Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YBR105C (VID24)36235619190.0
CAGL0K12254g3352968001e-105
Sklu_2286.33383037352e-95
Kwal_27.126133112867002e-90
ADL330W2762836241e-79
Scas_718.43563425911e-73
KLLA0B09592g3333085622e-69
Scas_667.273322274045e-46
YGR066C2922353395e-37
Kwal_34.15922496239691.4
Scas_707.1278166682.1
KLLA0B02200g46659672.3
CAGL0D04312g96425654.1
Scas_721.79605135645.7
Kwal_56.2411346963645.9
CAGL0G03003g119141646.3
Scas_707.539459637.8
YGL092W (NUP145)131747629.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YBR105C
         (356 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YBR105C (VID24) [294] chr2 complement(450838..451926) Protein re...   743   0.0  
CAGL0K12254g complement(1196376..1197383) similar to sp|P38263 S...   312   e-105
Sklu_2286.3 YBR105C, Contig c2286 2431-3447 reverse complement        287   2e-95
Kwal_27.12613                                                         274   2e-90
ADL330W [1411] [Homologous to ScYBR105C (VID24) - SH] complement...   244   1e-79
Scas_718.4                                                            232   1e-73
KLLA0B09592g 834414..835415 weakly similar to sp|P38263 Saccharo...   221   2e-69
Scas_667.27                                                           160   5e-46
YGR066C (YGR066C) [2028] chr7 complement(620923..621801) Protein...   135   5e-37
Kwal_34.15922                                                          31   1.4  
Scas_707.12                                                            31   2.1  
KLLA0B02200g 196341..197741 similar to sp|Q01159 Saccharomyces c...    30   2.3  
CAGL0D04312g complement(422482..425376) similar to sp|P30771 Sac...    30   4.1  
Scas_721.79                                                            29   5.7  
Kwal_56.24113                                                          29   5.9  
CAGL0G03003g 276362..279937 highly similar to sp|P53254 Saccharo...    29   6.3  
Scas_707.5                                                             29   7.8  
YGL092W (NUP145) [1891] chr7 (337907..341860) Nuclear pore prote...    28   9.6  

>YBR105C (VID24) [294] chr2 complement(450838..451926) Protein
           required for vacuolar import and degradation of Fbp1p
           (fructose-1,6-bisphosphatase) [1089 bp, 362 aa]
          Length = 362

 Score =  743 bits (1919), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/356 (100%), Positives = 356/356 (100%)

Query: 1   MINNPKVDSVAEKPKAVTSKQSEQAASPEPTPAPPVSRNQYPITFNLTSTAPFHLHDRHR 60
           MINNPKVDSVAEKPKAVTSKQSEQAASPEPTPAPPVSRNQYPITFNLTSTAPFHLHDRHR
Sbjct: 1   MINNPKVDSVAEKPKAVTSKQSEQAASPEPTPAPPVSRNQYPITFNLTSTAPFHLHDRHR 60

Query: 61  YLQEQDLYKCASRDSLSSLQQLAHTPNGSTRKKYIVEDQSPYSSENPVIVTSSYNHTVCT 120
           YLQEQDLYKCASRDSLSSLQQLAHTPNGSTRKKYIVEDQSPYSSENPVIVTSSYNHTVCT
Sbjct: 61  YLQEQDLYKCASRDSLSSLQQLAHTPNGSTRKKYIVEDQSPYSSENPVIVTSSYNHTVCT 120

Query: 121 NYLRPRMQFTGYQISGYKRYQVTVNLKTVDLPKKDCTSLSPHLSGFLSIRGLTNQHPEIS 180
           NYLRPRMQFTGYQISGYKRYQVTVNLKTVDLPKKDCTSLSPHLSGFLSIRGLTNQHPEIS
Sbjct: 121 NYLRPRMQFTGYQISGYKRYQVTVNLKTVDLPKKDCTSLSPHLSGFLSIRGLTNQHPEIS 180

Query: 181 TYFEAYAVNHKELGFLSSSWKDEPVLNEFKATDQTDLEHWINFPSFRQLFLMSQKNGLNS 240
           TYFEAYAVNHKELGFLSSSWKDEPVLNEFKATDQTDLEHWINFPSFRQLFLMSQKNGLNS
Sbjct: 181 TYFEAYAVNHKELGFLSSSWKDEPVLNEFKATDQTDLEHWINFPSFRQLFLMSQKNGLNS 240

Query: 241 TDDNGTTNAAKKLPPQQLPTTPSADAGNISRIFSQEKQFDNYLNERFIFMKWKEKFLVPD 300
           TDDNGTTNAAKKLPPQQLPTTPSADAGNISRIFSQEKQFDNYLNERFIFMKWKEKFLVPD
Sbjct: 241 TDDNGTTNAAKKLPPQQLPTTPSADAGNISRIFSQEKQFDNYLNERFIFMKWKEKFLVPD 300

Query: 301 ALLMEGVDGASYDGFYYIVHDQVTGNIQGFYYHQDAEKFQQLELVPSLKNKVESSD 356
           ALLMEGVDGASYDGFYYIVHDQVTGNIQGFYYHQDAEKFQQLELVPSLKNKVESSD
Sbjct: 301 ALLMEGVDGASYDGFYYIVHDQVTGNIQGFYYHQDAEKFQQLELVPSLKNKVESSD 356

>CAGL0K12254g complement(1196376..1197383) similar to sp|P38263
           Saccharomyces cerevisiae YBR105c VID24 required for
           vacuolar import and degradation of FBP1P, hypothetical
           start
          Length = 335

 Score =  312 bits (800), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 158/296 (53%), Positives = 211/296 (71%), Gaps = 23/296 (7%)

Query: 65  QDLYKCASRDSLSSLQQLAHTPNGST-----RKKYIVEDQSPYSSEN-PVIVTSSYNHTV 118
           + LYKC S+DSL SLQ L    +  +     +KKYI+ D+S Y++ + P  VT ++ +T 
Sbjct: 38  EGLYKCHSKDSLPSLQHLIDRSSSESLPLKKKKKYIMNDRSSYTTVSVPRYVTPTHKNTT 97

Query: 119 CTNYLRPRMQFTGYQISGYKRYQVTVNLKTVDLPKKDC--TSLSPHLSGFLSIRGLTNQH 176
            TN+LRPR++F+GYQ+SGYKRYQV V+LKTVDLP  +   T+ +PH++G+L+I+GLT+QH
Sbjct: 98  QTNFLRPRLEFSGYQLSGYKRYQVNVSLKTVDLPTVESGNTTTTPHITGYLTIKGLTSQH 157

Query: 177 PEISTYFEAYAVNHKELGFLSSSWKDEPVLNEFKATDQTDLEHWINFPSFRQLFLMSQKN 236
           PEI+T+FEAYAV H ELGFLSS W +E     +K+ DQTDLEHW+NFP+FR+LF+    N
Sbjct: 158 PEITTFFEAYAVEHNELGFLSSQWPEENNYEPYKSDDQTDLEHWLNFPAFRELFIAQHAN 217

Query: 237 GLNSTDDNGTTNAAKKLPPQQLPTTPSADAGNISRIFSQ---EKQFDNYLNERFIFMKWK 293
            L   D+  T +  KK                ++ +F +   + +  NYLN+R+IFM+WK
Sbjct: 218 -LVKEDEEATPDFKKK----------RQSINTLAELFMENQAQNEGRNYLNDRYIFMRWK 266

Query: 294 EKFLVPDALLMEGVDGASYDGFYYIVHDQVTGNIQGFYYHQDAEKFQQLELVPSLK 349
           EKFLVPDA  +E VDGASYDGFYY+VHDQ+TG +QGFYYHQDAE+FQQLELVP  K
Sbjct: 267 EKFLVPDA-FVENVDGASYDGFYYVVHDQLTGCMQGFYYHQDAERFQQLELVPCKK 321

>Sklu_2286.3 YBR105C, Contig c2286 2431-3447 reverse complement
          Length = 338

 Score =  287 bits (735), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 156/303 (51%), Positives = 204/303 (67%), Gaps = 16/303 (5%)

Query: 63  QEQDLYKCASRDSLSSLQQLAHTPNGSTRKKYIVEDQSPYSSENPVIVTSSYNHTVCTNY 122
           +E+ LYKC+SRDSL+SL  L H  + ++ KKYI+ED S Y   N V   +  + T  TN+
Sbjct: 39  EEESLYKCSSRDSLASLNSLQHQDSIASPKKYILEDNSAY---NNVSNDTRVDATTRTNF 95

Query: 123 LRPRMQFTGYQISGYKRYQVTVNLKTVDLPKKDCTSLSPHLSGFLSIRGLTNQHPEISTY 182
           L+PRM+FTGYQ+SGYK+YQV V+L+TVDLP    T+ +PHL+GFL+IRGLTNQHPEI+T+
Sbjct: 96  LKPRMKFTGYQVSGYKKYQVIVDLQTVDLPTTPATTTTPHLTGFLTIRGLTNQHPEITTF 155

Query: 183 FEAYAVNHKELGFLSSSWKDEPVLNEFKATDQTDLEHWINFPSFRQLFLM-----SQKNG 237
           FE++ V    +GFLSS   +E  LN +K  D  DLEHW+NFP F++L +      ++ + 
Sbjct: 156 FESFTV-MDTIGFLSSCIPEE--LNAYKGNDHVDLEHWLNFPCFKELCMRRPASNNKHSS 212

Query: 238 LNSTDDNGTTNAAKKLP----PQQLPTTPSADAGNISRIFSQEKQFDNYLNERFIFMKWK 293
             S   NG  NA  K       Q       AD   + +I + +   +NYL  RFIFM+WK
Sbjct: 213 STSYACNGKPNAYHKYTNYANVQSNCVGGDADVNILHQILNGQYTHENYLCNRFIFMRWK 272

Query: 294 EKFLVPDALLMEGVDGASYDGFYYIVHDQVTGNIQGFYYHQDAEKFQQLELVPSLKNKVE 353
           EKFLVPDA + + V+GASYDG+YYIVHDQVTGNI GFYYH+DAEKFQQLEL P +     
Sbjct: 273 EKFLVPDAEI-DSVEGASYDGYYYIVHDQVTGNILGFYYHKDAEKFQQLELSPVMSGMES 331

Query: 354 SSD 356
           + D
Sbjct: 332 ACD 334

>Kwal_27.12613
          Length = 311

 Score =  274 bits (700), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 151/286 (52%), Positives = 192/286 (67%), Gaps = 36/286 (12%)

Query: 66  DLYKCASRDSLSSLQQLAHTPNG---STRKKYIVEDQSPYSSENPVIVTSSYN-HTVCTN 121
           +LY+C+S DS+ SL+    TP+G   +  +KYI ED+S Y S       +    HT CTN
Sbjct: 43  ELYRCSSVDSVDSLRH-TFTPSGVSSAATRKYIAEDRSRYESRARARRAARRAPHTCCTN 101

Query: 122 YLRPRMQFTGYQISGYKRYQVTVNLKTVDLPKKDCTS-LSPHLSGFLSIRGLTNQHPEIS 180
           +LRPRMQF+GYQIS YK+YQVTV+L+TV LP    +S ++PH++GFLSIRGLT+QHPEI+
Sbjct: 102 FLRPRMQFSGYQISDYKKYQVTVSLQTVALPDAPGSSAMAPHVTGFLSIRGLTSQHPEIT 161

Query: 181 TYFEAYAVNHKELGFLSSSWKDEPVLNEFKATDQTDLEHWINFPSFRQLFLMSQKNGLNS 240
           T+F+ YAV    LGFLSS+    P L+ FKATD+TDLEHW++FP F++L          S
Sbjct: 162 TFFDGYAVT-DNLGFLSSALP--PELDAFKATDKTDLEHWLSFPCFKELCRP------ES 212

Query: 241 TDDNGTTNAAKKLPPQQLPTTPSADAGNISRIFSQEKQFDNYLNERFIFMKWKEKFLVPD 300
             D GT      L             G+ S         ++YL  RFI+M+WKEKFLVPD
Sbjct: 213 ACDEGTNVLGAVL------------EGSYSH--------EDYLQNRFIYMRWKEKFLVPD 252

Query: 301 ALLMEGVDGASYDGFYYIVHDQVTGNIQGFYYHQDAEKFQQLELVP 346
           A + + V+GASYDG+YYIVHDQVTG+I GFYYHQDAEKFQQLEL P
Sbjct: 253 AEI-DSVEGASYDGYYYIVHDQVTGHILGFYYHQDAEKFQQLELTP 297

>ADL330W [1411] [Homologous to ScYBR105C (VID24) - SH]
           complement(121954..122784) [831 bp, 276 aa]
          Length = 276

 Score =  244 bits (624), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 135/283 (47%), Positives = 176/283 (62%), Gaps = 44/283 (15%)

Query: 67  LYKCASRDSLSSLQQLAHTPNGST--RKKYIVEDQSPYSSENPVIVTSSYNHTVCTNYLR 124
           L++C S +SL+S    A T  G +   +KY+                ++   T  TN+LR
Sbjct: 21  LFRCGSGESLAS-AWTADTSAGCSPCARKYMAGLGGGGGGGK-----AAPRATTTTNWLR 74

Query: 125 PRMQFTGYQISGYKRYQVTVNLKTVDLPKKDC-TSLSPHLSGFLSIRGLTNQHPEISTYF 183
           P M F GYQISGYK+YQV V L+TV LP K C T+ +PH++GFL+IRGLTNQHPEI+T+F
Sbjct: 75  PLMAFQGYQISGYKKYQVHVLLQTVALPTKGCATATTPHVTGFLTIRGLTNQHPEITTFF 134

Query: 184 EAYAVNHKELGFLSSSWKDEPVLNEFKATDQTDLEHWINFPSFRQLFLMSQKNGLNSTDD 243
           E++AVN   +GFLSSS    P L E+K++D+ DLEHW+NFPSF++L +            
Sbjct: 135 ESFAVN-DTVGFLSSSMP--PELAEYKSSDRVDLEHWLNFPSFKELCMAG---------- 181

Query: 244 NGTTNAAKKLPPQQLPTTPSADAGNISRIFSQEKQFDNYLNERFIFMKWKEKFLVPDALL 303
            GTT                     ++ I        +YL  RF+FM+WKEKFLVPD  +
Sbjct: 182 GGTT---------------------VADIMDGHYTHRDYLARRFVFMRWKEKFLVPDEEV 220

Query: 304 MEGVDGASYDGFYYIVHDQVTGNIQGFYYHQDAEKFQQLELVP 346
              V+GASYDG+YYIVHDQVTG++ GFYYH+DAEKFQQLEL P
Sbjct: 221 -GAVEGASYDGYYYIVHDQVTGSVLGFYYHKDAEKFQQLELTP 262

>Scas_718.4
          Length = 356

 Score =  232 bits (591), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 142/342 (41%), Positives = 199/342 (58%), Gaps = 61/342 (17%)

Query: 35  PVSRNQYP--ITFNLTSTAPFHLHDRHRYLQEQDLYKCASRDSLSSLQQLAHTPNGSTR- 91
           PV+R+  P  +  +L+      L +RH YL ++ +Y+C S DSL SL  LA + + + + 
Sbjct: 40  PVARSPSPQHLHIDLSKQRSSSLLNRHEYLSDE-IYRCESNDSLPSLHNLASSSSLTLKS 98

Query: 92  -------------KKYIVEDQSPYSSENPVIVTSSYNHTVCTNYLRPRMQFTGYQISGYK 138
                        KKYI  D S YS     I +++   T  TN+L P M+F G+Q+SGYK
Sbjct: 99  PSSSLSPSPSSSYKKYINNDNSSYSQSYNNIPSAT---TTNTNFLTPSMKFKGFQMSGYK 155

Query: 139 RYQVTVNLKTVDLPK--KDCTSLSPHLSGFLSIRGLTNQHPEISTYFEAYAVNHKELGFL 196
           +YQVTV +KTV+LP   ++  +  PH++G L+I+GLT Q+P+I+T+F+++AVN +   FL
Sbjct: 156 KYQVTVTIKTVNLPSSTQETITTQPHMTGSLTIKGLTFQYPQITTFFQSFAVN-ENFHFL 214

Query: 197 SSSW--KDEPVLNEFKATDQTDLEHWINFPSFRQLFLMSQKNGLNSTDDNGTTNAAKKLP 254
           SS W       L++ ++ D+ DLEHW+NFP F+QLF M+   G  + D            
Sbjct: 215 SSHWDANTRAQLHDLQSNDRIDLEHWLNFPIFKQLF-MADVEGEETQD------------ 261

Query: 255 PQQLPTTPSADAGNISRIFSQEKQFDNYLNERFIFMKWKEKFLVPDA-----LLMEGVDG 309
                            I S  KQ   YLN RFIFM+WKEKFL+ D         + ++G
Sbjct: 262 ---------------HEIDSYLKQ---YLNNRFIFMRWKEKFLIRDGEHIDDDDEDEING 303

Query: 310 ASYDGFYYIVHDQVTGNIQGFYYHQDAEKFQQLELVPSLKNK 351
           AS+DGFYYIVHDQV G+I GFYYH+DAEKFQQLELVP    +
Sbjct: 304 ASFDGFYYIVHDQVDGSIHGFYYHKDAEKFQQLELVPVFNER 345

>KLLA0B09592g 834414..835415 weakly similar to sp|P38263
           Saccharomyces cerevisiae YBR105c VID24 required for
           vacuolar import and degradation of FBP1P, hypothetical
           start
          Length = 333

 Score =  221 bits (562), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 133/308 (43%), Positives = 185/308 (60%), Gaps = 39/308 (12%)

Query: 42  PITFNLTSTAPFHLHDRHRYLQEQDLYKCASRDSLSSLQQLAHTPNGSTRKKYIVEDQ-S 100
           PI F    T  FH   R+ Y +   L++  S DS++S+++ +H  N    + Y ++D  S
Sbjct: 48  PIAFPAPLTPFFH---RNPYFRNTSLHRTGSHDSINSIRR-SHE-NFQDSEDYDIQDSCS 102

Query: 101 PYSSENPVIVTSSYNHTVCTNYLRPRMQFTGYQISGYKRYQVTVNLKTVDLPK-KDCTSL 159
           P  +  P     +  +   T++L  R +F GYQ+SGYK++QV + +++V LP   +    
Sbjct: 103 PSLNSPPRSRPQTPKNHERTHWLGARKRFVGYQLSGYKKFQVMITIQSVSLPNDNESNCC 162

Query: 160 SPHLSGFLSIRGLTNQHPEISTYFEAYAVNHKELGFLSSSWKDEPV-LNEFKATDQTDLE 218
           SPHL+GFLSI+GLT Q+PEI+T+FE+  V    LGFLS   KD P+    +KA+DQTDLE
Sbjct: 163 SPHLTGFLSIKGLTVQNPEITTFFESITVT-DSLGFLS---KDIPIDYASYKASDQTDLE 218

Query: 219 HWINFPSFRQLFLMSQKNGLNSTDDNGTTNAAKKLPPQQLPTTPSADAGNISRIFSQEKQ 278
           HW+NFPSF++L +                        Q  P  PS +   +  I      
Sbjct: 219 HWLNFPSFKELCM------------------------QNDPKYPSKNI--LQSIIDGTYS 252

Query: 279 FDNYLNERFIFMKWKEKFLVPDALLMEGVDGASYDGFYYIVHDQVTGNIQGFYYHQDAEK 338
             +YLN+RF++M+W EKFLVPDA L E +DGASYDG+YYIVHDQ+ GNI GFYYH+ AE+
Sbjct: 253 HTDYLNQRFLYMRWNEKFLVPDADL-ESIDGASYDGYYYIVHDQLLGNILGFYYHEHAER 311

Query: 339 FQQLELVP 346
           FQQLEL P
Sbjct: 312 FQQLELQP 319

>Scas_667.27
          Length = 332

 Score =  160 bits (404), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 83/227 (36%), Positives = 132/227 (58%), Gaps = 25/227 (11%)

Query: 120 TNYLRPRMQFTGYQISGYKRYQVTVNLKTVDLPKKDCTSLSPHLSGFLSIRGLTNQHPEI 179
           ++YL+P+ +F G Q+ G K Y + V+L+T++ P  +    +PHL+G L+I+G ++   ++
Sbjct: 116 SHYLKPKKRFHGVQVVGPKVYVIKVDLETINFPPFNYNIFNPHLTGRLNIQGFSDTGEDV 175

Query: 180 STYFEAYAVNHKELGFLSSSWKDEPVLNEFKATDQTDLEHWINFPSFRQLFLMSQKNGLN 239
           +TYFE Y++ + +LGFLSS+W+D P L +  A D  D+ HW+    FR++        LN
Sbjct: 176 TTYFEGYSIENDKLGFLSSNWEDHPCLEDLTADDIVDIFHWLKLKPFRRI--------LN 227

Query: 240 STDDNGTTNAAKKLPPQQLPTTPSADAGNISRIFSQEKQFDNYLNERFIFMKWKEKFLVP 299
               N   +        +LP     D  N       E ++ N  + R++FMKWKE+F++ 
Sbjct: 228 KKPVNKRWS--------KLPLRVLKDIVN-------ETEYQN--DGRYVFMKWKERFVID 270

Query: 300 DALLMEGVDGASYDGFYYIVHDQVTGNIQGFYYHQDAEKFQQLELVP 346
            A+  E V G +Y GFYYIVHD+ TG I+GFY+ +    FQ+L L P
Sbjct: 271 HAVDDEPVAGITYRGFYYIVHDKFTGEIEGFYHERGTAAFQRLSLQP 317

>YGR066C (YGR066C) [2028] chr7 complement(620923..621801) Protein of
           unknown function, has low similarity to a region of S.
           cerevisiae Vid24p, which is required for vacuolar import
           and degradation of fructose-1,6-bisphosphatase (S.
           cerevisiae Fbp1p) [879 bp, 292 aa]
          Length = 292

 Score =  135 bits (339), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 79/235 (33%), Positives = 124/235 (52%), Gaps = 42/235 (17%)

Query: 121 NYLRPRMQFTGYQISGYKRYQVTVNLKTVDLP-KKDCTSLSPHLSGFLSIRGLTNQHPEI 179
           ++LRP ++F G Q S Y  Y V V + TV+LP  KD  SL PH++G  +I+ LT    ++
Sbjct: 77  DFLRPGLRFGGSQSSKYTYYTVEVKIDTVNLPLYKDSRSLDPHVTGTFTIKNLTPVLDKV 136

Query: 180 STYFEAYAVNHKELGFLSSSWKDEPVLNEFKATDQTDLEHWINFPSFRQLFLMSQKNGLN 239
            T FE Y +N+ +    S  W  E  L+ + A  ++D  HW  F  F             
Sbjct: 137 VTLFEGYVINYNQFPLCSLHWPAEETLDPYMAQRESDCSHWKRFGHF------------- 183

Query: 240 STDDNGTTNAAKKLPPQQLPTTPSADAGNISRIFSQEKQFDNYLNERFIFMKWKEKFLVP 299
                G+ N              S    N  +   +  +F   +N+R+I++KWKE+FL+ 
Sbjct: 184 -----GSDNW-------------SLTERNFGQYNHESAEF---MNQRYIYLKWKERFLLD 222

Query: 300 DA----LLMEG---VDGASYDGFYYIVHDQVTGNIQGFYYHQDAEKFQQLELVPS 347
           D     L+++    ++GAS++GFYY+  DQ+TG+++G+YYH   E FQ+LELVP+
Sbjct: 223 DEEQENLMLDDNHHLEGASFEGFYYVCLDQLTGSVEGYYYHPACELFQKLELVPT 277

>Kwal_34.15922
          Length = 496

 Score = 31.2 bits (69), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 53/239 (22%), Positives = 100/239 (41%), Gaps = 32/239 (13%)

Query: 103 SSENPVIVTSSYNHTVCTNYLRPRMQFTGY-----QIS-GYKRYQVTVNLKTVDLPKKDC 156
           S ENP+ +T++Y ++           F GY     Q+S  YK Y     LK VD P+   
Sbjct: 33  SEENPIELTNAYQYSQVLQLEHAVTNFLGYFNKIIQLSPNYKVY-----LKNVDRPQSTS 87

Query: 157 TSLSPHLSGFLSIRGLTNQHPEISTYFE------AYAVNHKELGFLSSSWKDEPVLNEFK 210
             + P +     +R       E+++  E         +N  E  F +S     P+L + K
Sbjct: 88  VEILPAM-----LRHKLKCAAELASLNELGKLPLLKELNEYEAKFSTSD--RNPILKDLK 140

Query: 211 ATDQTDLEHWINFPSFRQLFLMSQKNGLNSTDDNGTTNAA--KKLPPQQLPTTPSADAGN 268
            +D   +   +N    RQ   +S++      +++G       KK PP +LP   ++    
Sbjct: 141 KSDLDKISASVNNEMVRQWNAVSRQAAEEDEEEDGYDPDEHKKKWPP-KLPEIKNSAIR- 198

Query: 269 ISRIFSQEKQFDN--YLNERFIFMKWKEKF-LVPDALLMEGVDGASYDGFYYIVHDQVT 324
            +R+F  +   ++  YL+E  +     E+   + D++L   +    Y+ F ++   Q++
Sbjct: 199 -ARVFIHKSMINDKLYLSEHDMIKAHNERLEFLGDSILNTTITMILYNQFPHLTEGQLS 256

>Scas_707.12
          Length = 781

 Score = 30.8 bits (68), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 33/66 (50%), Gaps = 11/66 (16%)

Query: 231 LMSQKNGLNSTDDNG---------TTNAAKKLPPQQLPTTPSADAGNISRIFSQEKQFDN 281
           L SQ+NGL+ +D+N          T++   KLP  ++P     D  NI  + S+E+    
Sbjct: 425 LQSQRNGLSKSDENKGSQQTSQPLTSHVYVKLPSSKIPDIVLEDVDNI--LSSKERNAKK 482

Query: 282 YLNERF 287
           ++ ER 
Sbjct: 483 FVQERM 488

>KLLA0B02200g 196341..197741 similar to sp|Q01159 Saccharomyces
           cerevisiae YGL130w CEG1 mRNA guanylyltransferase (mRNA
           capping enzyme, alpha subunit) singleton, start by
           similarity
          Length = 466

 Score = 30.4 bits (67), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 26/59 (44%)

Query: 44  TFNLTSTAPFHLHDRHRYLQEQDLYKCASRDSLSSLQQLAHTPNGSTRKKYIVEDQSPY 102
           TF  +    FHL D    L  QD Y C   D L +L  +   P    +  ++++ ++ Y
Sbjct: 39  TFPGSQPVSFHLADIEEKLLAQDYYVCEKTDGLRALMLIMVNPVTKEQGCFMIDRENNY 97

>CAGL0D04312g complement(422482..425376) similar to sp|P30771
           Saccharomyces cerevisiae YMR080c NAM7 nonsense-mediated
           mRNA decay protein, hypothetical start
          Length = 964

 Score = 29.6 bits (65), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 11/25 (44%), Positives = 16/25 (64%)

Query: 263 SADAGNISRIFSQEKQFDNYLNERF 287
              AGN S +FS + +F+NYLN  +
Sbjct: 887 GGQAGNFSNLFSNDSEFNNYLNNEY 911

>Scas_721.79
          Length = 605

 Score = 29.3 bits (64), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 33/135 (24%), Positives = 59/135 (43%), Gaps = 5/135 (3%)

Query: 20  KQSEQAASPEPTPAP-PVSRNQYPI-TFNLTSTAPFHLHDRHRYLQEQDLYKCASRDSLS 77
           ++S   +S EPT  P P+  N  P   FN + ++ F   +  R +  +D  +      L+
Sbjct: 246 ERSTTTSSLEPTETPMPLGTNNSPSPLFNGSVSSLFG--NVSRIVTPEDFAEMEKASKLT 303

Query: 78  SLQQLAHTPNGSTRKKYIVEDQSPYSSENPVIVTSSYNHTVCTNYLRPRMQFTGYQISGY 137
           S+Q L H+ NG+    +    +S  +  + +  T+  N     N   P + F    +S  
Sbjct: 304 SIQTLFHSLNGAGL-IFTPPKESIVTLFDKIDSTNKLNSKKAKNNNLPSISFLQDVVSNC 362

Query: 138 KRYQVTVNLKTVDLP 152
           K Y  T N+  ++ P
Sbjct: 363 KAYFATANVNILNTP 377

>Kwal_56.24113
          Length = 469

 Score = 29.3 bits (64), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 26/63 (41%)

Query: 44  TFNLTSTAPFHLHDRHRYLQEQDLYKCASRDSLSSLQQLAHTPNGSTRKKYIVEDQSPYS 103
           TF  +    FH  D    L  QD Y C   D L +L  +   P    +  +I++ ++ Y 
Sbjct: 38  TFPGSQPVSFHHSDIEEKLLAQDYYVCEKTDGLRALMLIVINPVTKEQGCFIIDRENNYY 97

Query: 104 SEN 106
             N
Sbjct: 98  QVN 100

>CAGL0G03003g 276362..279937 highly similar to sp|P53254
           Saccharomyces cerevisiae YGR090w, hypothetical start
          Length = 1191

 Score = 29.3 bits (64), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 13/41 (31%), Positives = 24/41 (58%)

Query: 240 STDDNGTTNAAKKLPPQQLPTTPSADAGNISRIFSQEKQFD 280
           + ++ GT +  K+LP   LP++ +    N+S  F+ +K FD
Sbjct: 651 NVNNEGTKHLHKQLPLPNLPSSSATSIQNLSSFFNLKKSFD 691

>Scas_707.5
          Length = 394

 Score = 28.9 bits (63), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 29/59 (49%), Gaps = 1/59 (1%)

Query: 159 LSPHLSGFLSIRGLTNQHPEISTYFEAYAVNHKELGFLSSSWKDEPVLNEFKATDQTDL 217
           LSPH+   LSI+ L++  PE  T ++    N + L F +   K  P++     T   DL
Sbjct: 31  LSPHVQSALSIQSLSHTSPEFVTIYQRVLQNTRRL-FKADVKKGLPIVLAGSGTLGFDL 88

>YGL092W (NUP145) [1891] chr7 (337907..341860) Nuclear pore protein
           (nucleoporin) required for nuclear envelope structure,
           contains GLFG repeat motifs [3954 bp, 1317 aa]
          Length = 1317

 Score = 28.5 bits (62), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 13/47 (27%), Positives = 25/47 (53%)

Query: 9   SVAEKPKAVTSKQSEQAASPEPTPAPPVSRNQYPITFNLTSTAPFHL 55
           +VA+ P+++TS  S+     +  P P  +R  Y  + +++  AP  L
Sbjct: 240 AVADMPRSITSSLSDVNGKSDAEPKPIENRRTYSFSSSVSGNAPLPL 286

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.314    0.130    0.383 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 12,923,376
Number of extensions: 587204
Number of successful extensions: 1839
Number of sequences better than 10.0: 46
Number of HSP's gapped: 1799
Number of HSP's successfully gapped: 50
Length of query: 356
Length of database: 16,596,109
Length adjustment: 103
Effective length of query: 253
Effective length of database: 13,030,455
Effective search space: 3296705115
Effective search space used: 3296705115
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 62 (28.5 bits)