

Query: 195 LIGLKPTKGVFSCQGVVPACKSLDCVSIFALNLSDAERCFRIMCQPD 241
           ++G K + G  S  GVV   +SLD V I A NL   +  F  + + D
Sbjct: 168 VLGFKGSYGRISRFGVVSFAQSLDTVGIMADNLQRVKDVFNTLDKFD 214

>Kwal_23.4249
          Length = 465

 Score = 95.1 bits (235), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 84/252 (33%), Positives = 124/252 (49%), Gaps = 21/252 (8%)

Query: 28  SSQASLRLLESLLDSQNVAPVDNAWISLISKENLLHQFQILKSRENKETLPLYGVPIAVK 87
           SS+A+L+ L SL   Q      NA+  +  K    H+     S  + E  PL  +   +K
Sbjct: 2   SSKAALKRLSSLPTVQKQF---NAFTYINPK---CHERLSQGSSADDEK-PLKNILCGIK 54

Query: 88  DNIDVRGLPTTAACPSFA-YEPSKDSKVVELLRNAGAIIVGKTNLDQFATGLVGTRSPYG 146
           DNI  + LPT+        ++   ++ VV+LL  AGA+ VGKTN+D+F  G  GT S +G
Sbjct: 55  DNIATKELPTSCGSKILKDFQSPFNATVVDLLEGAGAVTVGKTNMDEFGMGSGGTHSHFG 114

Query: 147 KT--PCAFSKEHXXXXXXXXXXXXXXRGIVPIALGTDTAGSGRVPAALNNLIGLKPTKGV 204
            T  P   S                   +V  A+GTDT GS R+PAA  +++G KP+ G 
Sbjct: 115 PTRNPQFPSDNVIAGGSSSGSAAAVAADVVDFAIGTDTGGSVRLPAAYTSVMGFKPSYGR 174

Query: 205 FSCQGVVPACKSLDCVSIFALNLSDAERCFRIMCQ---PDPDN-DEYSRPYVSNPLKKFS 260
            S  GVV   +SLD V I A ++   ++ F+++ +    DP + DE SR      L KF 
Sbjct: 175 ISRHGVVAYAQSLDTVGILAKDIDIVQQVFKVLDKYDWKDPTSLDETSR----EKLAKFH 230

Query: 261 SNVT---IAIPK 269
            + T   + IP+
Sbjct: 231 CSKTKLKVGIPQ 242

>KLLA0A09845g complement(862467..863876) similar to sp|Q03557
           Saccharomyces cerevisiae YMR293c, start by similarity
          Length = 469

 Score = 94.0 bits (232), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 62/168 (36%), Positives = 85/168 (50%), Gaps = 4/168 (2%)

Query: 78  PLYGVPIAVKDNIDVRGLPTTAACPSF-AYEPSKDSKVVELLRNAGAIIVGKTNLDQFAT 136
           PL     A+KDNI  + +P+T A      Y    D+ VV LL  AG +I GK N+D+F  
Sbjct: 46  PLNYTLAAIKDNIATKNMPSTCASKILDGYMSPFDATVVSLLLEAGTVIAGKANMDEFGM 105

Query: 137 GLVGTRSPYGKT--PCAFSKEHX-XXXXXXXXXXXXXRGIVPIALGTDTAGSGRVPAALN 193
           G  G  S +G T  P    K+                 G+V  ALGTDT GS R+PA+  
Sbjct: 106 GSAGIHSHFGPTFNPLFDHKDRVIAGGSSSGSAAAVASGVVDFALGTDTGGSVRLPASYT 165

Query: 194 NLIGLKPTKGVFSCQGVVPACKSLDCVSIFALNLSDAERCFRIMCQPD 241
           +  G KP+ G  S  GV+   +SLD V +FA +LS  +R F ++ + D
Sbjct: 166 STFGFKPSYGRLSRHGVISYAQSLDTVGVFANDLSMIDRVFSLLDKHD 213

>CAGL0M13585g complement(1335488..1336891) similar to sp|Q03557
           Saccharomyces cerevisiae YMR293c, hypothetical start
          Length = 467

 Score = 90.9 bits (224), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 57/169 (33%), Positives = 84/169 (49%), Gaps = 8/169 (4%)

Query: 79  LYGVPIAVKDNIDVRGLPTTAACPSF-AYEPSKDSKVVELLRNAGAIIVGKTNLDQFATG 137
           L G+   +KDNI  + +PTT        Y+   D+ VV+LL+  G+I++GKTNLD+F  G
Sbjct: 39  LSGLLCGIKDNIVTKDMPTTCGSEILRGYQSPYDATVVKLLKQEGSIVLGKTNLDEFGMG 98

Query: 138 LVGTRSPYGKT-----PCAFSKEHXXXXXXXXXXXXXXRGIVPIALGTDTAGSGRVPAAL 192
             G  S +G T     P A   +                  V  +LGTDT GS R+PA  
Sbjct: 99  SRGIHSCFGPTFNPLYPAA--DKVIMGGSSSGSAAAVVSEAVDFSLGTDTGGSVRLPATY 156

Query: 193 NNLIGLKPTKGVFSCQGVVPACKSLDCVSIFALNLSDAERCFRIMCQPD 241
            ++ G KP+ G  S  GV+   +SLD V I   N+S   + + ++ + D
Sbjct: 157 GSIYGFKPSYGRISRYGVIAYAQSLDTVGILTKNISTLRKVYHVLDKYD 205

>YMR293C (YMR293C) [4247] chr13 complement(855398..856792) Protein
           with similarity to amidases, may be involved in
           mitochondrial function [1395 bp, 464 aa]
          Length = 464

 Score = 84.3 bits (207), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 62/183 (33%), Positives = 87/183 (47%), Gaps = 10/183 (5%)

Query: 65  FQILKSRENKETLPLYGVPIAVKDNIDVRGLPTTAACPSFAYEPSK---DSKVVELLRNA 121
           + I   +  KETL   G   ++KDNI  +  PTT  C S   E  K   D+ VV+LL+ A
Sbjct: 32  YSITNKKGTKETLT--GCVASIKDNIVTKDFPTT--CASHILENFKSPFDATVVKLLKQA 87

Query: 122 GAIIVGKTNLDQFATGLVGT---RSPYGKTPCAFSKEHXXXXXXXXXXXXXXRGIVPIAL 178
           G  I+GKTNLD+F  G  G    R P          +                 +V  AL
Sbjct: 88  GVHILGKTNLDEFGMGSGGVHSIRGPVINPLYPHEDKKIMGGSSSGAAASVACDLVDFAL 147

Query: 179 GTDTAGSGRVPAALNNLIGLKPTKGVFSCQGVVPACKSLDCVSIFALNLSDAERCFRIMC 238
           GTDT GS R+PA   +++G KP+ G  S  GV+   +SLD V I +  ++   + F  + 
Sbjct: 148 GTDTGGSVRLPACYGSVLGFKPSYGRLSRFGVIAYSQSLDTVGILSKKINVLRKVFHTLD 207

Query: 239 QPD 241
           + D
Sbjct: 208 KYD 210

>Kwal_56.22295
          Length = 583

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 57/179 (31%), Positives = 85/179 (47%), Gaps = 10/179 (5%)

Query: 78  PLYGVPIAVKDNIDVRGLPTTAACPSFAYEPS---KDSKVVELLRNAGAIIVGKTNLDQF 134
           PL+G+P  VKDN   +    T  C S+A   S   +D+ VV  LR+AGA++ G   L ++
Sbjct: 131 PLHGIPFVVKDNYATKDKMDTT-CGSWALLGSVVPRDAHVVAKLRDAGAVLFGHATLSEW 189

Query: 135 A-----TGLVGTRSPYGKTPCAFSKEHXXXXXXXXXXXXXXRGIVPIALGTDTAGSGRVP 189
           A     +   G  +  G+  C F+                   ++P +LGT+T GS   P
Sbjct: 190 ADMRSSSYSEGYSARGGQARCPFNLSVNPGGSSSGSAAAVAANMIPFSLGTETDGSIIDP 249

Query: 190 AALNNLIGLKPTKGVFSCQGVVPACKSLDCVSIFALNLSDAERCFRIMCQPDPDNDEYS 248
           A  N ++G KPT G+ S  GVVP  +  D     A ++ DA   F+ M   D + D Y+
Sbjct: 250 AMRNGIVGFKPTVGLTSRAGVVPESEHQDSTGPMARSVRDAVYAFQYMWGVD-ERDVYT 307

>Sklu_2417.11 , Contig c2417 20071-21846
          Length = 591

 Score = 73.6 bits (179), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 54/178 (30%), Positives = 83/178 (46%), Gaps = 8/178 (4%)

Query: 78  PLYGVPIAVKDNIDVRG-LPTTAACPSFAYEP-SKDSKVVELLRNAGAIIVGKTNLDQFA 135
           PL+G+P  VKDN   +  + TTA   S       +D+ VVE LR+AGA++ G   + ++A
Sbjct: 140 PLHGIPFVVKDNYATKDKMDTTAGSWSLMGSVVPRDAYVVEKLRDAGAVLFGHATMSEWA 199

Query: 136 -----TGLVGTRSPYGKTPCAFSKEHXXXXXXXXXXXXXXRGIVPIALGTDTAGSGRVPA 190
                +   G  +  G+  C F+                   ++  +LGT+T GS   PA
Sbjct: 200 DMRSNSYSEGYSARGGQARCPFNLTVNPGGSSSGSAGSVAANMIMFSLGTETDGSIIDPA 259

Query: 191 ALNNLIGLKPTKGVFSCQGVVPACKSLDCVSIFALNLSDAERCFRIMCQPDPDNDEYS 248
             N ++G KPT G+ S  GV+P  +  D     A  + DA   F+ M   D + D Y+
Sbjct: 260 MRNGIVGFKPTVGLTSRAGVIPESEHQDSTGPMARTVKDAVYVFQSMWGVD-ERDAYT 316

>Sklu_2417.10 , Contig c2417 20071-21846
          Length = 591

 Score = 73.6 bits (179), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 54/178 (30%), Positives = 83/178 (46%), Gaps = 8/178 (4%)

Query: 78  PLYGVPIAVKDNIDVRG-LPTTAACPSFAYEP-SKDSKVVELLRNAGAIIVGKTNLDQFA 135
           PL+G+P  VKDN   +  + TTA   S       +D+ VVE LR+AGA++ G   + ++A
Sbjct: 140 PLHGIPFVVKDNYATKDKMDTTAGSWSLMGSVVPRDAYVVEKLRDAGAVLFGHATMSEWA 199

Query: 136 -----TGLVGTRSPYGKTPCAFSKEHXXXXXXXXXXXXXXRGIVPIALGTDTAGSGRVPA 190
                +   G  +  G+  C F+                   ++  +LGT+T GS   PA
Sbjct: 200 DMRSNSYSEGYSARGGQARCPFNLTVNPGGSSSGSAGSVAANMIMFSLGTETDGSIIDPA 259

Query: 191 ALNNLIGLKPTKGVFSCQGVVPACKSLDCVSIFALNLSDAERCFRIMCQPDPDNDEYS 248
             N ++G KPT G+ S  GV+P  +  D     A  + DA   F+ M   D + D Y+
Sbjct: 260 MRNGIVGFKPTVGLTSRAGVIPESEHQDSTGPMARTVKDAVYVFQSMWGVD-ERDAYT 316

>Scas_721.66
          Length = 573

 Score = 71.2 bits (173), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 50/163 (30%), Positives = 79/163 (48%), Gaps = 4/163 (2%)

Query: 45  VAPVDNAWISLISKENLLHQFQILKSRENKETLP-LYGVPIAVKDNIDVRGLPTTAACPS 103
           +  V N    ++  E L H   + +++    TLP LYG+PI++KD  +V G+ TT    S
Sbjct: 107 IHQVVNCLSEIMFTEALEHSKILDQNKYEYSTLPPLYGIPISLKDQCNVEGVDTTLGYLS 166

Query: 104 FAYEPSK---DSKVVELLRNAGAIIVGKTNLDQFATGLVGTRSPYGKTPCAFSKEHXXXX 160
            A++P K   +S +V  LR+ GAII  KT +         T + +G T  +F++      
Sbjct: 167 RAFKPKKKEDESLIVSFLRDLGAIIYVKTTVPPSMMATETTSNTFGYTYNSFNQHFSAGG 226

Query: 161 XXXXXXXXXXRGIVPIALGTDTAGSGRVPAALNNLIGLKPTKG 203
                          + LGTD  GS R+PA+ + + G KP+ G
Sbjct: 227 SSGGEGSLIGCYGSVLGLGTDIGGSIRIPASYHGIFGFKPSTG 269

>Sklu_1884.2 YDR242W, Contig c1884 1484-3124 reverse complement
          Length = 546

 Score = 66.6 bits (161), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 50/194 (25%), Positives = 88/194 (45%), Gaps = 20/194 (10%)

Query: 62  LHQFQILKSRENKETLPLYGVPIAVKDNIDVRGLPTTAACPSFAYEP---SKDSKVVELL 118
           L + ++L  R+  + LPLYG+PI++KD  +V G  TT      A++P   +++S +V+ L
Sbjct: 103 LERAKLLDERKPDKLLPLYGIPISLKDQCNVAGYDTTLGYLGRAFKPKTAAEESLLVKFL 162

Query: 119 RNAGAIIVGKTNLDQFATGLVGTRSPYGKTPCAFSKEHXXXXXXXXXXXXXXRGIVPIAL 178
           ++ GA++  KT +           + +G T  + +                      + +
Sbjct: 163 KDLGAVLYVKTTVPSSMMASETVSNTFGYTLNSVNTNFSSGGSSGGEGSLIGCYGSILGI 222

Query: 179 GTDTAGSGRVPAALNNLIGLKPTKG---------VFSCQGVVPACKSLDCVSIFALNLSD 229
           GTD  GS R+P++   L GL+PT G          F  Q ++P+      +   A NL D
Sbjct: 223 GTDIGGSIRIPSSFQGLFGLRPTHGRLPYLKVDNSFEGQELIPS-----VIGPLARNLED 277

Query: 230 AERCFRIM---CQP 240
            E    ++   C+P
Sbjct: 278 LEFFMELIVNKCKP 291

>YDR242W (AMD2) [1076] chr4 (946799..948448) Protein with similarity
           to amidases [1650 bp, 549 aa]
          Length = 549

 Score = 66.6 bits (161), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 63/257 (24%), Positives = 106/257 (41%), Gaps = 30/257 (11%)

Query: 78  PLYGVPIAVKDNIDVRGLPTTAACPSFAYEP---SKDSKVVELLRNAGAIIVGKTNLDQF 134
           PLYG+PI++KD  +V G+ T+       ++P   +++S +V  LR+ GAII  KT +   
Sbjct: 123 PLYGIPISLKDQCNVEGVDTSLGYLCRTFKPKTKNEESLIVSFLRDLGAIIFVKTTVPSS 182

Query: 135 ATGLVGTRSPYGKTPCAFSKEHXXXXXXXXXXXXXXRGIVPIALGTDTAGSGRVPAALNN 194
                   + +G T  + +                      + LGTD  GS R+P++   
Sbjct: 183 MMATDTQSNTFGYTYNSINLSFSSGGSSGGEGSLIGAHGSLLGLGTDIGGSIRIPSSYQG 242

Query: 195 LIGLKPTKG---------VFSCQGVVPACKSLDCVSIFALNLSDAE---RCFRIMCQPDP 242
           L GLKPT G          F  +  +P+      +   A +LSD      C   +CQP  
Sbjct: 243 LFGLKPTFGRVPYLRVDNSFEGRETIPS-----VIGPLARDLSDLRYFMSCVINICQPWV 297

Query: 243 DNDEYSRPYVSNPLKKFSSNVTIAIPKNIPWYGE-----TKNPVLFSNAVENLSRTGANV 297
            + +    +  +   K   N  + I     WYG+       + +      E+L      +
Sbjct: 298 QDVKCIPYHFDSSTSKLHDNYVVGI-----WYGDGVIDPPPSDIRALKTCEDLVNKTKGM 352

Query: 298 IEIDFEPLLELARCLYE 314
             + +EP  EL+R L++
Sbjct: 353 KAVKWEPSSELSRELFD 369

>Sklu_2136.3 , Contig c2136 3336-5189 reverse complement
          Length = 617

 Score = 57.8 bits (138), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 69/284 (24%), Positives = 117/284 (41%), Gaps = 51/284 (17%)

Query: 78  PLYGVPIAVKDNIDVRGLPTTAACPSFAYEPSKDSKV-VELLRNAGAIIVGKTNLDQFAT 136
           PL+GVP+++K+ ++ +G PT A+  S+     K+S V +++L   GAI   +T+  Q   
Sbjct: 188 PLHGVPVSLKEQMNFKGKPTHASYVSYITNIPKNSAVSIDILDKLGAIFHTRTSQPQAIM 247

Query: 137 GLVGTRSPYGKT--PCAFSKEHXXXXXXXXXXXXXXRGIVPIALGTDTAGSGRVPAALNN 194
            L    +  G+T  PC+ ++                 G V I  G+D  GS RVPAA  +
Sbjct: 248 HLDTWNNITGRTRNPCS-TRLSPGGSSGGESAMVGMHGSV-IGHGSDIGGSIRVPAAFVD 305

Query: 195 LIGLKPT----------------KGVFSCQGVVPACKSLDCVSIFALNLSDAERCFRI-- 236
           L G++PT                + + S QG  P  +S+D +  +     +  + +    
Sbjct: 306 LFGIRPTTRRISSLNGLSGGKGQESIVSTQG--PIARSIDELDYYMKAYINEGKPWEYDS 363

Query: 237 MCQPDP---------------DNDEYSRPY------VSNPLKKFSSNVTIAIPKNIP-WY 274
           +C P P                +D    PY      ++  ++K  ++ +  I    P WY
Sbjct: 364 LCVPIPWREANLPSKIKIGVLSDDNLVTPYPAVSRAIAESVEKLKADDSFEIIDLSPYWY 423

Query: 275 GETKNPVLFSNAVENLSRTGANV----IEIDFEPLLELARCLYE 314
            E +   ++   V   +  G  V     E   EPLL + R   E
Sbjct: 424 SEAQMEEIYDVNVSLYTCDGNKVQLSMFEESGEPLLPMTRHFLE 467

>YJL130C (URA2) [2788] chr10 complement(165641..172285)
            Multifunctional protein of pyrimidine biosynthesis
            pathway, contains glutamine amidotransferase,
            glutamine-dependent carbamylphosphate synthetase
            (CPSase), dihydroorotase-like (DHOase) domain, and
            aspartate carbamyltransferase (ATCase) [6645 bp, 2214 aa]
          Length = 2214

 Score = 56.6 bits (135), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 63/300 (21%), Positives = 128/300 (42%), Gaps = 21/300 (7%)

Query: 645  AVRIIKTLKKLGIRSVAVYSDPDKYSQHVTDADVSVPLHGTTAAQTYLDMNKIIDAAKQT 704
            AV  ++TL+   I+++ V  +P+  S   TD D +  L+  T     +++ +++D  +  
Sbjct: 1002 AVTAVRTLRANNIKTIMVNYNPETVS---TDYDEADRLYFET-----INLERVLDIYEIE 1053

Query: 705  NAQAIIPGYGFLSENADFSDACTSAGITFVGPSGDIIRGLGLKHSARQIAQKAGVPLVPG 764
            N+  ++   G  + N + +       +  +G S D+I     ++   ++  + GV   P 
Sbjct: 1054 NSSGVVVSMGGQTSN-NIAMTLHRENVKILGTSPDMIDSAENRYKFSRMLDQIGVDQ-PA 1111

Query: 765  SLLITSXXXXXXXXXXLEYPVMVKSTAGGGGIGLQKVDSEEDIEHIFETVKHQGETFFGD 824
               +TS          + YPV+V+ +    G  +  V S+ D+E       +Q      D
Sbjct: 1112 WKELTSMDEAESFAEKVGYPVLVRPSYVLSGAAMNTVYSKNDLESYL----NQAVEVSRD 1167

Query: 825  AGVFLERFIENARHVEVQLM---GDGFGKAIALGERDCSLQRRNQKVIEETPAPNLPEKT 881
              V + ++IENA+ +E+  +   G+     ++    +  +   +  +I   P  +L  +T
Sbjct: 1168 YPVVITKYIENAKEIEMDAVARNGELVMHVVSEHVENAGVHSGDATLI--VPPQDLAPET 1225

Query: 882  RLALRKAAESLGSLLNYKCAGTVEFIYDEKKDEFYFLEVNTRLQVEHPITEMVTGLDLVE 941
               +  A   +G  L       ++FI   K +E   +E N R     P    V G++L+E
Sbjct: 1226 VDRIVVATAKIGKALKITGPYNIQFI--AKDNEIKVIECNVRASRSFPFISKVVGVNLIE 1283

 Score = 38.1 bits (87), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 56/276 (20%), Positives = 110/276 (39%), Gaps = 37/276 (13%)

Query: 783  YPVMVKSTAGGGGIGLQKVDSEEDIEHIFETVKHQGETFFGDAGVFLERFIENARHVEVQ 842
            +PV+V++    GG+G    ++E+      E V      F     V +E+ ++  + VE +
Sbjct: 593  FPVIVRAAYALGGLGSGFANNEK------ELVDLCNVAFSSSPQVLVEKSMKGWKEVEYE 646

Query: 843  LMGDGFGKAIALGERDCSLQR------RNQKVIEETPAPNLPEKTRLALRKAAESLGSLL 896
            ++ D F   I +    C+++            I   P+  L ++    LR  A ++   L
Sbjct: 647  VVRDAFDNCITV----CNMENFDPLGIHTGDSIVVAPSQTLSDEDYNMLRTTAVNVIRHL 702

Query: 897  NYKCAGTVEFIYDEKKDEFYFLEVNTRLQVEHPITEMVTGLDLVEWMIRIAANDAPDFDS 956
                   +++  +    ++  +EVN RL     +    TG  L     ++  N       
Sbjct: 703  GVVGECNIQYALNPVSKDYCIIEVNARLSRSSALASKATGYPLAYTAAKLGLN------- 755

Query: 957  TKVEVNGVSMEARLYAENPLKNFRPSPGLLVDVKFPDWARVDTWVKKGTNISPEYDPTL- 1015
              + +N V        ++    F PS    V VK P W      +KK T +S E   ++ 
Sbjct: 756  --IPLNEVKNSV---TKSTCACFEPSLDYCV-VKMPRWD-----LKKFTRVSTELSSSMK 804

Query: 1016 --AKIIVHGKDRDDAISKLNQALEETKVYGCITNID 1049
               +++  G+  ++AI K  ++ E   +    T++D
Sbjct: 805  SVGEVMSIGRTFEEAIQKAIRSTEYANLGFNETDLD 840

>CAGL0L05676g 619734..626369 highly similar to sp|P07259 Saccharomyces
            cerevisiae YJL130c URA2, start by similarity
          Length = 2211

 Score = 54.7 bits (130), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 61/304 (20%), Positives = 129/304 (42%), Gaps = 21/304 (6%)

Query: 645  AVRIIKTLKKLGIRSVAVYSDPDKYSQHVTDADVSVPLHGTTAAQTYLDMNKIIDAAKQT 704
            AV  ++TL+   I+++ +  +P+  S   TD D +  L+  T     +++ +++D  +  
Sbjct: 1000 AVTAVRTLRANNIKTIMINYNPETVS---TDYDEADRLYFET-----INLERVLDIYEAE 1051

Query: 705  NAQAIIPGYGFLSENADFSDACTSAGITFVGPSGDIIRGLGLKHSARQIAQKAGVPLVPG 764
             +  ++   G  + N + + +     +  +G S D+I     ++   ++  + GV   P 
Sbjct: 1052 ASNGVVVSMGGQTSN-NIAMSLHRENVKILGTSPDMIDSAENRYKFSRMLDQIGVDQ-PA 1109

Query: 765  SLLITSXXXXXXXXXXLEYPVMVKSTAGGGGIGLQKVDSEEDIEHIFETVKHQGETFFGD 824
               +TS          + YPV+V+ +    G  +  V S+ D+E       +Q      D
Sbjct: 1110 WKELTSMDEAEDFAEKVGYPVLVRPSYVLSGAAMNTVYSKNDLESYL----NQAVEVSRD 1165

Query: 825  AGVFLERFIENARHVEVQLM---GDGFGKAIALGERDCSLQRRNQKVIEETPAPNLPEKT 881
              V + ++IENA+ +E+  +   G+     ++    +  +   +  +I   P  +L  +T
Sbjct: 1166 YPVVITKYIENAKEIEMDAVARNGELVMHVVSEHVENAGVHSGDATLI--VPPQDLAPET 1223

Query: 882  RLALRKAAESLGSLLNYKCAGTVEFIYDEKKDEFYFLEVNTRLQVEHPITEMVTGLDLVE 941
               +  A   +G  L       ++FI   K +E   +E N R     P    V G++L+E
Sbjct: 1224 VDRIVVATAKIGKALKITGPYNIQFI--AKDNEIKVIECNVRASRSFPFISKVVGVNLIE 1281

Query: 942  WMIR 945
               +
Sbjct: 1282 LATK 1285

 Score = 40.8 bits (94), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 54/264 (20%), Positives = 106/264 (40%), Gaps = 37/264 (14%)

Query: 783  YPVMVKSTAGGGGIGLQKVDSEEDIEHIFETVKHQGETFFGDAGVFLERFIENARHVEVQ 842
            +PV+V++    GG+G    ++E+++  +          F     V +ER ++  + VE +
Sbjct: 591  FPVIVRAAYALGGLGSGFANNEQELIDLCNV------AFASSPQVLVERSMKGWKEVEYE 644

Query: 843  LMGDGFGKAIALGERDCSLQR------RNQKVIEETPAPNLPEKTRLALRKAAESLGSLL 896
            ++ D F   I +    C+++            I   P+  L ++    LR  A ++   L
Sbjct: 645  VVRDAFDNCITV----CNMENFDPLGIHTGDSIVVAPSQTLSDEDYNMLRTTAVNVIRHL 700

Query: 897  NYKCAGTVEFIYDEKKDEFYFLEVNTRLQVEHPITEMVTGLDLVEWMIRIAANDAPDFDS 956
                   +++  +    E+  +EVN RL     +    TG  L     ++  N       
Sbjct: 701  GVVGECNIQYALNPFSKEYCIIEVNARLSRSSALASKATGYPLAYTAAKLGLN------- 753

Query: 957  TKVEVNGVSMEARLYAENPLKNFRPSPGLLVDVKFPDWARVDTWVKKGTNISPEYDPTL- 1015
              + +N V        ++    F PS    V VK P W      +KK T +S E   ++ 
Sbjct: 754  --IPLNEVKNSV---TKSTCACFEPSLDYCV-VKMPRWD-----LKKFTRVSTELSSSMK 802

Query: 1016 --AKIIVHGKDRDDAISKLNQALE 1037
               +++  G+  ++AI K  ++ E
Sbjct: 803  SVGEVMSIGRTFEEAIQKAIRSTE 826

>KLLA0E15444g 1370741..1377427 highly similar to sp|P07259
            Saccharomyces cerevisiae YJL130c URA2 multifunctional
            pyrimidine biosynthesis protein, start by similarity
          Length = 2228

 Score = 54.7 bits (130), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 62/304 (20%), Positives = 131/304 (43%), Gaps = 21/304 (6%)

Query: 645  AVRIIKTLKKLGIRSVAVYSDPDKYSQHVTDADVSVPLHGTTAAQTYLDMNKIIDAAKQT 704
            AV  ++TL+K   +++ V  +P+  S   TD D +  L+  T     +++ +I+D  +  
Sbjct: 1000 AVTAVRTLRKNNFKTIMVNYNPETVS---TDYDEADRLYFET-----INLERIMDIYELE 1051

Query: 705  NAQAIIPGYGFLSENADFSDACTSAGITFVGPSGDIIRGLGLKHSARQIAQKAGVPLVPG 764
            ++  ++   G  + N + + +     +  +G S ++I     ++   ++  +  V   P 
Sbjct: 1052 SSAGVVVSMGGQTSN-NIAMSLHRENVKILGTSPEMIDSAENRYKFSRMLDQIDVDQ-PA 1109

Query: 765  SLLITSXXXXXXXXXXLEYPVMVKSTAGGGGIGLQKVDSEEDIEHIFETVKHQGETFFGD 824
               +TS          + YPV+V+ +    G  +  V S++D+E       +Q      +
Sbjct: 1110 WKELTSMDEAEDFAEKVSYPVLVRPSYVLSGAAMNTVYSKDDLESYL----NQAVEVSRE 1165

Query: 825  AGVFLERFIENARHVE---VQLMGDGFGKAIALGERDCSLQRRNQKVIEETPAPNLPEKT 881
              V + ++IENA+ +E   V L G+     ++    +  +   +  +I   P  +L  +T
Sbjct: 1166 YPVVITKYIENAKEIEMDAVALDGELIMHVVSEHVENAGVHSGDATLI--VPPQDLDPET 1223

Query: 882  RLALRKAAESLGSLLNYKCAGTVEFIYDEKKDEFYFLEVNTRLQVEHPITEMVTGLDLVE 941
               + +A   +G  L       ++FI   K +E   +E N R     P    V G++L+E
Sbjct: 1224 VRRIVEATAKIGRALQITGPYNIQFI--AKNNEIKVIECNVRASRSFPFISKVVGVNLIE 1281

Query: 942  WMIR 945
               +
Sbjct: 1282 MATK 1285

 Score = 36.6 bits (83), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 55/268 (20%), Positives = 107/268 (39%), Gaps = 37/268 (13%)

Query: 783  YPVMVKSTAGGGGIGLQKVDSEEDIEHIFETVKHQGETFFGDAGVFLERFIENARHVEVQ 842
            +PV+V++    GG+G     +E+      E V      F     V +ER ++  + +E +
Sbjct: 591  FPVIVRAAYALGGLGSGFASNEK------ELVDLCNVAFASSPQVLVERSMKGWKEIEYE 644

Query: 843  LMGDGFGKAIALGERDCSLQRRNQKVIEE------TPAPNLPEKTRLALRKAAESLGSLL 896
            ++ D F   I +    C+++  +   I         P+  L ++    LR  A ++   L
Sbjct: 645  VVRDAFDNCITV----CNMENFDPLGIHTGDSIVIAPSQTLSDEDYNMLRTTAVNVIRHL 700

Query: 897  NYKCAGTVEFIYDEKKDEFYFLEVNTRLQVEHPITEMVTGLDLVEWMIRIAANDAPDFDS 956
                   +++  +    E+  +EVN RL     +    TG  L     ++  N  P ++ 
Sbjct: 701  GVVGECNIQYALNPTSKEYCIIEVNARLSRSSALASKATGYPLAYTAAKLGLN-IPLYEV 759

Query: 957  TKVEVNGVSMEARLYAENPLKNFRPSPGLLVDVKFPDWARVDTWVKKGTNISPEYDPTL- 1015
                 N V+        +    F PS    V VK P W      +KK T +S     ++ 
Sbjct: 760  K----NSVT-------RSTCACFEPSLDYCV-VKMPRWD-----LKKFTRVSTLLSSSMK 802

Query: 1016 --AKIIVHGKDRDDAISKLNQALEETKV 1041
               +++  G+  ++AI K  ++ E + +
Sbjct: 803  SVGEVMSIGRTFEEAIQKAIRSTEYSNI 830

>Kwal_34.15724
          Length = 556

 Score = 54.3 bits (129), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 59/126 (46%), Gaps = 1/126 (0%)

Query: 79  LYGVPIAVKDNIDVRGLPTTAACPS-FAYEPSKDSKVVELLRNAGAIIVGKTNLDQFATG 137
           L+GVPI++KD +++ G+ TT    S    +  K S +  +L++ GAI   KT +      
Sbjct: 124 LHGVPISLKDQVNLPGIETTIGYISKVGSKSEKVSLLARVLQDQGAIFYVKTAVPTAMLA 183

Query: 138 LVGTRSPYGKTPCAFSKEHXXXXXXXXXXXXXXRGIVPIALGTDTAGSGRVPAALNNLIG 197
                S +G+T  A +                     P+ +GTD  GS R+PAA   L G
Sbjct: 184 SETVSSLHGRTLNAVNIAFSSGGSSGGEGSLIGARGSPLGVGTDIGGSIRIPAAFQGLYG 243

Query: 198 LKPTKG 203
           L+P+ G
Sbjct: 244 LRPSHG 249

>Scas_582.4*
          Length = 2193

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 61/304 (20%), Positives = 130/304 (42%), Gaps = 21/304 (6%)

Query: 645  AVRIIKTLKKLGIRSVAVYSDPDKYSQHVTDADVSVPLHGTTAAQTYLDMNKIIDAAKQT 704
            AV  ++TL+   I+++ +  +P+  S   TD D +  L+  T     +++ +I+D  +  
Sbjct: 977  AVTAVRTLRANKIKTIMINYNPETVS---TDYDEADRLYFET-----INLERILDIYEIE 1028

Query: 705  NAQAIIPGYGFLSENADFSDACTSAGITFVGPSGDIIRGLGLKHSARQIAQKAGVPLVPG 764
            N+  ++   G  + N + + +     +  +G S ++I     ++   ++  + GV   P 
Sbjct: 1029 NSSGVVVSMGGQTSN-NIAMSLHRENVKILGTSPEMIDSAENRYKFSRMLDQIGVDQ-PA 1086

Query: 765  SLLITSXXXXXXXXXXLEYPVMVKSTAGGGGIGLQKVDSEEDIEHIFETVKHQGETFFGD 824
               +TS          + YPV+V+ +    G  +  V S+ D+        +Q      D
Sbjct: 1087 WKELTSMDEAESFAEKVGYPVLVRPSYVLSGAAMNTVYSKNDLASYL----NQAVEVSRD 1142

Query: 825  AGVFLERFIENARHVEVQLM---GDGFGKAIALGERDCSLQRRNQKVIEETPAPNLPEKT 881
              V + ++IENA+ +E+  +   G+     ++    +  +   +  +I   P  +L ++T
Sbjct: 1143 YPVVITKYIENAKEIEMDAVARNGELVMHVVSEHVENAGVHSGDATLI--VPPQDLAKET 1200

Query: 882  RLALRKAAESLGSLLNYKCAGTVEFIYDEKKDEFYFLEVNTRLQVEHPITEMVTGLDLVE 941
               +  A   +G  L       ++FI   K +E   +E N R     P    V G++L+E
Sbjct: 1201 VDRIVVATAKIGKALKITGPYNIQFI--AKDNEIKVIECNVRASRSFPFISKVVGVNLIE 1258

Query: 942  WMIR 945
               +
Sbjct: 1259 LATK 1262

 Score = 38.9 bits (89), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 52/264 (19%), Positives = 106/264 (40%), Gaps = 37/264 (14%)

Query: 783  YPVMVKSTAGGGGIGLQKVDSEEDIEHIFETVKHQGETFFGDAGVFLERFIENARHVEVQ 842
            +PV+V++    GG+G    ++E+++  +          F     V +ER ++  + +E +
Sbjct: 588  FPVIVRAAYALGGLGSGFANNEQELIDLCNV------AFASSPQVLVERSMKGWKEIEYE 641

Query: 843  LMGDGFGKAIALGERDCSLQR------RNQKVIEETPAPNLPEKTRLALRKAAESLGSLL 896
            ++ D F   + +    C+++            I   P+  L ++    LR  A ++   L
Sbjct: 642  VVRDAFDNCVTV----CNMENFDPLGIHTGDSIVVAPSQTLSDEEYNMLRNTAVNVIRHL 697

Query: 897  NYKCAGTVEFIYDEKKDEFYFLEVNTRLQVEHPITEMVTGLDLVEWMIRIAANDAPDFDS 956
                   +++  +    E+  +EVN RL     +    TG  L     ++  N       
Sbjct: 698  GVVGECNIQYALNPFSKEYCIIEVNARLSRSSALASKATGYPLAYTAAKLGLN------- 750

Query: 957  TKVEVNGVSMEARLYAENPLKNFRPSPGLLVDVKFPDWARVDTWVKKGTNISPEYDPTL- 1015
              + +N V        ++    F PS    V VK P W      +KK T +S E   ++ 
Sbjct: 751  --IPLNEVINSV---TKSTCACFEPSLDYCV-VKMPRWD-----LKKFTRVSTELSSSMK 799

Query: 1016 --AKIIVHGKDRDDAISKLNQALE 1037
               +++  G+  ++AI K  ++ E
Sbjct: 800  SVGEVMSIGRTFEEAIQKAIRSTE 823

>Sklu_2072.3 , Contig c2072 3010-4362 reverse complement
          Length = 450

 Score = 51.2 bits (121), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 88/420 (20%), Positives = 148/420 (35%), Gaps = 54/420 (12%)

Query: 70  SRENKETLPLYGVPIAVKDNIDVRGLPTTAACPSFAYE-PSKDSKVVELLRNAGAIIVGK 128
           S   K   P++G+P+++K++   +G  T A   S       +D+   E+ R AGA+   +
Sbjct: 20  SETGKTVGPMHGLPLSLKEHYAYKGKTTNAGFSSMIDNLTEEDALTTEIFRKAGAVFYIR 79

Query: 129 TNLDQFATGLVGTRSPYGKTPCAFSKEHXXXXXXXXXXXXXXRGIVPIALGTDTAGSGRV 188
           T   Q    L    +  G+     +                     P+  G+D  GS R 
Sbjct: 80  TTQPQSLMHLDSFNNITGRCRNPLNTLLSPGGSTSGEGALISLRGSPLGTGSDIGGSIRA 139

Query: 189 PAALNNLIGLKPTKGVFSCQGVVPACKSLD------CVSIFALNLSDAERCFRIMCQPDP 242
           PAA  N+ G KPT    S QG   + + +        V   A    D E   +     +P
Sbjct: 140 PAAFCNIWGFKPTNKRVSLQGAWASYRDMSNDMVLCSVGPMANTPEDLELYMKTFLDSEP 199

Query: 243 ---DNDEYSRPYVSNPLKKFSSNVTIAIPKNIPWYGETKNPVL--FSNAVENLSRTG-AN 296
              DN     P+    L      + I +   I    +   PVL     A ++L + G A 
Sbjct: 200 WLRDNYVIRLPWREVDLSLDKLKIAIVMDDGIV---KPSPPVLRALELAKKSLEKAGVAK 256

Query: 297 VIE-IDFEPLLELARCLYEGTWVAERYQAIQSFLDSKPPKESLDPTVISIIEGAKKYSAV 355
            +E + F     L  C Y        +     + +S  P   L    +    G +   ++
Sbjct: 257 CVEWVPFNTSEGLDIC-YTAYNCDGNFNHRSRYEESGEPLAPLSEHHMRFGCGDRGLDSL 315

Query: 356 DCFSFEYKRQGILQKVRRLLESVDVLCVPTCPLNPTMQQVADEPVLVNSRQGTWTNFVNL 415
           +   + +KR    Q+   ++  +DV  V    L P     A  P  +  +   +T   N+
Sbjct: 316 EMLQYLHKRDSYRQRFADMMNEIDVDYV----LTPAYFAPAAIPDKI--KYWGYTALYNI 369

Query: 416 ADLAALAVPAGF--------RD----------------------DGLPNGITLIGKKFTD 445
            DL  ++ P G         +D                      DG P G++L G+++ D
Sbjct: 370 LDLPGVSFPTGVVTDAKLDAKDANHVPRNALEEYEYPLYDEELYDGFPVGLSLHGRRYYD 429

>ACR263C [1310] [Homologous to ScYJL130C (URA2) - SH] (827830..834552)
            [6723 bp, 2240 aa]
          Length = 2240

 Score = 51.2 bits (121), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 60/304 (19%), Positives = 130/304 (42%), Gaps = 21/304 (6%)

Query: 645  AVRIIKTLKKLGIRSVAVYSDPDKYSQHVTDADVSVPLHGTTAAQTYLDMNKIIDAAKQT 704
            AV  ++TL++  ++++ V  +P+  S   TD D    L+  T     ++M +I+D  +  
Sbjct: 1018 AVTAVRTLRQNNVKTIMVNYNPETVS---TDYDEVDRLYFET-----INMERILDIYEVE 1069

Query: 705  NAQAIIPGYGFLSENADFSDACTSAGITFVGPSGDIIRGLGLKHSARQIAQKAGVPLVPG 764
            ++  ++   G  + N + + +     +  +G S ++I     ++   ++  +  V   P 
Sbjct: 1070 SSAGVVVSMGGQTSN-NIAMSLHRENVKILGTSPEMIDSAENRYKFSRMLDQIEVDQ-PA 1127

Query: 765  SLLITSXXXXXXXXXXLEYPVMVKSTAGGGGIGLQKVDSEEDIEHIFETVKHQGETFFGD 824
               +TS          + YPV+V+ +    G  +  V S++D+E       +Q      +
Sbjct: 1128 WKELTSMEEAEDFANKVGYPVLVRPSYVLSGAAMNTVYSKDDLESYL----NQAVEVSRE 1183

Query: 825  AGVFLERFIENARHVEVQLM---GDGFGKAIALGERDCSLQRRNQKVIEETPAPNLPEKT 881
              V + ++IENA+ +E+  +   G+     ++    +  +   +  +I   P  +L  +T
Sbjct: 1184 YPVVITKYIENAKEIEMDAVAKDGEMIMHVVSEHVENAGVHSGDATLI--VPPQDLDPET 1241

Query: 882  RLALRKAAESLGSLLNYKCAGTVEFIYDEKKDEFYFLEVNTRLQVEHPITEMVTGLDLVE 941
               +  A   +G  L       ++FI   K +E   +E N R     P    V G++L+E
Sbjct: 1242 VRRIVDATAKIGRALKITGPYNIQFI--AKNNEIKVIECNVRASRSFPFISKVIGVNLIE 1299

Query: 942  WMIR 945
               +
Sbjct: 1300 MATK 1303

 Score = 37.0 bits (84), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 52/258 (20%), Positives = 101/258 (39%), Gaps = 37/258 (14%)

Query: 783  YPVMVKSTAGGGGIGLQKVDSEEDIEHIFETVKHQGETFFGDAGVFLERFIENARHVEVQ 842
            +PV+V++    GG+G     +E+++  +          F     V +ER ++  + VE +
Sbjct: 609  FPVIVRAAYALGGLGSGFASNEQELVDLCNV------AFASSPQVLVERSMKGWKEVEYE 662

Query: 843  LMGDGFGKAIALGERDCSLQR------RNQKVIEETPAPNLPEKTRLALRKAAESLGSLL 896
            ++ D F   I +    C+++            I   P+  L ++    LR  A ++   L
Sbjct: 663  VVRDAFDNCITV----CNMENFDPLGIHTGDSIVVAPSQTLSDEDYNMLRTTAVNVIRHL 718

Query: 897  NYKCAGTVEFIYDEKKDEFYFLEVNTRLQVEHPITEMVTGLDLVEWMIRIAANDAPDFDS 956
                   +++  +    E+  +EVN RL     +    TG  L     ++  N       
Sbjct: 719  GVVGECNIQYALNPFSKEYCIIEVNARLSRSSALASKATGYPLAYTAAKLGLN------- 771

Query: 957  TKVEVNGVSMEARLYAENPLKNFRPSPGLLVDVKFPDWARVDTWVKKGTNISPEYDPTL- 1015
              + +N V        ++    F PS    V VK P W      +KK T +S     ++ 
Sbjct: 772  --IPLNEVKNSV---TQSTCACFEPSLDYCV-VKMPRWD-----LKKFTRVSTLLSSSMK 820

Query: 1016 --AKIIVHGKDRDDAISK 1031
               +++  G+  ++AI K
Sbjct: 821  SVGEVMSVGRTFEEAIQK 838

>KLLA0B08800g complement(772732..774444) similar to
           ca|CA4426|CaAMD21 Candida albicans amidase (by
           homology), start by similarity
          Length = 570

 Score = 48.9 bits (115), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 42/155 (27%), Positives = 67/155 (43%), Gaps = 13/155 (8%)

Query: 60  NLLHQFQILKSRENKETL------------PLYGVPIAVKDNIDVRGLPTTAACPSFA-Y 106
           N   QF I ++ +  E L            PL+GVP+++K+ +  +G  T A+  S+  +
Sbjct: 111 NFALQFLIPEALQQAEALDQYLKENGSPVGPLHGVPVSIKEQMCYKGKVTNASYVSYVDF 170

Query: 107 EPSKDSKVVELLRNAGAIIVGKTNLDQFATGLVGTRSPYGKTPCAFSKEHXXXXXXXXXX 166
            P + +  V++L   GA+   +T+  Q    L    +  G+T    S +           
Sbjct: 171 VPEQSAVSVDILIKLGAVCHVRTSQPQTIMHLDTWNNYIGRTRNPRSTKLSPGGSSGGES 230

Query: 167 XXXXRGIVPIALGTDTAGSGRVPAALNNLIGLKPT 201
                    I  G+D  GS R PAA  NL GL+PT
Sbjct: 231 ACVGMHGSVIGHGSDIGGSIRAPAAFANLFGLRPT 265

>Sklu_2331.1 YJL130C, Contig c2331 2029-8691
          Length = 2220

 Score = 48.1 bits (113), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 59/304 (19%), Positives = 129/304 (42%), Gaps = 21/304 (6%)

Query: 645  AVRIIKTLKKLGIRSVAVYSDPDKYSQHVTDADVSVPLHGTTAAQTYLDMNKIIDAAKQT 704
            AV  ++TL+   ++++ V  +P+  S   TD D +  L+  T     +++ +I+D  +  
Sbjct: 1002 AVTAVRTLRANNVKTIMVNYNPETVS---TDYDEADRLYFET-----INLERILDIYEAE 1053

Query: 705  NAQAIIPGYGFLSENADFSDACTSAGITFVGPSGDIIRGLGLKHSARQIAQKAGVPLVPG 764
             +  ++   G  + N + + +     +  +G S ++I     ++   ++  + GV   P 
Sbjct: 1054 ASAGVVISMGGQTSN-NIAMSLHREKVKILGTSPEMIDSAENRYKFSRMLDQIGVDQ-PA 1111

Query: 765  SLLITSXXXXXXXXXXLEYPVMVKSTAGGGGIGLQKVDSEEDIEHIFETVKHQGETFFGD 824
               +TS          + YPV+V+ +    G  +  V S++D+        +Q      D
Sbjct: 1112 WKELTSIDEAEGFAENVGYPVLVRPSYVLSGAAMNTVYSKDDLASYL----NQAVEVSRD 1167

Query: 825  AGVFLERFIENARHVEVQLM---GDGFGKAIALGERDCSLQRRNQKVIEETPAPNLPEKT 881
              V + ++IENA+ +E+  +   G+     ++    +  +   +  +I   P  +L  +T
Sbjct: 1168 YPVVITKYIENAKEIEMDAVAKDGELVMHVVSEHVENAGVHSGDATLI--VPPQDLDPET 1225

Query: 882  RLALRKAAESLGSLLNYKCAGTVEFIYDEKKDEFYFLEVNTRLQVEHPITEMVTGLDLVE 941
               +  A   +G  L       ++FI   K ++   +E N R     P    V G++L+E
Sbjct: 1226 VNRIVVATAKIGKALKITGPYNIQFI--AKNNDIKVIECNVRASRSFPFISKVVGVNLIE 1283

Query: 942  WMIR 945
               +
Sbjct: 1284 MATK 1287

 Score = 37.4 bits (85), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 53/264 (20%), Positives = 104/264 (39%), Gaps = 37/264 (14%)

Query: 783  YPVMVKSTAGGGGIGLQKVDSEEDIEHIFETVKHQGETFFGDAGVFLERFIENARHVEVQ 842
            +PV+V++    GG+G     +E ++  +          F     V +ER ++  + VE +
Sbjct: 593  FPVIVRAAYALGGLGSGFASNETELVDLCNV------AFASSPQVLVERSMKGWKEVEYE 646

Query: 843  LMGDGFGKAIALGERDCSLQR------RNQKVIEETPAPNLPEKTRLALRKAAESLGSLL 896
            ++ D F   I +    C+++            I   P+  L ++    LR  A ++   L
Sbjct: 647  VVRDAFDNCITV----CNMENFDPLGIHTGDSIVVAPSQTLSDEDYNMLRTTAVNVIRHL 702

Query: 897  NYKCAGTVEFIYDEKKDEFYFLEVNTRLQVEHPITEMVTGLDLVEWMIRIAANDAPDFDS 956
                   +++  +    E+  +EVN RL     +    TG  L     ++  N       
Sbjct: 703  GVVGECNIQYALNPFSKEYCIIEVNARLSRSSALASKATGYPLAFIAAKLGLN------- 755

Query: 957  TKVEVNGVSMEARLYAENPLKNFRPSPGLLVDVKFPDWARVDTWVKKGTNISPEYDPTL- 1015
              + +N V        ++    F PS    V VK P W      +KK T +S +   ++ 
Sbjct: 756  --IPLNEVKNSV---TKSTCACFEPSLDYCV-VKMPRWD-----LKKFTRVSTQLSSSMK 804

Query: 1016 --AKIIVHGKDRDDAISKLNQALE 1037
               +++  G+  ++AI K  ++ E
Sbjct: 805  SVGEVMSVGRTFEEAIQKAIRSTE 828

>Kwal_33.14061
          Length = 2221

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 59/304 (19%), Positives = 128/304 (42%), Gaps = 21/304 (6%)

Query: 645  AVRIIKTLKKLGIRSVAVYSDPDKYSQHVTDADVSVPLHGTTAAQTYLDMNKIIDAAKQT 704
            AV  ++TL+K  I+S+ V  +P+  S   TD D +  L+  T       + +I+D  +  
Sbjct: 1002 AVTAVRTLRKEKIKSIMVNYNPETVS---TDYDEADRLYFETIC-----LERILDIYEIE 1053

Query: 705  NAQAIIPGYGFLSENADFSDACTSAGITFVGPSGDIIRGLGLKHSARQIAQKAGVPLVPG 764
            ++  ++   G  + N + + +     +  +G + ++I     ++   ++  + GV   P 
Sbjct: 1054 SSAGVVVSMGGQTSN-NIAMSLHRENVKILGTTPEMIDSAENRYKFSRMLDQIGVDQ-PA 1111

Query: 765  SLLITSXXXXXXXXXXLEYPVMVKSTAGGGGIGLQKVDSEEDIEHIFETVKHQGETFFGD 824
               +TS          + +PV+V+ +    G  +  V S++D+        +Q      D
Sbjct: 1112 WKELTSIEEAEQFADAVSFPVLVRPSYVLSGAAMNTVYSKDDLASYL----NQAVEVSRD 1167

Query: 825  AGVFLERFIENARHVEVQLM---GDGFGKAIALGERDCSLQRRNQKVIEETPAPNLPEKT 881
              V + ++IENA+ +E+  +   G+     ++    +  +   +  +I   P  +L  +T
Sbjct: 1168 YPVVITKYIENAKEIEMDAVAKDGELVMHVVSEHVENAGVHSGDATLI--VPPQDLDPET 1225

Query: 882  RLALRKAAESLGSLLNYKCAGTVEFIYDEKKDEFYFLEVNTRLQVEHPITEMVTGLDLVE 941
               +  A   +G  L       ++FI   K ++   +E N R     P    V  ++L+E
Sbjct: 1226 VERIVVATAKIGKALKITGPFNIQFI--AKNNDIKVIECNVRASRSFPFISKVVNVNLIE 1283

Query: 942  WMIR 945
               +
Sbjct: 1284 MATK 1287

 Score = 35.0 bits (79), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 55/276 (19%), Positives = 108/276 (39%), Gaps = 37/276 (13%)

Query: 783  YPVMVKSTAGGGGIGLQKVDSEEDIEHIFETVKHQGETFFGDAGVFLERFIENARHVEVQ 842
            +PV+ ++    GG+G    ++E+      E V      F     V +ER ++  + VE +
Sbjct: 593  FPVICRAAYALGGLGSGFANNEK------ELVDLCNIAFASSPQVLVERSMKGWKEVEYE 646

Query: 843  LMGDGFGKAIALGERDCSLQR------RNQKVIEETPAPNLPEKTRLALRKAAESLGSLL 896
            ++ D F   I +    C+++            I   P+  L ++    LR  A ++   L
Sbjct: 647  VVRDAFDNCITV----CNMENFDPLGIHTGDSIVVAPSQTLSDEDYNMLRTTAVNVIRHL 702

Query: 897  NYKCAGTVEFIYDEKKDEFYFLEVNTRLQVEHPITEMVTGLDLVEWMIRIAANDAPDFDS 956
                   +++  +    E+  +EVN RL     +    TG  L     ++  N       
Sbjct: 703  GVVGECNIQYALNPFSKEYCIIEVNARLSRSSALASKATGYPLAYTAAKLGLN------- 755

Query: 957  TKVEVNGVSMEARLYAENPLKNFRPSPGLLVDVKFPDWARVDTWVKKGTNISPEYDPTL- 1015
              + +N V        ++    F PS    V VK P W      +KK + +S     ++ 
Sbjct: 756  --IPLNEVRNSV---TQSTCACFEPSLDYCV-VKMPRWD-----LKKFSRVSTALSSSMK 804

Query: 1016 --AKIIVHGKDRDDAISKLNQALEETKVYGCITNID 1049
               +++  G+  ++AI K  ++ E   +    T++D
Sbjct: 805  SVGEVMSIGRTFEEAIQKAIRSTEYVNLGFNETDLD 840

>Kwal_27.10438
          Length = 569

 Score = 45.1 bits (105), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 35/133 (26%), Positives = 62/133 (46%), Gaps = 2/133 (1%)

Query: 71  RENKETL-PLYGVPIAVKDNIDVRGLPTTAACPSFAYEPS-KDSKVVELLRNAGAIIVGK 128
           ++NK+ + PL+GV +++K+ ++ +G  TTA+  ++    + K+   + +LR  GA+   +
Sbjct: 135 KDNKKLIGPLHGVVVSLKEQMNYKGKVTTASYVAYLRNVTEKEGLSISILRKLGAVFHVR 194

Query: 129 TNLDQFATGLVGTRSPYGKTPCAFSKEHXXXXXXXXXXXXXXRGIVPIALGTDTAGSGRV 188
           T   Q    L    +  G+T    S                      I  G+D  GS R 
Sbjct: 195 TAQPQGIMHLDTWNNITGRTRNPLSTRLSPGGSSGGESAIVAMHGSVIGHGSDIGGSIRA 254

Query: 189 PAALNNLIGLKPT 201
           PAA  +L G++PT
Sbjct: 255 PAAFADLFGIRPT 267

>KLLA0D12628g 1071637..1073373 weakly similar to sp|P22580
           Saccharomyces cerevisiae YDR242w AMD2 amidase singleton,
           hypothetical start
          Length = 578

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 38/145 (26%), Positives = 63/145 (43%), Gaps = 15/145 (10%)

Query: 78  PLYGVPIAVKDNIDVRGLPTTAACPSFAYEPS-KDSKVVELLRNAGAIIVGKT------- 129
           P++G+PI++K+++  +G  T A+  S     + K +  V++    GA+   +T       
Sbjct: 143 PMHGIPISLKEHLSFKGEITHASYVSLLSSVTPKHALTVDIFDKQGALYHVRTAQPQTIM 202

Query: 130 NLDQFATGLVGTRSPYGKTPCAFSKEHXXXXXXXXXXXXXXRGIVPIALGTDTAGSGRVP 189
           +LD +      TR+P        +K                 G V I +GTD  GS R P
Sbjct: 203 HLDTWNIITGRTRNPRS------TKLSPGGSSGGESAAIGMHGSV-IGIGTDIGGSIRCP 255

Query: 190 AALNNLIGLKPTKGVFSCQGVVPAC 214
           AA   + G++PT    S   V P+ 
Sbjct: 256 AAFAGICGMRPTVKRVSLLDVTPSS 280

>Sklu_2413.4 YJR109C, Contig c2413 10886-14254
          Length = 1122

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 66/318 (20%), Positives = 129/318 (40%), Gaps = 27/318 (8%)

Query: 645 AVRIIKTLKKLGIRSVAVYSDPDKYSQHVTDADVSVPLHGTTAAQTYLDMNKIIDAAKQT 704
           AV   + L++ G +++ +  +P+  S   TD D    L+        L   +++D  +  
Sbjct: 604 AVNTARALREEGKKTIMINYNPETVS---TDFDEVDRLYFEE-----LSFERVMDIYELE 655

Query: 705 NAQA-IIPGYGFLSENADFSDACTSAGITFVGPSGDIIRGLGLKHSARQIAQKAGVPLVP 763
           N++  +I   G L +N          G   +G S + I     +H    I    GV   P
Sbjct: 656 NSEGCVISVGGQLPQNIALK--LFHEGAKILGTSPEDIDKAENRHKFSSILDSIGVDQ-P 712

Query: 764 GSLLITSXXXXXXXXXXLEYPVMVKSTAGGGGIGLQKVDSEEDIEHIFETVKHQGETFFG 823
               +TS          + YPV+++ +    G  +  V+SE+++E     VK    +   
Sbjct: 713 EWKELTSVNEAKIFASKVGYPVLIRPSYVLSGAAMSVVNSEDELE-----VKLTNASDVS 767

Query: 824 -DAGVFLERFIENARHVEVQLM---GDGFGKAIALGERDCSLQRRNQKVIEETPAPNLPE 879
            D  V + +FIE A+ ++V  +   G     AI+    +  +   +  +I   P  +L E
Sbjct: 768 PDHPVVISKFIEGAQEIDVDAVAYDGKVLVHAISEHVENAGVHSGDASLI--LPPQHLSE 825

Query: 880 KTRLALRKAAESLGSLLNYKCAGTVEFIYDEKKD--EFYFLEVNTRLQVEHPITEMVTGL 937
           +T+  L+  A+ +    N      ++ I D++        +E N R     P    V G+
Sbjct: 826 ETKQRLKDIADKVAKAWNICGPFNMQIIKDDRDHGTSLKVIECNIRASRSFPFVSKVLGI 885

Query: 938 DLVEWMIR--IAANDAPD 953
           + ++  ++  +  N  P+
Sbjct: 886 NFIDVAVKAFLGGNKVPE 903

 Score = 35.0 bits (79), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 34/173 (19%), Positives = 73/173 (42%), Gaps = 16/173 (9%)

Query: 781 LEYPVMVKSTAGGGGIGLQKVDSEEDIEHIFETVKHQGETFFGDAGVFLERFIENARHVE 840
           ++YPV+V+S    GG+G    + E++++ +        ++      + +E+ ++  + +E
Sbjct: 186 VKYPVIVRSAYALGGLGSGFANDEQEMKEL------ASQSLSLAPQILVEKSLKGWKEIE 239

Query: 841 VQLMGDGFGKAIALGERDCSLQRRNQKVIEE------TPAPNLPEKTRLALRKAAESLGS 894
            +++ D  G  I +    C+++  +   I         P+  L ++    LR AA  +  
Sbjct: 240 YEVVRDRVGNCITV----CNMENFDPLGIHTGDSIVFAPSQTLSDEEFHMLRSAAIKIIR 295

Query: 895 LLNYKCAGTVEFIYDEKKDEFYFLEVNTRLQVEHPITEMVTGLDLVEWMIRIA 947
            L       V++       ++  +EVN RL     +    TG  L     +IA
Sbjct: 296 HLGVVGECNVQYALQPDGLDYRVIEVNARLSRSSALASKATGYPLAYTAAKIA 348

>CAGL0C04917g 457506..460847 highly similar to sp|P03965
           Saccharomyces cerevisiae YJR109c CPA2, hypothetical
           start
          Length = 1113

 Score = 36.6 bits (83), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 35/181 (19%), Positives = 72/181 (39%), Gaps = 10/181 (5%)

Query: 768 ITSXXXXXXXXXXLEYPVMVKSTAGGGGIGLQKVDSEEDIEHIFETVKHQGETFFGDAGV 827
           +TS          + YPV+++ +    G  +  V++E ++E               D  V
Sbjct: 714 LTSVEEAKTFANKVSYPVLIRPSYVLSGAAMSVVNNEHELEDKLTLASDVSP----DHPV 769

Query: 828 FLERFIENARHVEVQLM---GDGFGKAIALGERDCSLQRRNQKVIEETPAPNLPEKTRLA 884
            + +FI+ A+ ++V  +   G+    AI+    D  +   +  +I   P  +L E  +  
Sbjct: 770 VMSKFIQGAQEIDVDAVACNGELLVHAISEHVEDAGVHSGDATLI--LPPQHLSENVKSQ 827

Query: 885 LRKAAESLGSLLNYKCAGTVEFIYDEKKDEFYFLEVNTRLQVEHPITEMVTGLDLVEWMI 944
           L+  A+ +    N      ++ I   + D    +E N R     P    V G++ +E  +
Sbjct: 828 LKTIAKKVAKAWNITGPFNMQVIKAGEND-LKVIECNIRASRSFPFVSKVLGVNFIEVAV 886

Query: 945 R 945
           +
Sbjct: 887 K 887

 Score = 31.6 bits (70), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 34/171 (19%), Positives = 68/171 (39%), Gaps = 16/171 (9%)

Query: 783 YPVMVKSTAGGGGIGLQKVDSEEDIEHIFETVKHQGETFFGDAGVFLERFIENARHVEVQ 842
           YPV+++S    GG+G    ++ E+++ +        ++      V +E+ +   + VE +
Sbjct: 184 YPVIIRSAYALGGLGSGFANNPEELKEL------ASQSLSLAPQVLVEKSLRGWKEVEYE 237

Query: 843 LMGDGFGKAIALGERDCSLQR------RNQKVIEETPAPNLPEKTRLALRKAAESLGSLL 896
           ++ D     I +    C+++            I   P+  L ++    LR AA  +   L
Sbjct: 238 VVRDRENNCITV----CNMENFDPLGVHTGDSIVFAPSQTLSDEEFHMLRSAAIKIIRHL 293

Query: 897 NYKCAGTVEFIYDEKKDEFYFLEVNTRLQVEHPITEMVTGLDLVEWMIRIA 947
                  V++       ++  +EVN RL     +    TG  L     +IA
Sbjct: 294 GVVGECNVQYALSPNSLDYRVIEVNARLSRSSALASKATGYPLAYTAAKIA 344

>ABR157W [750] [Homologous to ScYJR109C (CPA2) - SH]
           complement(695747..699088) [3342 bp, 1113 aa]
          Length = 1113

 Score = 36.6 bits (83), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 34/168 (20%), Positives = 71/168 (42%), Gaps = 11/168 (6%)

Query: 783 YPVMVKSTAGGGGIGLQKVDSEEDIEHIFETVKHQGETFFGDAGVFLERFIENARHVEVQ 842
           YPV+V+ +    G  +  V + ED+E +FE+          +  V + +FIE A+ +++ 
Sbjct: 724 YPVLVRPSYVLSGAAMSTVYNSEDLEGVFESAVAVSP----EHPVVISKFIEGAQELDID 779

Query: 843 LM---GDGFGKAIALGERDCSLQRRNQKVIEETPAPNLPEKTRLALRKAAESLGSLLNYK 899
            +   G     AI+    +  +   +  ++   P  +L E+ +  L++ A  + +  N  
Sbjct: 780 AVAYKGSLLVHAISEHVENAGVHSGDATLV--LPPQSLKEEEKTRLKQLAAQVAAAWNIT 837

Query: 900 CAGTVEFIYDEKKDE--FYFLEVNTRLQVEHPITEMVTGLDLVEWMIR 945
               ++ I   +        +E N R     P    V G++ VE  ++
Sbjct: 838 GPFNMQIIKTAEGGHTCLKIIECNIRASRSFPFVSKVLGVNFVEIAVK 885

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 36/171 (21%), Positives = 67/171 (39%), Gaps = 16/171 (9%)

Query: 783 YPVMVKSTAGGGGIGLQKVDSEEDIEHIFETVKHQGETFFGDAGVFLERFIENARHVEVQ 842
           YPV+V+S    GG+G    D +  +  +        ++      V +E+ ++  + +E +
Sbjct: 185 YPVIVRSAYALGGLGSGFADDDLQLRQLC------AQSLALSPQVLVEKSLKGWKEIEYE 238

Query: 843 LMGDGFGKAIALGERDCSLQRRNQKVIEE------TPAPNLPEKTRLALRKAAESLGSLL 896
           ++ D  G  I +    C+++  +   I         P+  L ++    LR AA  +   L
Sbjct: 239 VVRDRVGNCITV----CNMENFDPLGIHTGDSIVLAPSQTLSDEEFHMLRTAAIEIIRHL 294

Query: 897 NYKCAGTVEFIYDEKKDEFYFLEVNTRLQVEHPITEMVTGLDLVEWMIRIA 947
                  V++        F  +EVN RL     +    TG  L     +IA
Sbjct: 295 GVVGECNVQYALQPDGLAFKVIEVNARLSRSSALASKATGYPLAYTAAKIA 345

>YJR109C (CPA2) [3001] chr10 complement(629500..632856)
           Carbamoylphosphate synthetase of arginine biosynthetic
           pathway, synthetase (large) subunit [3357 bp, 1118 aa]
          Length = 1118

 Score = 36.2 bits (82), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 62/305 (20%), Positives = 119/305 (39%), Gaps = 22/305 (7%)

Query: 645 AVRIIKTLKKLGIRSVAVYSDPDKYSQHVTDADVSVPLHGTTAAQTYLDMNKIIDAAKQT 704
           AV   KTL+  G +++ +  +P+  S   TD D    L+        L   +++D  +  
Sbjct: 601 AVNTAKTLRDQGKKTIMINYNPETVS---TDFDEVDRLYFEE-----LSYERVMDIYELE 652

Query: 705 NAQA-IIPGYGFLSENADFSDACTSAGITFVGPSGDIIRGLGLKHSARQIAQKAGVPLVP 763
            ++  II   G L +N           I    P+ DI R    +H    I     V    
Sbjct: 653 QSEGCIISVGGQLPQNIALKLYDNGCNIMGTNPN-DIDRAEN-RHKFSSILDSIDVDQPE 710

Query: 764 GSLLITSXXXXXXXXXXLEYPVMVKSTAGGGGIGLQKVDSEEDIEHIFETVKHQGETFFG 823
            S L TS          + YPV+++ +    G  +  V++EE+++               
Sbjct: 711 WSEL-TSVEEAKLFASKVNYPVLIRPSYVLSGAAMSVVNNEEELKAKLTLASDVSP---- 765

Query: 824 DAGVFLERFIENARHVEVQLM---GDGFGKAIALGERDCSLQRRNQKVIEETPAPNLPEK 880
           D  V + +FIE A+ ++V  +   G+    AI+    +  +   +  ++   P  +L + 
Sbjct: 766 DHPVVMSKFIEGAQEIDVDAVAYNGNVLVHAISEHVENAGVHSGDASLV--LPPQHLSDD 823

Query: 881 TRLALRKAAESLGSLLNYKCAGTVEFIYDEKKDEFYFLEVNTRLQVEHPITEMVTGLDLV 940
            ++AL+  A+ +           ++ I D  +     +E N R     P    V G++ +
Sbjct: 824 VKIALKDIADKVAKAWKITGPFNMQIIKD-GEHTLKVIECNIRASRSFPFVSKVLGVNFI 882

Query: 941 EWMIR 945
           E  ++
Sbjct: 883 EIAVK 887

>Kwal_55.19783
          Length = 1121

 Score = 36.2 bits (82), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 65/316 (20%), Positives = 124/316 (39%), Gaps = 24/316 (7%)

Query: 645 AVRIIKTLKKLGIRSVAVYSDPDKYSQHVTDADVSVPLHGTTAAQTYLDMNKIIDAAKQT 704
           AV   + L++ G +++ +  +P+  S   TD D    L+        L   +++D  +  
Sbjct: 604 AVNTARALREKGKKTIMINYNPETVS---TDFDEVDRLYFEE-----LSFERVMDIYELE 655

Query: 705 NAQ-AIIPGYGFLSENADFSDACTSAGITFVGPSGDIIRGLGLKHSARQIAQKAGVPLVP 763
           +++ A+I   G L +N         A I    P  DI R    +H    I    GV    
Sbjct: 656 HSEGAVISVGGQLPQNIALKMLENGANILGTSPE-DIDRAEN-RHKFSSILDTIGVDQPE 713

Query: 764 GSLLITSXXXXXXXXXXLEYPVMVKSTAGGGGIGLQKVDSEEDIEHIFETVKHQGETFFG 823
            S L +S          + YPV+++ +    G  +  V+SE+++    ET          
Sbjct: 714 WSEL-SSVSEAKDFSKSVGYPVLIRPSYVLSGAAMSVVNSEDEL----ETKLTNASDVSP 768

Query: 824 DAGVFLERFIENARHVEVQLM---GDGFGKAIALGERDCSLQRRNQKVIEETPAPNLPEK 880
           D  V + +FIE A+ ++V  +   G+    AI+    +  +   +  +I   P  +L E 
Sbjct: 769 DHPVVISKFIEGAQEIDVDAVAYNGEVLVHAISEHVENAGVHSGDATLI--LPPQSLSES 826

Query: 881 TRLALRKAAESLGSLLNYKCAGTVEFIYDEKKD--EFYFLEVNTRLQVEHPITEMVTGLD 938
            +  L   A+ +           ++ I D++ +      +E N R     P    V G +
Sbjct: 827 IKERLYDIAKKVAHAWKITGPFNMQIIKDDRHEGTSLKVIECNIRASRSFPFVSKVLGCN 886

Query: 939 LVEWMIR-IAANDAPD 953
            ++  ++     D P+
Sbjct: 887 FIDVAVKAFIGEDVPE 902

 Score = 31.6 bits (70), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 34/171 (19%), Positives = 68/171 (39%), Gaps = 16/171 (9%)

Query: 783 YPVMVKSTAGGGGIGLQKVDSEEDIEHIFETVKHQGETFFGDAGVFLERFIENARHVEVQ 842
           YPV+V+S    GG+G    ++E +++ +        +       + +E+ ++  + VE +
Sbjct: 188 YPVIVRSAYALGGLGSGFAENEAEMKEL------AAQALSLSPQILVEKSLKGWKEVEYE 241

Query: 843 LMGDGFGKAIALGERDCSLQR------RNQKVIEETPAPNLPEKTRLALRKAAESLGSLL 896
           ++ D     I +    C+++            I   P+  L ++    LR AA  +   L
Sbjct: 242 VVRDRVDNCITV----CNMENFDPLGVHTGDSIVFAPSQTLSDEEFHMLRTAAIKIIRHL 297

Query: 897 NYKCAGTVEFIYDEKKDEFYFLEVNTRLQVEHPITEMVTGLDLVEWMIRIA 947
                  V++       ++  +EVN RL     +    TG  L     +IA
Sbjct: 298 GVVGECNVQYALQPDGLDYRVIEVNARLSRSSALASKATGYPLAYTAAKIA 348

>KLLA0F01837g complement(168045..170255) weakly similar to sp|P38148
            Saccharomyces cerevisiae YBR276c PPS1 protein tyrosine
            phosphatase singleton, start by similarity
          Length = 736

 Score = 35.8 bits (81), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 36/71 (50%)

Query: 1362 EAELWKVGQVKPGDSIQFVPLSYESSRSLKESQDVAIKSLDGTKLRRLDSVSILPSFETP 1421
            +AE+WK+G+    D+++     YE S S+  + D+   +L     +  D    +  FE  
Sbjct: 305  DAEIWKIGKFTENDTLETPTTYYEPSNSVVNATDLNDNALFNIPSKTNDWRLFINCFENA 364

Query: 1422 ILAQMEKVNEL 1432
             L  +EK++EL
Sbjct: 365  QLPSLEKISEL 375

>Scas_691.19
          Length = 1117

 Score = 34.7 bits (78), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 34/173 (19%), Positives = 71/173 (41%), Gaps = 16/173 (9%)

Query: 781 LEYPVMVKSTAGGGGIGLQKVDSEEDIEHIFETVKHQGETFFGDAGVFLERFIENARHVE 840
           ++YPV+++S    GG+G    +++++++ +                + +ER ++  + VE
Sbjct: 183 IKYPVIIRSAYALGGLGSGFANNDQELKQLSSQSLSLSPQ------ILVERSMKGWKEVE 236

Query: 841 VQLMGDGFGKAIALGERDCSLQR------RNQKVIEETPAPNLPEKTRLALRKAAESLGS 894
            +++ D  G  I +    C+++            I   P+  L ++    LR AA  +  
Sbjct: 237 YEVVRDRVGNCITV----CNMENFDPLGVHTGDSIVFAPSQTLSDEEYHMLRSAAIKIIR 292

Query: 895 LLNYKCAGTVEFIYDEKKDEFYFLEVNTRLQVEHPITEMVTGLDLVEWMIRIA 947
            L       V++       ++  +EVN RL     +    TG  L     +IA
Sbjct: 293 HLGVIGECNVQYALQPDGLDYCVIEVNARLSRSSALASKATGYPLAYTAAKIA 345

>ABR075C [666] [Homologous to ScYKL056C - SH] (527207..527635) [429
            bp, 142 aa]
          Length = 142

 Score = 32.3 bits (72), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 31/62 (50%), Gaps = 12/62 (19%)

Query: 1679 EEDLDKMTEDCDNGVYKVNIEKSVFDHQEYLRWINA------------NKDSITAFQEGQ 1726
            +ED+D  TE  +N V+   ++++ FD + +L +I              N D IT F++G 
Sbjct: 54   DEDVDDGTETVNNVVHSFRLQQTAFDKKSFLTYIKGYMKEIKNRLQETNPDEITIFEKGA 113

Query: 1727 LG 1728
             G
Sbjct: 114  QG 115

>Sklu_2439.12 YKL082C, Contig c2439 16281-17624 reverse complement
          Length = 447

 Score = 32.7 bits (73), Expect = 3.1,   Method: Composition-based stats.
 Identities = 20/63 (31%), Positives = 34/63 (53%), Gaps = 4/63 (6%)

Query: 1739 QNANSELKESVTVKPDEEEDFPEGAEIVYSEYSGRFWKSIASVGDVIEAGQGLLIIEAMK 1798
            +NA +E+ E V VK DE E+F   AE  +SE+  +  K ++      E  Q    +E ++
Sbjct: 134  KNAETEISEDVQVKEDENENFVAEAEEDHSEHKNKTKKELSDS----EKAQKQKNLEQLR 189

Query: 1799 AEM 1801
            A++
Sbjct: 190  AKL 192

>KLLA0F03190g complement(296883..300236) highly similar to sp|P03965
           Saccharomyces cerevisiae YJR109c CPA2 arginine-specific
           carbamoylphosphate synthase, large chain, start by
           similarity
          Length = 1117

 Score = 32.7 bits (73), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 33/171 (19%), Positives = 71/171 (41%), Gaps = 16/171 (9%)

Query: 783 YPVMVKSTAGGGGIGLQKVDSEEDIEHIFETVKHQGETFFGDAGVFLERFIENARHVEVQ 842
           +PV+V+S    GG+G    ++ ++++ +        ++      + +E+ ++  + VE +
Sbjct: 186 FPVIVRSAYALGGLGSGFANNAQEMKQL------ASQSLSLAPQILVEKSLKGWKEVEYE 239

Query: 843 LMGDGFGKAIALGERDCSLQRRNQKVIEE------TPAPNLPEKTRLALRKAAESLGSLL 896
           ++ D  G  I +    C+++  +   I         P+  L ++    LR AA  +   L
Sbjct: 240 VVRDRVGNCITV----CNMENFDPLGIHTGDSIVFAPSQTLSDEEFHMLRSAAIKIIRHL 295

Query: 897 NYKCAGTVEFIYDEKKDEFYFLEVNTRLQVEHPITEMVTGLDLVEWMIRIA 947
                  V++       ++  +EVN RL     +    TG  L     +IA
Sbjct: 296 GVIGECNVQYALSPDSLDYRVIEVNARLSRSSALASKATGYPLAYTAAKIA 346

>Scas_712.17
          Length = 793

 Score = 32.3 bits (72), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 30/121 (24%), Positives = 54/121 (44%), Gaps = 6/121 (4%)

Query: 730 GITFVGPSGDIIRGLGLKHSARQIAQKAGVPLVPGSLLITSXXXXXXXXXXLEYPVMVKS 789
           GI   GPS  + +  G K  +++   K G+P    +   T           ++Y V++K+
Sbjct: 95  GIPVFGPSAKVAQLEGSKVFSKRFMDKHGIPTAKYASF-TDFEKAKKYLAEVDYNVVLKA 153

Query: 790 TAGGGGIGLQKVDSEEDIEHIFETVKHQGETFFGDAG--VFLERFIENARHVEVQLMGDG 847
                G G+   DS+E      +T+  + +  FG AG  V +E F+E    + +  + DG
Sbjct: 154 DGIAAGKGVLIPDSKEQALKDLDTIMVERQ--FGSAGDSVVIEEFLE-GEEISILTISDG 210

Query: 848 F 848
           +
Sbjct: 211 Y 211

>KLLA0A02365g 211300..212568 similar to sgd|S0005681 Saccharomyces
           cerevisiae YOR155c, hypothetical start
          Length = 422

 Score = 32.0 bits (71), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 23/39 (58%), Gaps = 3/39 (7%)

Query: 638 IANRGEIAVRIIKTLKK---LGIRSVAVYSDPDKYSQHV 673
           I   G+I  RII  LK+   +G+ + A Y DPDKY + +
Sbjct: 158 IERGGKIVTRIITLLKRGINVGVVTAAGYDDPDKYKERL 196

>KLLA0F12452g complement(1152209..1156510) some similarities with
           sp|P53094 Saccharomyces cerevisiae YGL197w MDS3 negative
           regulator of early meiotic expression, hypothetical
           start
          Length = 1433

 Score = 32.0 bits (71), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 36/75 (48%), Gaps = 10/75 (13%)

Query: 283 FSNAVENLSRTGANVIEIDFEPLLELARCLYEGTWVAERYQAIQSF-----LDSKPPKES 337
           F++  E+L+    N  ++DFEPL  + R LY   W  E  +A   F     +D K P   
Sbjct: 930 FASNTESLTSQTLNSGDVDFEPLF-IPRSLY-MPWPTETVKAFAEFFFTGQIDGKWP--- 984

Query: 338 LDPTVISIIEGAKKY 352
           L P  + ++  AK Y
Sbjct: 985 LSPVAVGLLNMAKIY 999

>YHR014W (SPO13) [2300] chr8 (132039..132914) Meiosis-specific
           protein required for sister centromere cohesion during
           meiosis I chromosome division [876 bp, 291 aa]
          Length = 291

 Score = 30.8 bits (68), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 26/51 (50%), Gaps = 2/51 (3%)

Query: 55  LISKENLLHQFQILKSRENKETLPLYGVPIAVKDNIDVRGLPTTAACPSFA 105
           L  K  L HQ + L   +N + LP+Y  P+++ +N D  G  T  A P  +
Sbjct: 211 LFKKTRLPHQTKSLDKEKNYQYLPIY--PVSISNNGDFVGQETPRAAPKLS 259

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.136    0.403 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 59,429,481
Number of extensions: 2701658
Number of successful extensions: 6896
Number of sequences better than 10.0: 70
Number of HSP's gapped: 6903
Number of HSP's successfully gapped: 91
Length of query: 1802
Length of database: 16,596,109
Length adjustment: 116
Effective length of query: 1686
Effective length of database: 12,580,421
Effective search space: 21210589806
Effective search space used: 21210589806
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)