Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YBR104W (YMC2)32932415790.0
Scas_667.2230632410551e-145
CAGL0K12210g31132410531e-144
CAGL0D01606g30532410291e-141
Scas_718.532433010161e-139
YPR058W (YMC1)3073269991e-136
Sklu_1926.23053249491e-129
Kwal_27.125993043249211e-124
KLLA0B08503g3033249031e-122
Kwal_33.129883033248361e-111
Sklu_2398.43093248221e-109
Sklu_1275.13113248091e-107
Kwal_56.230113033247941e-105
KLLA0F17864g3073257711e-102
KLLA0C13431g3283222951e-30
Kwal_23.29133203282914e-30
ADL264C3293412836e-29
Scas_697.473283042828e-29
KLLA0E09680g3072942765e-28
Kwal_33.154463052982722e-27
CAGL0B04543g3173332679e-27
YOR100C (CRC1)3273022626e-26
Kwal_55.213353172972512e-24
KLLA0E02772g2842992352e-22
Sklu_2127.52782912342e-22
Sklu_2075.33452952364e-22
YPL134C (ODC1)3102522283e-21
CAGL0B03883g3063182248e-21
YOR130C (ORT1)2923102176e-20
AGL311C3622502162e-19
YOR222W (ODC2)3072542082e-18
ACR109W2993072063e-18
Scas_632.92923162027e-18
Kwal_26.86692963022028e-18
CAGL0K10362g3013112011e-17
KLLA0D07073g2973012002e-17
KLLA0F03212g3052531983e-17
ADL049W9123512033e-17
CAGL0M09020g3482561985e-17
KLLA0E13453g9062492015e-17
Kwal_23.47313142401922e-16
YPR021C (AGC1)9022461953e-16
AFR146W2813041869e-16
CAGL0J02002g3612521872e-15
YJR095W (SFC1)3222551852e-15
Scas_640.253063091852e-15
Sklu_2334.23192501842e-15
Sklu_2037.23102471824e-15
CAGL0H10538g2971901807e-15
KLLA0C11363g5172561838e-15
Scas_709.93652521828e-15
YIL006W3732521801e-14
Scas_691.43343291791e-14
Kwal_47.173218812471803e-14
AER366W2932411736e-14
Scas_714.183053161737e-14
Scas_582.73291831702e-13
CAGL0G08910g2892341692e-13
CAGL0K02365g9192471722e-13
Sklu_2359.69022481723e-13
Kwal_47.182163332811667e-13
KLLA0E08877g2941851595e-12
Kwal_23.30425422561615e-12
Scas_602.88852471609e-12
YJL133W (MRS3)3142501561e-11
AER419W4932591581e-11
Kwal_55.208683802561562e-11
Scas_662.123082441533e-11
KLLA0E15532g3262481533e-11
Scas_721.273742651534e-11
YIL134W (FLX1)3112431524e-11
Kwal_23.39653071941515e-11
ADL009W3792541525e-11
CAGL0J04114g3032591508e-11
KLLA0D14036g4312671518e-11
ACR260W3112491508e-11
YEL006W3352531509e-11
YNL083W5452551511e-10
CAGL0J05522g5192531482e-10
Scas_578.3*5242561482e-10
CAGL0K08250g2972521444e-10
KLLA0F04697g3072421444e-10
Kwal_27.120813691991445e-10
Sklu_2363.23232381411e-09
Scas_379.23012471401e-09
Sklu_2431.53702661411e-09
Sklu_2115.42991861382e-09
Sklu_2374.75132521402e-09
Kwal_0.2322742431364e-09
Kwal_27.114192981871364e-09
CAGL0F04213g3061811365e-09
YKL120W (OAC1)3242451348e-09
CAGL0K11616g3202451349e-09
Kwal_33.140503142501331e-08
CAGL0M05225g3811811313e-08
AEL253W3652021303e-08
YBR291C (CTP1)2993121293e-08
Scas_589.103162541294e-08
Scas_721.1293232411294e-08
YPR011C3262401285e-08
Sklu_1149.22961871276e-08
KLLA0B12826g3192481268e-08
CAGL0H03839g2822121268e-08
AER184W3051791268e-08
YBR085W (AAC3)3071811269e-08
YKR052C (MRS4)3042471259e-08
CAGL0L05742g3051911251e-07
Scas_718.243371811251e-07
Kwal_26.79672971871232e-07
Scas_489.42971981222e-07
AGR383W2931821222e-07
Kwal_26.76533252481223e-07
YBL030C (PET9)3181811223e-07
Scas_667.43082551213e-07
AGL047C3161801213e-07
Scas_558.22892561213e-07
Sklu_2442.82751761213e-07
KLLA0D04290g1881871184e-07
Kwal_27.116262991511214e-07
CAGL0J01661g3271801214e-07
Kwal_14.22103151921205e-07
KLLA0E12353g3051581205e-07
Kwal_27.124813041811196e-07
Sklu_2117.22981511196e-07
YBR192W (RIM2)3771841197e-07
KLLA0D15015g3172001189e-07
Scas_562.123001521171e-06
AAL014C2711601171e-06
YMR166C3682931171e-06
Kwal_23.43543432211162e-06
KLLA0E18810g3771961162e-06
CAGL0G03135g3072001152e-06
CAGL0G01166g2952541142e-06
Scas_613.241771731113e-06
KLLA0E23705g3681991143e-06
Scas_669.63732721143e-06
YDL198C (YHM1)3001521134e-06
YNL003C (PET8)2841671124e-06
KLLA0F13464g3001511125e-06
Scas_328.12271491105e-06
Kwal_47.192282811441108e-06
CAGL0L02079g2971871109e-06
Sklu_2430.103242401091e-05
CAGL0J09790g3001521081e-05
YHR002W (LEU5)3572841082e-05
Scas_717.20356821082e-05
CAGL0K02915g3422671063e-05
Sklu_2432.52882911044e-05
Scas_716.293162011045e-05
AGL065C3351961037e-05
Sklu_2435.23442471028e-05
YMR056C (AAC1)3091871029e-05
AAR036W3172051002e-04
AFR131C3442681002e-04
KLLA0D04950g274243982e-04
Kwal_55.21106328253983e-04
Scas_702.10302250973e-04
YGR096W (TPC1)314143973e-04
Kwal_23.3529395259983e-04
Sklu_2433.8420126984e-04
Kwal_55.21338323244974e-04
Scas_715.45305193964e-04
YLR348C (DIC1)298244964e-04
AGR191W298151965e-04
Kwal_26.797235882930.001
CAGL0D04774g32285920.001
KLLA0D09889g364200920.002
YDL119C307202910.002
KLLA0A09383g366241900.003
CAGL0F08305g374205900.003
AFR253W344163890.004
AGL064W29680880.004
Scas_673.17314184880.004
KLLA0E02750g304305880.005
Scas_687.15*328126870.007
Scas_645.9391206870.008
CAGL0C02013g329120860.009
Scas_705.932372840.013
YJR077C (MIR1)311166840.016
AER450C30866830.019
Kwal_33.15597305167830.021
CAGL0F00231g307162830.021
KLLA0E18788g381199830.025
KLLA0B14454g30566810.034
KLLA0A00979g34377800.051
CAGL0F07711g368266790.059
KLLA0D04312g10387730.097
Sklu_1119.1307198770.097
AFL196W361159770.10
YGR257C (MTM1)366207760.17
Sklu_2127.4323152750.17
YPR128C (ANT1)32895750.18
YFR045W28576740.26
ABL023W309174710.60
YER053C30051710.63
KLLA0B11319g355155700.89
YEL032W (MCM3)97155701.0
ADR036C340181681.5
AFR147C315160662.5
CAGL0L01397g94555663.2
Scas_696.931233653.5
Sklu_2194.3312168653.6
AEL060C429117644.5
KLLA0F08547g308133619.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YBR104W
         (324 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YBR104W (YMC2) [293] chr2 (449624..450613) Member of the mitocho...   612   0.0  
Scas_667.22                                                           410   e-145
CAGL0K12210g 1193771..1194706 similar to sp|P38087 Saccharomyces...   410   e-144
CAGL0D01606g complement(169066..169983) highly similar to sp|P32...   400   e-141
Scas_718.5                                                            395   e-139
YPR058W (YMC1) [5488] chr16 (673746..674669) Member of the mitoc...   389   e-136
Sklu_1926.2 YPR058W, Contig c1926 347-1264 reverse complement         370   e-129
Kwal_27.12599                                                         359   e-124
KLLA0B08503g complement(753498..754409) similar to sp|P32331 Sac...   352   e-122
Kwal_33.12988                                                         326   e-111
Sklu_2398.4 , Contig c2398 9476-10405                                 321   e-109
Sklu_1275.1 , Contig c1275 314-1249                                   316   e-107
Kwal_56.23011                                                         310   e-105
KLLA0F17864g complement(1634241..1635164) similar to sp|P32331 S...   301   e-102
KLLA0C13431g 1145919..1146905 similar to sgd|S0005626 Saccharomy...   118   1e-30
Kwal_23.2913                                                          116   4e-30
ADL264C [1477] [Homologous to ScYOR100C (CRC1) - SH] (241532..24...   113   6e-29
Scas_697.47                                                           113   8e-29
KLLA0E09680g complement(860245..861168) similar to ca|CA5146|CaY...   110   5e-28
Kwal_33.15446                                                         109   2e-27
CAGL0B04543g 441599..442552 highly similar to tr|Q12289 Saccharo...   107   9e-27
YOR100C (CRC1) [4905] chr15 complement(513295..514278) Mitochond...   105   6e-26
Kwal_55.21335                                                         101   2e-24
KLLA0E02772g complement(261895..262749) similar to sp|Q12375 Sac...    95   2e-22
Sklu_2127.5 YOR130C, Contig c2127 7354-8190 reverse complement         95   2e-22
Sklu_2075.3 , Contig c2075 6414-7451 reverse complement                96   4e-22
YPL134C (ODC1) [5311] chr16 complement(298570..299502) 2-Oxodica...    92   3e-21
CAGL0B03883g 383602..384522 weakly similar to sp|P32331 Saccharo...    91   8e-21
YOR130C (ORT1) [4932] chr15 complement(569929..570807) Ornithine...    88   6e-20
AGL311C [4001] [Homologous to ScYJR095W (SFC1) - SH] (119645..12...    88   2e-19
YOR222W (ODC2) [5014] chr15 (758330..759253) 2-Oxodicarboxylate ...    85   2e-18
ACR109W [1156] [Homologous to ScYOR222W (ODC2) - SH; ScYPL134C (...    84   3e-18
Scas_632.9                                                             82   7e-18
Kwal_26.8669                                                           82   8e-18
CAGL0K10362g complement(1009155..1010060) similar to sp|Q12375 S...    82   1e-17
KLLA0D07073g 606857..607750 similar to sp|Q03028 Saccharomyces c...    82   2e-17
KLLA0F03212g 302915..303832 highly similar to sp|P33303 Saccharo...    81   3e-17
ADL049W [1692] [Homologous to ScYPR021C - SH] complement(598135....    83   3e-17
CAGL0M09020g complement(896312..897358) highly similar to sp|P33...    81   5e-17
KLLA0E13453g complement(1184806..1187526) similar to sgd|S000622...    82   5e-17
Kwal_23.4731                                                           79   2e-16
YPR021C (AGC1) [5455] chr16 complement(600644..603352) Member of...    80   3e-16
AFR146W [3338] [Homologous to ScYOR130C (ORT1) - SH] complement(...    76   9e-16
CAGL0J02002g 198226..199311 similar to sp|P40556 Saccharomyces c...    77   2e-15
YJR095W (SFC1) [2987] chr10 (609690..610658) Mitochondrial membr...    76   2e-15
Scas_640.25                                                            76   2e-15
Sklu_2334.2 YJR095W, Contig c2334 6303-7262 reverse complement         75   2e-15
Sklu_2037.2 YIL134W, Contig c2037 1645-2577 reverse complement         75   4e-15
CAGL0H10538g 1027739..1028632 highly similar to tr|Q07534 Saccha...    74   7e-15
KLLA0C11363g complement(975442..976995) similar to sp|P48233 Sac...    75   8e-15
Scas_709.9                                                             75   8e-15
YIL006W (YIL006W) [2659] chr9 (344059..345180) Member of the mit...    74   1e-14
Scas_691.4                                                             74   1e-14
Kwal_47.17321                                                          74   3e-14
AER366W [2867] [Homologous to ScYIL134W (FLX1) - SH] complement(...    71   6e-14
Scas_714.18                                                            71   7e-14
Scas_582.7                                                             70   2e-13
CAGL0G08910g complement(853693..854562) similar to sp|P40464 Sac...    70   2e-13
CAGL0K02365g 212702..215461 highly similar to tr|Q12482 Saccharo...    71   2e-13
Sklu_2359.6 YPR021C, Contig c2359 14617-17325                          71   3e-13
Kwal_47.18216                                                          69   7e-13
KLLA0E08877g complement(791157..792041) similar to sgd|S0002277 ...    66   5e-12
Kwal_23.3042                                                           67   5e-12
Scas_602.8                                                             66   9e-12
YJL133W (MRS3) [2785] chr10 (160537..161481) Member of the mitoc...    65   1e-11
AER419W [2919] [Homologous to ScYNL083W - SH] complement(1442595...    65   1e-11
Kwal_55.20868                                                          65   2e-11
Scas_662.12                                                            64   3e-11
KLLA0E15532g complement(1383230..1384210) similar to sp|P23500 S...    64   3e-11
Scas_721.27                                                            64   4e-11
YIL134W (FLX1) [2542] chr9 (97395..98330) Protein involved in tr...    63   4e-11
Kwal_23.3965                                                           63   5e-11
ADL009W [1733] [Homologous to ScYIL006W - SH; ScYEL006W - SH] co...    63   5e-11
CAGL0J04114g complement(384321..385232) similar to sp|Q99297 Sac...    62   8e-11
KLLA0D14036g complement(1203522..1204817) some similarities with...    63   8e-11
ACR260W [1307] [Homologous to ScYJL133W (MRS3) - SH; ScYKR052C (...    62   8e-11
YEL006W (YEL006W) [1417] chr5 (144326..145333) Member of the mit...    62   9e-11
YNL083W (YNL083W) [4507] chr14 (471377..473014) Member of the mi...    63   1e-10
CAGL0J05522g complement(524930..526489) highly similar to sp|P48...    62   2e-10
Scas_578.3*                                                            62   2e-10
CAGL0K08250g complement(820185..821078) highly similar to sp|P23...    60   4e-10
KLLA0F04697g complement(461126..462049) similar to sp|P40464 Sac...    60   4e-10
Kwal_27.12081                                                          60   5e-10
Sklu_2363.2 YPR011C, Contig c2363 11969-12940                          59   1e-09
Scas_379.2                                                             59   1e-09
Sklu_2431.5 YBR192W, Contig c2431 8526-9638                            59   1e-09
Sklu_2115.4 YDL119C, Contig c2115 2906-3805                            58   2e-09
Sklu_2374.7 YNL083W, Contig c2374 13874-15415 reverse complement       59   2e-09
Kwal_0.232                                                             57   4e-09
Kwal_27.11419                                                          57   4e-09
CAGL0F04213g 419473..420393 highly similar to sp|P18239 Saccharo...    57   5e-09
YKL120W (OAC1) [3145] chr11 (216990..217964) Mitochondrial oxalo...    56   8e-09
CAGL0K11616g complement(1121834..1122796) highly similar to sp|P...    56   9e-09
Kwal_33.14050                                                          56   1e-08
CAGL0M05225g 563163..564308 highly similar to sp|P38127 Saccharo...    55   3e-08
AEL253W [2253] [Homologous to ScYBR192W (RIM2) - SH] complement(...    55   3e-08
YBR291C (CTP1) [469] chr2 complement(783631..784530) Mitochondri...    54   3e-08
Scas_589.10                                                            54   4e-08
Scas_721.129                                                           54   4e-08
YPR011C (YPR011C) [5447] chr16 complement(583057..584037) Protei...    54   5e-08
Sklu_1149.2 YBR291C, Contig c1149 2019-2909 reverse complement         54   6e-08
KLLA0B12826g 1121106..1122065 similar to sp|P32332 Saccharomyces...    53   8e-08
CAGL0H03839g 359987..360835 highly similar to sp|P38921 Saccharo...    53   8e-08
AER184W [2686] [Homologous to ScYBL030C (PET9) - SH; ScYBR085W (...    53   8e-08
YBR085W (AAC3) [275] chr2 (415940..416863) ADP/ATP transporter p...    53   9e-08
YKR052C (MRS4) [3303] chr11 complement(532192..533106) Member of...    53   9e-08
CAGL0L05742g complement(630844..631761) similar to sp|P10566 Sac...    53   1e-07
Scas_718.24                                                            53   1e-07
Kwal_26.7967                                                           52   2e-07
Scas_489.4                                                             52   2e-07
AGR383W [4694] [Homologous to ScYDL119C - SH] complement(1436769...    52   2e-07
Kwal_26.7653                                                           52   3e-07
YBL030C (PET9) [164] chr2 complement(163006..163962) ADP/ATP car...    52   3e-07
Scas_667.4                                                             51   3e-07
AGL047C [4264] [Homologous to ScYPR011C - NSH] (616853..617803) ...    51   3e-07
Scas_558.2                                                             51   3e-07
Sklu_2442.8 YNL003C, Contig c2442 12309-13136                          51   3e-07
KLLA0D04290g 366536..367102 similar to sgd|S0006215 Saccharomyce...    50   4e-07
Kwal_27.11626                                                          51   4e-07
CAGL0J01661g 154646..155629 highly similar to tr|Q12251 Saccharo...    51   4e-07
Kwal_14.2210                                                           51   5e-07
KLLA0E12353g complement(1092303..1093220) gi|1351895|sp|P49382|A...    51   5e-07
Kwal_27.12481                                                          50   6e-07
Sklu_2117.2 YDL198C, Contig c2117 3737-4633                            50   6e-07
YBR192W (RIM2) [375] chr2 (607609..608742) Member of the mitocho...    50   7e-07
KLLA0D15015g 1267803..1268756 similar to sp|P53257 Saccharomyces...    50   9e-07
Scas_562.12                                                            50   1e-06
AAL014C [173] [Homologous to ScYNL003C (PET8) - SH] (317388..318...    50   1e-06
YMR166C (YMR166C) [4121] chr13 complement(593366..594472) Member...    50   1e-06
Kwal_23.4354                                                           49   2e-06
KLLA0E18810g 1663220..1664353 some similarities with sp|P38152 S...    49   2e-06
CAGL0G03135g 290834..291757 similar to sp|P53257 Saccharomyces c...    49   2e-06
CAGL0G01166g complement(111298..112185) highly similar to tr|Q06...    49   2e-06
Scas_613.24                                                            47   3e-06
KLLA0E23705g complement(2099965..2101071) highly similar to sp|P...    49   3e-06
Scas_669.6                                                             49   3e-06
YDL198C (GGC1) [676] chr4 complement(103650..104552) Member of t...    48   4e-06
YNL003C (PET8) [4582] chr14 complement(624974..625828) Protein o...    48   4e-06
KLLA0F13464g 1246646..1247548 highly similar to sp|P38988 Saccha...    48   5e-06
Scas_328.1                                                             47   5e-06
Kwal_47.19228                                                          47   8e-06
CAGL0L02079g 243467..244360 highly similar to sp|P38152 Saccharo...    47   9e-06
Sklu_2430.10 YKL120W, Contig c2430 18856-19830                         47   1e-05
CAGL0J09790g complement(957759..958661) highly similar to sp|P38...    46   1e-05
YHR002W (LEU5) [2287] chr8 (108806..109879) Protein with similar...    46   2e-05
Scas_717.20                                                            46   2e-05
CAGL0K02915g 259026..260054 highly similar to sp|P38702 Saccharo...    45   3e-05
Sklu_2432.5 YLR348C, Contig c2432 10310-11176 reverse complement       45   4e-05
Scas_716.29                                                            45   5e-05
AGL065C [4246] [Homologous to ScYHR002W (LEU5) - SH] (585963..58...    44   7e-05
Sklu_2435.2 YPR128C, Contig c2435 2489-3523 reverse complement         44   8e-05
YMR056C (AAC1) [4016] chr13 complement(387314..388243) ADP/ATP c...    44   9e-05
AAR036W [222] [Homologous to ScYGR096W - SH] complement(406887.....    43   2e-04
AFR131C [3323] [Homologous to ScYGR257C - SH] (672999..674033) [...    43   2e-04
KLLA0D04950g 424550..425374 similar to sp|P38921 Saccharomyces c...    42   2e-04
Kwal_55.21106                                                          42   3e-04
Scas_702.10                                                            42   3e-04
YGR096W (TPC1) [2056] chr7 (676623..677567) Mitochondrial thiami...    42   3e-04
Kwal_23.3529                                                           42   3e-04
Sklu_2433.8 YFR045W, Contig c2433 11995-13257 reverse complement       42   4e-04
Kwal_55.21338                                                          42   4e-04
Scas_715.45                                                            42   4e-04
YLR348C (DIC1) [3731] chr12 complement(826976..827872) Mitochond...    42   4e-04
AGR191W [4502] [Homologous to ScYDL198C (YHM1) - SH] complement(...    42   5e-04
Kwal_26.7972                                                           40   0.001
CAGL0D04774g complement(467712..468680) similar to tr|Q06497 Sac...    40   0.001
KLLA0D09889g complement(834904..835998) similar to sp|Q03829 Sac...    40   0.002
YDL119C (YDL119C) [751] chr4 complement(246689..247612) Member o...    40   0.002
KLLA0A09383g complement(818752..819852) similar to sp|P53320 Sac...    39   0.003
CAGL0F08305g complement(827705..828829) similar to sp|P53320 Sac...    39   0.003
AFR253W [3445] [Homologous to ScYFR045W - SH] complement(892939....    39   0.004
AGL064W [4247] [Homologous to ScYBR291C (CTP1) - SH] complement(...    39   0.004
Scas_673.17                                                            39   0.004
KLLA0E02750g 260854..261768 similar to ca|CA6127|IPF149 Candida ...    39   0.005
Scas_687.15*                                                           38   0.007
Scas_645.9                                                             38   0.008
CAGL0C02013g complement(209930..210919) weakly similar to sp|P38...    38   0.009
Scas_705.9                                                             37   0.013
YJR077C (MIR1) [2970] chr10 complement(577169..578104) Phosphate...    37   0.016
AER450C [2950] [Homologous to ScYJR077C (MIR1) - SH] (1500683..1...    37   0.019
Kwal_33.15597                                                          37   0.021
CAGL0F00231g 29705..30628 highly similar to sp|P23641 Saccharomy...    37   0.021
KLLA0E18788g complement(1661093..1662238) similar to sp|P38702 S...    37   0.025
KLLA0B14454g complement(1268709..1269626) highly similar to sp|P...    36   0.034
KLLA0A00979g complement(92561..93592) weakly similar to sp|P3815...    35   0.051
CAGL0F07711g complement(751794..752900) similar to sp|Q03829 Sac...    35   0.059
KLLA0D04312g 367160..367471 highly similar to sgd|S0006215 Sacch...    33   0.097
Sklu_1119.1 YJR077C, Contig c1119 366-1289                             34   0.097
AFL196W [2999] [Homologous to ScYMR166C - SH] complement(66955.....    34   0.10 
YGR257C (MTM1) [2204] chr7 complement(1006210..1007310) Member o...    34   0.17 
Sklu_2127.4 , Contig c2127 6322-7293                                   33   0.17 
YPR128C (ANT1) [5547] chr16 complement(791212..792198) Peroxisom...    33   0.18 
YFR045W (YFR045W) [1727] chr6 (242129..242986) Member of the mit...    33   0.26 
ABL023W [569] [Homologous to ScYKL120W (OAC1) - SH] complement(3...    32   0.60 
YER053C (PIC2) [1481] chr5 complement(258736..259638) Member of ...    32   0.63 
KLLA0B11319g 988293..989360 similar to sgd|S0006332 Saccharomyce...    32   0.89 
YEL032W (MCM3) [1393] chr5 (86937..89852) Member of the MCM/P1 f...    32   1.0  
ADR036C [1777] [Homologous to ScYPR128C (ANT1) - SH] (771097..77...    31   1.5  
AFR147C [3339] [Homologous to NOHBY] (703270..704217) [948 bp, 3...    30   2.5  
CAGL0L01397g 152718..155555 highly similar to sp|P24279 Saccharo...    30   3.2  
Scas_696.9                                                             30   3.5  
Sklu_2194.3 YMR241W, Contig c2194 5245-6183                            30   3.6  
AEL060C [2446] [Homologous to NOHBY] (525069..526358) [1290 bp, ...    29   4.5  
KLLA0F08547g 796328..797254 similar to sp|Q04013 Saccharomyces c...    28   9.7  

>YBR104W (YMC2) [293] chr2 (449624..450613) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [990 bp, 329 aa]
          Length = 329

 Score =  612 bits (1579), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/324 (92%), Positives = 301/324 (92%)

Query: 1   MSEEFPTPQLLDELEDQQKVTTPNEKRELSSNRVLKDIFAGTIGGIAQVLVGQPFDXXXX 60
           MSEEFPTPQLLDELEDQQKVTTPNEKRELSSNRVLKDIFAGTIGGIAQVLVGQPFD    
Sbjct: 1   MSEEFPTPQLLDELEDQQKVTTPNEKRELSSNRVLKDIFAGTIGGIAQVLVGQPFDTTKV 60

Query: 61  XXXXXXXXXXXXXXXXXXXKNEGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYN 120
                              KNEGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYN
Sbjct: 61  RLQTATTRTTTLEVLRNLVKNEGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYN 120

Query: 121 ASKNPNMSSQDVDLSRSNTLPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDR 180
           ASKNPNMSSQDVDLSRSNTLPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDR
Sbjct: 121 ASKNPNMSSQDVDLSRSNTLPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDR 180

Query: 181 EFKGPWDCIKKLKAQGGLMRGLFPTMIRAGHGLGTYFLVYEALVAREIGTGLTRNEIPPW 240
           EFKGPWDCIKKLKAQGGLMRGLFPTMIRAGHGLGTYFLVYEALVAREIGTGLTRNEIPPW
Sbjct: 181 EFKGPWDCIKKLKAQGGLMRGLFPTMIRAGHGLGTYFLVYEALVAREIGTGLTRNEIPPW 240

Query: 241 KLCLFGAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKG 300
           KLCLFGAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKG
Sbjct: 241 KLCLFGAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKG 300

Query: 301 FGPTMVRSAPVNGATFLTFELVMR 324
           FGPTMVRSAPVNGATFLTFELVMR
Sbjct: 301 FGPTMVRSAPVNGATFLTFELVMR 324

>Scas_667.22
          Length = 306

 Score =  410 bits (1055), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 203/324 (62%), Positives = 234/324 (72%), Gaps = 21/324 (6%)

Query: 1   MSEEFPTPQLLDELEDQQKVTTPNEKRELSSNRVLKDIFAGTIGGIAQVLVGQPFDXXXX 60
           MSEEFPTPQL+D+LE+  K           + RV+KD+ AGT GGIAQVLVGQPFD    
Sbjct: 1   MSEEFPTPQLIDDLENHPK---------HDNARVIKDLLAGTAGGIAQVLVGQPFDTTKV 51

Query: 61  XXXXXXXXXXXXXXXXXXXKNEGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYN 120
                              KNEG   FYKG LTPL+GVG CVS+QFGVNEAMKRFF    
Sbjct: 52  RLQTSSTPTTAMEVIRKLLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFH--- 108

Query: 121 ASKNPNMSSQDVDLSRSNTLPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDR 180
            S+NP+ +SQ         L L QYY+CGLTGG+ NSFLASPIE +RIRLQTQT +G + 
Sbjct: 109 -SRNPDSTSQ--------ILSLPQYYICGLTGGITNSFLASPIEHVRIRLQTQTGSGPNV 159

Query: 181 EFKGPWDCIKKLKAQGGLMRGLFPTMIRAGHGLGTYFLVYEALVAREIGTGLTRNEIPPW 240
           EFKGP DCI+KL+AQGG MRGL PTM+R GHG GTYFLVYEA+VA EI  G  R E+P W
Sbjct: 160 EFKGPLDCIRKLRAQGGFMRGLTPTMLREGHGCGTYFLVYEAMVANEINKGFKRTEVPAW 219

Query: 241 KLCLFGAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKG 300
           KLCLFGA SGT LW+ VYPLDV+KS++Q D+L+ PKY NSIS VAKT+YAK G+ AFFKG
Sbjct: 220 KLCLFGALSGTTLWMMVYPLDVIKSVMQTDNLKSPKYGNSISSVAKTLYAKGGLGAFFKG 279

Query: 301 FGPTMVRSAPVNGATFLTFELVMR 324
           FGPTM+R+AP NGATF TFEL MR
Sbjct: 280 FGPTMLRAAPANGATFATFELAMR 303

>CAGL0K12210g 1193771..1194706 similar to sp|P38087 Saccharomyces
           cerevisiae YBR104w YMC2 or sp|P32331 Saccharomyces
           cerevisiae YPR058w YMC1, start by similarity
          Length = 311

 Score =  410 bits (1053), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 202/324 (62%), Positives = 231/324 (71%), Gaps = 16/324 (4%)

Query: 1   MSEEFPTPQLLDELEDQQKVTTPNEKRELSSNRVLKDIFAGTIGGIAQVLVGQPFDXXXX 60
           MSEEFPTPQLL+ELED   V  P         RV+KDIFAGT+GG+AQVLVGQPFD    
Sbjct: 1   MSEEFPTPQLLNELED---VPPPT-----PYGRVVKDIFAGTMGGVAQVLVGQPFDTTKV 52

Query: 61  XXXXXXXXXXXXXXXXXXXKNEGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYN 120
                              +NEG  AFYKG LTPLLGVGICVSVQFGVNE+MKRFF  YN
Sbjct: 53  RLQTSKTKIGVIEVVQNLLRNEGALAFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYN 112

Query: 121 ASKNPNMSSQDVDLSRSNTLPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDR 180
           A +        VD  +   LPL QYY+CGLTGGVVNSFLA+PIE +RIRLQTQTS G +R
Sbjct: 113 ADR--------VDPQKHVPLPLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNER 164

Query: 181 EFKGPWDCIKKLKAQGGLMRGLFPTMIRAGHGLGTYFLVYEALVAREIGTGLTRNEIPPW 240
           +FKGP+DCIKKL     LMRGL PTMIRAGHGLGTYF  YEALV +E   G  RN+IP W
Sbjct: 165 QFKGPFDCIKKLAKAKALMRGLLPTMIRAGHGLGTYFAAYEALVVKEFEKGTPRNQIPAW 224

Query: 241 KLCLFGAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKG 300
           KLC FGA SGT+LWLTVYP+DVVKS++Q D +  PKYKNSI    + +Y + GI AFFKG
Sbjct: 225 KLCSFGALSGTILWLTVYPVDVVKSVLQTDSIENPKYKNSIIKATRALYKQHGIPAFFKG 284

Query: 301 FGPTMVRSAPVNGATFLTFELVMR 324
           F PTM+R+AP N ATF++FE+ MR
Sbjct: 285 FVPTMIRAAPANAATFVSFEMTMR 308

>CAGL0D01606g complement(169066..169983) highly similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 or sp|P38087
           Saccharomyces cerevisiae YBR104w YMC2, start by
           similarity
          Length = 305

 Score =  400 bits (1029), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 196/324 (60%), Positives = 230/324 (70%), Gaps = 22/324 (6%)

Query: 1   MSEEFPTPQLLDELEDQQKVTTPNEKRELSSNRVLKDIFAGTIGGIAQVLVGQPFDXXXX 60
           MSEEFPTPQL+D+LED      P +     + RV+KD+ AGT GGIAQVL+GQPFD    
Sbjct: 1   MSEEFPTPQLIDDLEDH-----PGQ----DNGRVVKDLLAGTAGGIAQVLIGQPFDTTKV 51

Query: 61  XXXXXXXXXXXXXXXXXXXKNEGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYN 120
                              KNEG   FYKG LTPL+GVG CVS+QFGVNEAMKRFF   N
Sbjct: 52  RLQTSKVPTSAAEVVKNLLKNEGPKGFYKGTLTPLVGVGACVSIQFGVNEAMKRFFHARN 111

Query: 121 ASKNPNMSSQDVDLSRSNTLPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDR 180
              N              TL LSQYY+CGLTGG+ NSFLASPIE +RIRLQTQT +G   
Sbjct: 112 VDHNA-------------TLSLSQYYLCGLTGGMTNSFLASPIEHVRIRLQTQTGSGAQA 158

Query: 181 EFKGPWDCIKKLKAQGGLMRGLFPTMIRAGHGLGTYFLVYEALVAREIGTGLTRNEIPPW 240
           EFKGP DCIKKL++Q GLMRGL PTM+R GHG GTYFLVYEALV+++I  GL R EIPPW
Sbjct: 159 EFKGPIDCIKKLRSQKGLMRGLIPTMLREGHGCGTYFLVYEALVSKQINQGLKRTEIPPW 218

Query: 241 KLCLFGAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKG 300
           KLCL+GA SGT LWL VYP+DVVKS++Q D+L KP+   ++  VA+ +YA+EG++AFFKG
Sbjct: 219 KLCLYGALSGTALWLMVYPIDVVKSVMQTDNLNKPQNGKNMIQVARNLYAREGLKAFFKG 278

Query: 301 FGPTMVRSAPVNGATFLTFELVMR 324
           FGPTM+R+AP NG TF TFEL MR
Sbjct: 279 FGPTMLRAAPANGGTFATFELAMR 302

>Scas_718.5
          Length = 324

 Score =  395 bits (1016), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 194/330 (58%), Positives = 233/330 (70%), Gaps = 15/330 (4%)

Query: 1   MSEEFPTPQLLDELEDQQKVTTPNEKRELS------SNRVLKDIFAGTIGGIAQVLVGQP 54
           MSE+F +PQL++E +D+   +  N+    S      S RVLKDI AGT GGI+QV+VGQP
Sbjct: 1   MSEDFSSPQLINEFDDEM-ASNGNDNNGSSHSMAKDSTRVLKDILAGTCGGISQVIVGQP 59

Query: 55  FDXXXXXXXXXXXXXXXXXXXXXXXKNEGVFAFYKGALTPLLGVGICVSVQFGVNEAMKR 114
           FD                       KNEGV+AFYKG+L P++GVG CVSVQFGVNEAMKR
Sbjct: 60  FDTTKVRMQTSAKSVGALDIIRKLVKNEGVWAFYKGSLIPIVGVGACVSVQFGVNEAMKR 119

Query: 115 FFQNYNASKNPNMSSQDVDLSRSNTLPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQT 174
           FF+ +N S+            R  TL L QYY+CGLTGGVVNSFLASPIE +RIRLQTQT
Sbjct: 120 FFREWNTSRGTQ--------HRDGTLQLGQYYICGLTGGVVNSFLASPIEHVRIRLQTQT 171

Query: 175 SNGGDREFKGPWDCIKKLKAQGGLMRGLFPTMIRAGHGLGTYFLVYEALVAREIGTGLTR 234
            NG +REFKGP DCI+KL  +  LMRGL P M+RAGHGLG YFL YEAL+A EI  G  R
Sbjct: 172 GNGNEREFKGPLDCIRKLVKEKSLMRGLRPMMLRAGHGLGCYFLTYEALIANEIKKGKDR 231

Query: 235 NEIPPWKLCLFGAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGI 294
           +EI  WKLC +G+ SG +LWL +YPLDVVKS+IQ D LR P++KNS+  V   +Y ++GI
Sbjct: 232 SEIASWKLCSYGSLSGVVLWLAIYPLDVVKSMIQTDTLRNPRFKNSMKNVINHLYREQGI 291

Query: 295 RAFFKGFGPTMVRSAPVNGATFLTFELVMR 324
            AFFKGF PTM+R+APVNGATF+TFELVMR
Sbjct: 292 SAFFKGFAPTMLRAAPVNGATFVTFELVMR 321

>YPR058W (YMC1) [5488] chr16 (673746..674669) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [924 bp, 307 aa]
          Length = 307

 Score =  389 bits (999), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 196/326 (60%), Positives = 231/326 (70%), Gaps = 24/326 (7%)

Query: 1   MSEEFPTPQLLDELEDQQKVTTPNEKRELSSNRVLKDIFAGTIGGIAQVLVGQPFDXXXX 60
           MSEEFP+PQL+D+LE         E  +  + RV+KD+ AGT GGIAQVLVGQPFD    
Sbjct: 1   MSEEFPSPQLIDDLE---------EHPQHDNARVVKDLLAGTAGGIAQVLVGQPFDTTKV 51

Query: 61  XXXXXXXXXXXXXXXXXXXKNEGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYN 120
                               NEG   FYKG LTPL+GVG CVS+QFGVNEAMKRFF + N
Sbjct: 52  RLQTSSTPTTAMEVVRKLLANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHHRN 111

Query: 121 ASKNPNMSSQDVDLSRSNTLPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDR 180
           A    +MSS         TL L QYY CG+TGG+VNSFLASPIE +RIRLQTQT +G + 
Sbjct: 112 A----DMSS---------TLSLPQYYACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNA 158

Query: 181 EFKGPWDCIKKLKAQGGLMRGLFPTMIRAGHGLGTYFLVYEALVAREIGT--GLTRNEIP 238
           EFKGP +CIKKL+    L+RGL PT++R GHG GTYFLVYEAL+A ++    GL R +IP
Sbjct: 159 EFKGPLECIKKLRHNKALLRGLTPTILREGHGCGTYFLVYEALIANQMNKRRGLERKDIP 218

Query: 239 PWKLCLFGAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFF 298
            WKLC+FGA SGT LWL VYPLDV+KS++Q D+L+KPK+ NSIS VAKT+YA  GI AFF
Sbjct: 219 AWKLCIFGALSGTALWLMVYPLDVIKSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFF 278

Query: 299 KGFGPTMVRSAPVNGATFLTFELVMR 324
           KGFGPTM+R+AP NGATF TFEL MR
Sbjct: 279 KGFGPTMLRAAPANGATFATFELAMR 304

>Sklu_1926.2 YPR058W, Contig c1926 347-1264 reverse complement
          Length = 305

 Score =  370 bits (949), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 180/324 (55%), Positives = 213/324 (65%), Gaps = 22/324 (6%)

Query: 1   MSEEFPTPQLLDELEDQQKVTTPNEKRELSSNRVLKDIFAGTIGGIAQVLVGQPFDXXXX 60
           M+EE PTP ++D+L+               S RV KD+ AGT GG++QVL+GQPFD    
Sbjct: 1   MTEELPTPLIIDDLDGAH-----------DSTRVFKDLLAGTAGGVSQVLIGQPFDTTKV 49

Query: 61  XXXXXXXXXXXXXXXXXXXKNEGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYN 120
                              KNEG   FYKG LTPL+GVG CVSVQFGVNEAMKRFF + N
Sbjct: 50  RLQTSSVPTTALDVVKKLVKNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRN 109

Query: 121 ASKNPNMSSQDVDLSRSNTLPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDR 180
            +  PN            TL L QYY+CG  GG  NSFLASPIE +RIRLQTQT  G   
Sbjct: 110 GNSGPN-----------ETLGLLQYYLCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAA 158

Query: 181 EFKGPWDCIKKLKAQGGLMRGLFPTMIRAGHGLGTYFLVYEALVAREIGTGLTRNEIPPW 240
           +F GP DCIKKL A   LMRGL PTM+R  HG G YFL YEAL+A E+  G++R+EIP W
Sbjct: 159 QFHGPLDCIKKLTANNSLMRGLTPTMLRESHGCGVYFLTYEALIANELHKGVSRSEIPTW 218

Query: 241 KLCLFGAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKG 300
           KLCLFGA SGT LWL +YPLDV+KS++Q D L +PK   ++  VAKTIY+  G+ +FFKG
Sbjct: 219 KLCLFGATSGTTLWLMIYPLDVIKSVMQTDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKG 278

Query: 301 FGPTMVRSAPVNGATFLTFELVMR 324
           FGPTM+R+AP NGATF TFEL MR
Sbjct: 279 FGPTMLRAAPANGATFATFELAMR 302

>Kwal_27.12599
          Length = 304

 Score =  359 bits (921), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 181/324 (55%), Positives = 220/324 (67%), Gaps = 23/324 (7%)

Query: 1   MSEEFPTPQLLDELEDQQKVTTPNEKRELSSNRVLKDIFAGTIGGIAQVLVGQPFDXXXX 60
           M EE  +P L+D+++ Q     P++     S RVLKD+ AGT GG+AQVLVGQPFD    
Sbjct: 1   MPEETSSPLLIDDIDQQ-----PHD-----SGRVLKDLLAGTAGGMAQVLVGQPFDTTKV 50

Query: 61  XXXXXXXXXXXXXXXXXXXKNEGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYN 120
                              KNEG+  FYKG LTPL+GVG CVS QFGVNEAMKRFF+   
Sbjct: 51  RLQTSTTPTTAVEVVKKLVKNEGLRGFYKGTLTPLVGVGACVSCQFGVNEAMKRFFRG-- 108

Query: 121 ASKNPNMSSQDVDLSRSNTLPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDR 180
           +S +P+            TL L QYY+CG  GGV NSFLASPIE +RIRLQTQT++G   
Sbjct: 109 SSADPH-----------KTLTLPQYYICGFVGGVANSFLASPIEHVRIRLQTQTASGTVA 157

Query: 181 EFKGPWDCIKKLKAQGGLMRGLFPTMIRAGHGLGTYFLVYEALVAREIGTGLTRNEIPPW 240
           EFKGP DCI KL+A G LMRGL PT++R   G  TYFL YEALVA +IG G+ R+++P W
Sbjct: 158 EFKGPLDCINKLRANGALMRGLSPTILREAQGCATYFLTYEALVANQIGKGIARSDVPAW 217

Query: 241 KLCLFGAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKG 300
           KLCLFGA SG  LWLTVYPLDV+KS++Q D+L+ P    +I  VA+ + AK G ++FFKG
Sbjct: 218 KLCLFGAVSGVTLWLTVYPLDVIKSLMQTDNLKNPVRGKNIIQVARLVNAKYGWKSFFKG 277

Query: 301 FGPTMVRSAPVNGATFLTFELVMR 324
           FGPTM+R+AP NGATF TFEL MR
Sbjct: 278 FGPTMLRAAPANGATFATFELAMR 301

>KLLA0B08503g complement(753498..754409) similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 mitochondrial
           carrier protein (MCF), start by similarity
          Length = 303

 Score =  352 bits (903), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 180/324 (55%), Positives = 217/324 (66%), Gaps = 24/324 (7%)

Query: 1   MSEEFPTPQLLDELEDQQKVTTPNEKRELSSNRVLKDIFAGTIGGIAQVLVGQPFDXXXX 60
           M+EEFPTPQL+D+LE      +P++     + RV+KD+ AGT GGIAQVLVGQPFD    
Sbjct: 1   MTEEFPTPQLIDDLE------SPHD-----NTRVIKDLLAGTAGGIAQVLVGQPFDTTKV 49

Query: 61  XXXXXXXXXXXXXXXXXXXKNEGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYN 120
                              KNEG   FYKG LTPL+GVG CVS+QFGVNEAMKRFF  + 
Sbjct: 50  RLQTSETSTNAVKVIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTF- 108

Query: 121 ASKNPNMSSQDVDLSRSNTLPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDR 180
                       D + S  L L QYY+CG+ GG  NSFLASPIE IRIRLQTQT +G   
Sbjct: 109 ------------DEAASQHLSLLQYYICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATA 156

Query: 181 EFKGPWDCIKKLKAQGGLMRGLFPTMIRAGHGLGTYFLVYEALVAREIGTGLTRNEIPPW 240
           EFKGP DCIKKL+  G LMRGL PTM+R  HG G YFL YEAL+  ++ +G+ R +IP W
Sbjct: 157 EFKGPIDCIKKLRVNGQLMRGLTPTMLRESHGCGVYFLTYEALIGHQVKSGIQRKDIPAW 216

Query: 241 KLCLFGAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKG 300
           KLCLFGA SGT+LW  VYPLDV+KS++Q D+L+ PK  N+I  V +TI A++G+   FKG
Sbjct: 217 KLCLFGAASGTLLWTMVYPLDVIKSVMQTDNLKTPKNGNNILTVGRTIIARQGVSGLFKG 276

Query: 301 FGPTMVRSAPVNGATFLTFELVMR 324
           F PTM+R+AP N ATF TFE  MR
Sbjct: 277 FAPTMLRAAPANAATFATFETAMR 300

>Kwal_33.12988
          Length = 303

 Score =  326 bits (836), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 160/324 (49%), Positives = 199/324 (61%), Gaps = 24/324 (7%)

Query: 1   MSEEFPTPQLLDELEDQQKVTTPNEKRELSSNRVLKDIFAGTIGGIAQVLVGQPFDXXXX 60
           MS+E   PQ++D+L D+  +            R LKDI AGT GGIAQVLVGQPFD    
Sbjct: 1   MSDELTMPQVVDDLTDKSDI-----------RRTLKDITAGTTGGIAQVLVGQPFDITKV 49

Query: 61  XXXXXXXXXXXXXXXXXXXKNEGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYN 120
                              KNEG+  FYKG   PL+GVG+CVS QFG NEAMKR+F   N
Sbjct: 50  RLQTSSTPTTALRVVQDLVKNEGLRGFYKGTTLPLIGVGLCVSSQFGTNEAMKRYFHKRN 109

Query: 121 ASKNPNMSSQDVDLSRSNTLPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDR 180
             +             S +L L +YY CG   G  N+FLA+PIE +RI LQ QT +  D 
Sbjct: 110 NFQ-------------STSLRLPEYYACGFVSGCANAFLATPIEHVRILLQVQTKSRADA 156

Query: 181 EFKGPWDCIKKLKAQGGLMRGLFPTMIRAGHGLGTYFLVYEALVAREIGTGLTRNEIPPW 240
           E++G  DCIKKL  +G LMRG  PT++R  HG G YF  YEA++  E   G+ R +IP W
Sbjct: 157 EYQGAMDCIKKLLKEGKLMRGFTPTILRTSHGFGVYFTSYEAMICSEQRKGIARKDIPAW 216

Query: 241 KLCLFGAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKG 300
           KLCL+GAFSG++LW  VYP DV+KS++Q+D LR P Y  ++  VAK IY + G +AF KG
Sbjct: 217 KLCLYGAFSGSLLWAMVYPFDVIKSVMQSDKLRTPVYGTNVFQVAKNIYNERGPKAFVKG 276

Query: 301 FGPTMVRSAPVNGATFLTFELVMR 324
           FGPTM+RS PVNGATF  FE+ MR
Sbjct: 277 FGPTMLRSLPVNGATFTAFEMAMR 300

>Sklu_2398.4 , Contig c2398 9476-10405
          Length = 309

 Score =  321 bits (822), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 160/324 (49%), Positives = 197/324 (60%), Gaps = 24/324 (7%)

Query: 1   MSEEFPTPQLLDELEDQQKVTTPNEKRELSSNRVLKDIFAGTIGGIAQVLVGQPFDXXXX 60
           MS+E   PQ++D+L D            L   R +KDI +GT GGIAQVLVGQPFD    
Sbjct: 1   MSDELTAPQVVDDLSD-----------SLDYKRAIKDILSGTAGGIAQVLVGQPFDITKV 49

Query: 61  XXXXXXXXXXXXXXXXXXXKNEGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYN 120
                              KNEG+  FYKG L PL+GVG CVS QFGVNEAMKR F+  N
Sbjct: 50  RMQTSAGSATAVDVVTSLIKNEGILGFYKGTLAPLVGVGACVSCQFGVNEAMKRRFRRMN 109

Query: 121 ASKNPNMSSQDVDLSRSNTLPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDR 180
              +P           S  L L QYYVCG+  G  N+FLA+PIE +RIRLQ QT +  + 
Sbjct: 110 G--DP-----------SKPLSLKQYYVCGVASGCANAFLATPIEHVRIRLQLQTKSLANA 156

Query: 181 EFKGPWDCIKKLKAQGGLMRGLFPTMIRAGHGLGTYFLVYEALVAREIGTGLTRNEIPPW 240
           E++G  DC++KL  QG LMRG   T++R  HG G YF  YEAL+A +   G+ R +I PW
Sbjct: 157 EYQGSLDCMRKLLKQGALMRGFTATLMRTCHGFGIYFSTYEALIANQHKKGIPRKDIAPW 216

Query: 241 KLCLFGAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKG 300
           K+C+FGAFSG   W   YP+DVVKSI+Q+D L  P +  ++  VAK+IY   G RAF KG
Sbjct: 217 KVCIFGAFSGACYWAMAYPIDVVKSIMQSDRLVSPVHGTNVWQVAKSIYTTRGKRAFIKG 276

Query: 301 FGPTMVRSAPVNGATFLTFELVMR 324
           F P M+RS PVNGATF TFE+ MR
Sbjct: 277 FMPAMLRSLPVNGATFATFEMTMR 300

>Sklu_1275.1 , Contig c1275 314-1249
          Length = 311

 Score =  316 bits (809), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 159/324 (49%), Positives = 195/324 (60%), Gaps = 24/324 (7%)

Query: 1   MSEEFPTPQLLDELEDQQKVTTPNEKRELSSNRVLKDIFAGTIGGIAQVLVGQPFDXXXX 60
           MS+E  TPQ++D+L D  +             + +KDI +GT GGIAQVLVGQPFD    
Sbjct: 1   MSDELTTPQVVDDLSDAPEF-----------RKAIKDIISGTSGGIAQVLVGQPFDITKV 49

Query: 61  XXXXXXXXXXXXXXXXXXXKNEGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYN 120
                              KNEG+ AFYKG L PL+GVG CVS QFGVNEAMKR+F   N
Sbjct: 50  RMQTSSGSPTAIEVIKNLVKNEGLLAFYKGTLVPLIGVGACVSCQFGVNEAMKRYFLRVN 109

Query: 121 ASKNPNMSSQDVDLSRSNTLPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDR 180
             K+ ++S             L QYY CG   G  N+FLA+PIE +RIRLQ QT      
Sbjct: 110 GYKDQHLS-------------LLQYYTCGFVSGSANAFLATPIEHVRIRLQLQTKALAKA 156

Query: 181 EFKGPWDCIKKLKAQGGLMRGLFPTMIRAGHGLGTYFLVYEALVAREIGTGLTRNEIPPW 240
           E++G  DC+KKL  Q  LMRG   T++R  HG G YFL YEAL+  +   G+ R +IPPW
Sbjct: 157 EYRGSLDCMKKLLKQKALMRGFTATLMRTSHGFGVYFLTYEALIMNQNKNGVLRKDIPPW 216

Query: 241 KLCLFGAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKG 300
           K+C+FGAFSG   W   YP DVVKSI+Q D L  P +  ++  VAK+I+A  G  AF KG
Sbjct: 217 KVCVFGAFSGAFFWAMTYPFDVVKSIMQADRLVSPVHGKNVFQVAKSIHATRGWGAFVKG 276

Query: 301 FGPTMVRSAPVNGATFLTFELVMR 324
           F PTM+RS PVNGATF TFE+ MR
Sbjct: 277 FVPTMLRSLPVNGATFATFEVTMR 300

>Kwal_56.23011
          Length = 303

 Score =  310 bits (794), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 155/324 (47%), Positives = 190/324 (58%), Gaps = 24/324 (7%)

Query: 1   MSEEFPTPQLLDELEDQQKVTTPNEKRELSSNRVLKDIFAGTIGGIAQVLVGQPFDXXXX 60
           MSEE  +PQ++D+L D                + LKD+F GT+GG+AQVLVGQPFD    
Sbjct: 1   MSEELTSPQVVDDLVDTHDF-----------KQALKDVFCGTVGGVAQVLVGQPFDITKV 49

Query: 61  XXXXXXXXXXXXXXXXXXXKNEGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYN 120
                              KNEG+ AFYKG L PL GVG CVS QFGVNEA+K++F+   
Sbjct: 50  RLQTSPVPTTAAQVIKSLVKNEGLLAFYKGTLAPLAGVGACVSCQFGVNEALKKWFRK-- 107

Query: 121 ASKNPNMSSQDVDLSRSNTLPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDR 180
             K+ N             L L QYY CG   G  N+FLA+PIE +RIRLQ QT++    
Sbjct: 108 --KDGNFD---------QPLALRQYYACGFVSGTANAFLATPIEHVRIRLQLQTASSSAA 156

Query: 181 EFKGPWDCIKKLKAQGGLMRGLFPTMIRAGHGLGTYFLVYEALVAREIGTGLTRNEIPPW 240
           E+ G  DC +KL  QG LMRG   T +R  HG G YFL YE L+A +   G+ R  IP W
Sbjct: 157 EYHGSLDCARKLLKQGALMRGFTATTLRTSHGFGIYFLTYETLIANQAHHGVLRENIPAW 216

Query: 241 KLCLFGAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKG 300
           K+C++GAFSG   W   YP DVVKS++Q D L+ P Y  +   VAK IY + G RAF KG
Sbjct: 217 KVCVYGAFSGAFFWAMTYPFDVVKSVMQADKLKNPVYGRNPLAVAKAIYRERGPRAFTKG 276

Query: 301 FGPTMVRSAPVNGATFLTFELVMR 324
           F PTM+RS PVNGATF  FE+ MR
Sbjct: 277 FTPTMLRSLPVNGATFAAFEITMR 300

>KLLA0F17864g complement(1634241..1635164) similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 mitochondrial
           carrier protein (MCF), start by similarity
          Length = 307

 Score =  301 bits (771), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 150/325 (46%), Positives = 189/325 (58%), Gaps = 22/325 (6%)

Query: 1   MSEEF-PTPQLLDELEDQQKVTTPNEKRELSSNRVLKDIFAGTIGGIAQVLVGQPFDXXX 59
           MS+E   TPQ++++L D                + LKD+F+GT+GG+AQVLVGQPFD   
Sbjct: 1   MSDELLITPQVVEDLTDLHGF-----------RKTLKDVFSGTVGGVAQVLVGQPFDIIK 49

Query: 60  XXXXXXXXXXXXXXXXXXXXKNEGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNY 119
                               K EG   FYKG + PL+GVG CVS QFG+NEAMKR+F++ 
Sbjct: 50  VRLQTMPGNATAWEAITDLVKYEGFMGFYKGTMAPLVGVGACVSCQFGINEAMKRYFRDL 109

Query: 120 NASKNPNMSSQDVDLSRSNTLPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGD 179
           N S+              NTL L QYY CG   G  N+ LA+PIE +RIRLQ Q     +
Sbjct: 110 NRSRGI----------YDNTLSLGQYYTCGFVSGSANALLATPIEHVRIRLQLQKEALAN 159

Query: 180 REFKGPWDCIKKLKAQGGLMRGLFPTMIRAGHGLGTYFLVYEALVAREIGTGLTRNEIPP 239
            E+K   DC +KL  QG LMRG   T++R  HG G YFL YE L+A ++  G  R +I  
Sbjct: 160 AEYKSTLDCTEKLLKQGSLMRGFTATLMRTSHGFGIYFLTYETLIASQLAHGFRREDISA 219

Query: 240 WKLCLFGAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFK 299
           WK C+FGA SG   W   YP DVVKS++Q D L  P Y  ++  VAK IY + G+RAF K
Sbjct: 220 WKACMFGALSGAFFWAMTYPFDVVKSVMQADKLVNPAYGTNVVQVAKNIYRERGLRAFTK 279

Query: 300 GFGPTMVRSAPVNGATFLTFELVMR 324
           GF PTM+RS PVNGATF  FE+ M+
Sbjct: 280 GFMPTMLRSLPVNGATFAAFEVTMQ 304

>KLLA0C13431g 1145919..1146905 similar to sgd|S0005626 Saccharomyces
           cerevisiae YOR100c CRC1 mitochondrial carnitine carrier,
           member of the mitochondrial carrier (MCF) family, start
           by similarity
          Length = 328

 Score =  118 bits (295), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 91/322 (28%), Positives = 140/322 (43%), Gaps = 31/322 (9%)

Query: 13  ELEDQQKVTTPNEKRELSSNRVLKDIFAGTIGGIAQVLVGQPFDXXXXXXXXXXXXXXXX 72
           ELE          K +L+ N  LK + AG +GG+  VL G PFD                
Sbjct: 9   ELETSHVNDVSQTKSQLTEN--LKSLAAGGVGGVCAVLTGHPFDLVKVRCQSNQARSAMD 66

Query: 73  XXXXXXXKNE---------GVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASK 123
                               V  FYKG + PLLGV    +V F   +  K+   +  +S 
Sbjct: 67  AVSHILQAARQAAGPTSLNAVRGFYKGVVPPLLGVTPIFAVSFWGYDVGKKLVTSVPSSA 126

Query: 124 NPNMSSQDVDLSRSNTLPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFK 183
               ++ + +L+      LSQ    G    +  + + +P E++++ LQT     G   F 
Sbjct: 127 ASGAAAVEPELT------LSQMAAAGFISAIPTTLVTAPTERVKVVLQT---TQGKASFL 177

Query: 184 GPWDCIKKLKAQGGLMRGLFPTMIRAGHGLGTYFLVYEALVAREI---GTGLTRNEIPPW 240
                I + +    L +G   T+ R G G   YF  YE  + +E     +G T  E+   
Sbjct: 178 DAAKQIVRTQGFQSLFKGSLATLSRDGPGSALYFASYE--ICKEYLNKASGHTSGELSIT 235

Query: 241 KLCLFGAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIY-AKEGIRAFFK 299
            +C+ G  +G  +W+ V+P+D VK+ +Q+   R+     S+  V + IY  + GI+ FF 
Sbjct: 236 NVCISGGMAGVSMWVVVFPIDTVKTQLQSSSKRQ-----SMLEVTRMIYNTRGGIKGFFP 290

Query: 300 GFGPTMVRSAPVNGATFLTFEL 321
           G GP ++RS P N ATFL  EL
Sbjct: 291 GVGPAILRSFPANAATFLGVEL 312

>Kwal_23.2913
          Length = 320

 Score =  116 bits (291), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 92/328 (28%), Positives = 141/328 (42%), Gaps = 40/328 (12%)

Query: 17  QQKVTTPNEKRELSSN-RVLKDIF----AGTIGGIAQVLVGQPFDXXXXXXXXXXXXXXX 71
           +Q     N K E +SN   L+D F    AG +GG+  VL G PFD               
Sbjct: 6   EQDAADLNAKIEQASNSHTLRDSFESLAAGGVGGVCAVLTGHPFDLLKVRCQSNQASGTL 65

Query: 72  XXXXXXXXKNEG---------VFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNAS 122
                   + +          +  FY+G + PLLGV    +V F   +  KR        
Sbjct: 66  DAISRVLHEAKSKSGPLPLNQIKGFYRGVIPPLLGVTPIFAVSFWGYDVGKRL---VTWG 122

Query: 123 KNPNMSSQDVDLSRSNTLPL--SQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDR 180
            NP     D+  S S   PL  SQ  + G    +  + + +P E++++ LQT  S     
Sbjct: 123 SNP---VTDIAGSSSKLTPLTTSQLALAGFFSAIPTTLITAPTERVKVVLQTSESG---- 175

Query: 181 EFKGPWDCIKKLKAQGGLMRGLFPTMIRAGHGLGTYFLVYEALVAREIGTGLTRNE---- 236
            F G    + +      L +G   T+ R G G   YF  YE  V++     L+RN+    
Sbjct: 176 SFLGAARTLIREGGVRSLFQGTLATLARDGPGSALYFASYE--VSKRF---LSRNQDTDA 230

Query: 237 IPPWKLCLFGAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRA 296
           +    +C+ G  +G  +W+ V+P+D +K+ +Q+          S+   A+ IY + G+R 
Sbjct: 231 LSVVSICVAGGVAGMSMWIGVFPIDTIKTKLQSSS-----RSQSMVQAAREIYTRAGLRG 285

Query: 297 FFKGFGPTMVRSAPVNGATFLTFELVMR 324
           FF G GP ++RS P N ATFL  E   +
Sbjct: 286 FFPGLGPALMRSFPANAATFLGVEFTHQ 313

>ADL264C [1477] [Homologous to ScYOR100C (CRC1) - SH]
           (241532..242521) [990 bp, 329 aa]
          Length = 329

 Score =  113 bits (283), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 98/341 (28%), Positives = 145/341 (42%), Gaps = 62/341 (18%)

Query: 8   PQLLDELEDQQKVTTPNE---------KRELSSNRVLKDIFAGTIGGIAQVLVGQPFDXX 58
           P+  D + +Q+ V    E            L  N   K + AG +GG+  VL G PFD  
Sbjct: 14  PRSRDRMAEQESVVAIEEPSVHVGTPKSNALYEN--AKSLAAGAVGGVCAVLTGHPFDLL 71

Query: 59  XXXXXXXXXXXXXXXXXXXXXK---NEGVFA------FYKGALTPLLGVGICVSVQF-GV 108
                                +     G+ A      FYKG + PLLGV    +V F G 
Sbjct: 72  KVRCQSNQASGTVDAVRKILVEARAQSGLSAVNMMRGFYKGVIPPLLGVTPIFAVSFWGY 131

Query: 109 NEAMKRFFQNYNASKNPNMSSQDVDLSRSNTLPLSQYYVCGLTGGVVNSFLASPIEQIRI 168
           +   K    N N+ K                L  +Q    G    +  + + +P E++++
Sbjct: 132 DVGKKLVTWNDNSGK----------------LTTAQLATAGFISAIPTTLVMAPTERVKV 175

Query: 169 RLQTQTSNGGDREFKGPWDCIKKLKAQGG---LMRGLFPTMIRAGHGLGTYFLVYEA--- 222
            LQTQ+++             K + A GG   L RG   T+ R G G   YF  YEA   
Sbjct: 176 VLQTQSNHS-------LGSAAKHILATGGVRSLFRGSLATLARDGPGSALYFASYEATKA 228

Query: 223 -LVAREIGTGLTRNEIPPWKLCLFGAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSI 281
            L AR  GT    NE+    +CL G  +G  +W+ V+P+D +K+ +Q+ + R+     ++
Sbjct: 229 YLNARS-GT----NELSIKNVCLAGGMAGVSMWVGVFPIDTIKTELQSSNTRQ-----TM 278

Query: 282 SYVAKTIY-AKEGIRAFFKGFGPTMVRSAPVNGATFLTFEL 321
               + IY  + GI+ FF G GP ++RS P N ATFL  EL
Sbjct: 279 MEATRKIYNTRGGIKGFFPGIGPALLRSFPANAATFLGVEL 319

>Scas_697.47
          Length = 328

 Score =  113 bits (282), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 90/304 (29%), Positives = 123/304 (40%), Gaps = 39/304 (12%)

Query: 35  LKDIFAGTIGGIAQVLVGQPFDXXXXXXXXXXXXXXXXXXXXXXXKNEG----------V 84
           LK + AG +GG+  VL G PFD                                     V
Sbjct: 37  LKSLVAGGVGGVCAVLTGHPFDLIKVRCQSGQASSTIHAIKIILKDARAIPTSNMLVNSV 96

Query: 85  FAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTLPLSQ 144
             FYKG + PLLGV    +V F   +  K+     ++S              S  L + Q
Sbjct: 97  KGFYKGVIPPLLGVTPIFAVSFWGYDVGKKIVTRSDSS--------------SAQLTMGQ 142

Query: 145 YYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQGGLMRGLFP 204
               G    +  + + +P E+I++ LQT  +N     F G    I K      L +G   
Sbjct: 143 MAAAGFISAIPTTLVTAPTERIKVVLQTAGANS-KTSFIGAAKNIVKDGGVKSLFKGSLA 201

Query: 205 TMIRAGHGLGTYFLVYEA----LVAREIGTGLTRNEIPPWKLCLFGAFSGTMLWLTVYPL 260
           T+ R G G   YF  YE     L  R         E+    +CL G  +G  +WL V+P+
Sbjct: 202 TLARDGPGSALYFASYEISKKFLNDRNATAESKTGEVNIANVCLAGGIAGMSMWLVVFPI 261

Query: 261 DVVKSIIQNDDLRKPKYKNSISYVAKT--IYAKEG-IRAFFKGFGPTMVRSAPVNGATFL 317
           D +K+ +Q+          S S VA T  IY K G I+ FF G GP ++RS P N ATFL
Sbjct: 262 DTIKTKLQSSS-------GSQSMVAATREIYVKRGGIKGFFPGLGPALLRSFPANAATFL 314

Query: 318 TFEL 321
             EL
Sbjct: 315 GVEL 318

>KLLA0E09680g complement(860245..861168) similar to ca|CA5146|CaYMC2
           Candida albicans Carnitine/acylcarnitine translocase (by
           homology), start by similarity
          Length = 307

 Score =  110 bits (276), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 99/294 (33%), Positives = 129/294 (43%), Gaps = 30/294 (10%)

Query: 40  AGTIGGIAQVLVGQPFDXXXXXXXXXXXXXXXXXXXXXXXK---NEGVFAFYKGALTPLL 96
           AG   G+A+  VG PFD                       K   N+G+  FY G   PL+
Sbjct: 29  AGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGIRGFYLGFTPPLV 88

Query: 97  GVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTLPLSQYYVCGLTGGVVN 156
           G  +  SV  G     +     Y     PN             LPLS   + G+  G   
Sbjct: 89  GWILMDSVMLGCLHNYRMLMHKY---VYPN----------DEKLPLSGCIISGVLAGWSV 135

Query: 157 SFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKL-KAQG--GLMRGLFPTMIRAGHGL 213
           SF+A PIE  + +LQ Q      R +KGP D IKK+  AQG  GL +GL  T+I   H +
Sbjct: 136 SFIAPPIELAKAKLQVQYDKTTTR-YKGPLDVIKKIYSAQGIRGLYKGLISTLIFRTHFV 194

Query: 214 GTYFLVYEALVA--REIGTGLTRNEIPPWKLCLFGAFSGTM-LWLTVYPLDVVKSIIQND 270
             ++  YE L    RE  T ++   I  W     G FS +   W T YP DVVK ++  +
Sbjct: 195 -YWWGSYELLTRWFRE-NTKMSEAAINFWA----GGFSASFGFWTTAYPSDVVKQVVLCN 248

Query: 271 DLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATFLTFELVMR 324
           D     +K S     K IY  +GI  FFKGF P+ +RS P N A    FE V+R
Sbjct: 249 DKYDGSFK-SWRTAVKDIYQSKGINGFFKGFVPSFLRSFPANAAALAAFEFVLR 301

>Kwal_33.15446
          Length = 305

 Score =  109 bits (272), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 91/298 (30%), Positives = 126/298 (42%), Gaps = 38/298 (12%)

Query: 40  AGTIGGIAQVLVGQPFDXXXXXXXXXXXXXXXX---XXXXXXXKNEGVFAFYKGALTPLL 96
           +G   GIA+  VG PFD                          + +G+  FY G   PL+
Sbjct: 24  SGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGIRGFYLGFTPPLV 83

Query: 97  GVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTLPLSQYYVCGLTGGVVN 156
           G  +  SV  G     +   + Y                    LPLS   + G+  G   
Sbjct: 84  GWILMDSVMLGCLHNYRMLLKKYV-------------YQHEEKLPLSGCILSGVLAGWSV 130

Query: 157 SFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQGG---LMRGLFPTMIRAGH-- 211
           SF+A+P+E  + +LQ Q      R ++GP D IKK+ A  G   + +GL  T+I   H  
Sbjct: 131 SFIAAPVELAKAKLQVQYDAQTTR-YRGPLDVIKKVYAADGIRGMYKGLVSTLIFRTHFV 189

Query: 212 -GLGTYFLVYEALVAREIGTGLTRNEIPPWKLCLFGAFSGTM-LWLTVYPLDVVKSIIQN 269
              G+Y L+     A    T L+   I  W     G FS +   W T YP DV+K +I  
Sbjct: 190 YWWGSYELLTRWFKAN---TNLSDTAINFWA----GGFSASFGFWTTAYPSDVIKQVILC 242

Query: 270 DDLRKPKYKNSISY---VAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATFLTFELVMR 324
           +D    KY  S+      A  I+   GIR FFKGF P+ +RS P N A   +FE V+R
Sbjct: 243 ND----KYDGSLRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASFEFVLR 296

>CAGL0B04543g 441599..442552 highly similar to tr|Q12289
           Saccharomyces cerevisiae YOR100c CRC1, start by
           similarity
          Length = 317

 Score =  107 bits (267), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 90/333 (27%), Positives = 134/333 (40%), Gaps = 51/333 (15%)

Query: 14  LEDQQKVTTPNEKRELSSNRVLKDIFAGTIGGIAQVLVGQPFDXXXXXXXXXXXXXXXXX 73
           + D    T   E +  +    +K + AG +GG+  VL G PFD                 
Sbjct: 1   MSDTPAETNILEHKTDAFRENMKALVAGGVGGVCAVLTGHPFDLIKVRCQSNQAKSTMDA 60

Query: 74  XXXXXXK-----------------NEGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFF 116
                 +                    V  FYKG + PL+GV    +V F   +  KR  
Sbjct: 61  VSIILKEARSLSTVNGSLTTSLFFKNSVKGFYKGVIPPLIGVTPIFAVSFWGYDIGKRLV 120

Query: 117 QNYNASKNPNMSSQDVDLSRSNTLPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSN 176
               AS  P              L  +Q    G    +  + + +P E+I++ LQT    
Sbjct: 121 TWKQASDAP--------------LTTAQMATAGFISAIPTTLVTAPTERIKVVLQT---- 162

Query: 177 GGDREFKGPW-DCIKKLKAQGG---LMRGLFPTMIRAGHGLGTYFLVYE---ALVAREIG 229
             + EFKG +    K + + GG   L  G   T+ R G G   YF  YE   A + + + 
Sbjct: 163 --NSEFKGSFIKAAKHIVSTGGVKSLFNGSLATLARDGPGSALYFASYELSKAFLNKSVA 220

Query: 230 TGLTRNEIPPWKLCLFGAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIY 289
               ++E+    +CL G  +G  +WL V+P+D +K+      L+      S+    K IY
Sbjct: 221 KK-DKDEVNLANVCLAGGIAGMSMWLVVFPIDTIKT-----RLQVATTPISMVQATKDIY 274

Query: 290 AKEG-IRAFFKGFGPTMVRSAPVNGATFLTFEL 321
            + G I+ FF G GP ++RS P N ATFL  EL
Sbjct: 275 IQRGGIKGFFPGLGPALLRSFPANAATFLGVEL 307

>YOR100C (CRC1) [4905] chr15 complement(513295..514278)
           Mitochondrial carnitine carrier, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [984 bp, 327 aa]
          Length = 327

 Score =  105 bits (262), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 80/302 (26%), Positives = 121/302 (40%), Gaps = 35/302 (11%)

Query: 35  LKDIFAGTIGGIAQVLVGQPFDXXXXXXXXXXXXXXXXXXXXXXXK----------NEGV 84
           +K   AG +GG+  V  G PFD                       +             V
Sbjct: 36  IKSFVAGGVGGVCAVFTGHPFDLIKVRCQNGQANSTVHAITNIIKEAKTQVKGTLFTNSV 95

Query: 85  FAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTLPLSQ 144
             FYKG + PLLGV    +V F   +  K+     N                SN L + Q
Sbjct: 96  KGFYKGVIPPLLGVTPIFAVSFWGYDVGKKLVTFNNKQGG------------SNELTMGQ 143

Query: 145 YYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQGGLMRGLFP 204
               G    +  + + +P E++++ LQT +       F      I K      L +G   
Sbjct: 144 MAAAGFISAIPTTLVTAPTERVKVVLQTSSKG----SFIQAAKTIVKEGGIASLFKGSLA 199

Query: 205 TMIRAGHGLGTYFLVYEA----LVAREIGTGLTRNE-IPPWKLCLFGAFSGTMLWLTVYP 259
           T+ R G G   YF  YE     L +R+      ++E +    +CL G  +G  +WL V+P
Sbjct: 200 TLARDGPGSALYFASYEISKNYLNSRQPRQDAGKDEPVNILNVCLAGGIAGMSMWLAVFP 259

Query: 260 LDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATFLTF 319
           +D +K+ +Q    R+    N +S   +    + GI+ FF G GP ++RS P N ATFL  
Sbjct: 260 IDTIKTKLQASSTRQ----NMLSATKEIYLQRGGIKGFFPGLGPALLRSFPANAATFLGV 315

Query: 320 EL 321
           E+
Sbjct: 316 EM 317

>Kwal_55.21335
          Length = 317

 Score =  101 bits (251), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 83/297 (27%), Positives = 119/297 (40%), Gaps = 41/297 (13%)

Query: 35  LKDIFAGTIGGIAQVLVGQPFDXXXXXXXXXXXXX--XXXXXXXXXXKNEG-VFAFYKGA 91
           LKDI  G+I G A  ++  P D                         + EG V  FY+G 
Sbjct: 46  LKDILYGSIAGAAGKVIEYPLDTIKVRLQTQPAHVFPTSWSCIKYTYQKEGFVKGFYQGV 105

Query: 92  LTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTLPLSQYYVCGLT 151
            +PL+G  +  +V F      + F Q Y +                   PLSQ  + G  
Sbjct: 106 ASPLVGAALENAVLFVTFNRAQNFLQQYESVS-----------------PLSQTVLSGAF 148

Query: 152 GGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKL---KAQGGLMRGLFPTMIR 208
            G   S++ +P+E I+  LQ     G        W  +K +   K  GGL +G   T IR
Sbjct: 149 AGACTSYVLTPVELIKCTLQVSNLEGATTRHSKIWPTVKHIVQHKGIGGLWQGQSSTFIR 208

Query: 209 AGHGLGTYFLVYEAL---VAREIGTGLTRN--EIPPWKLCLFGAFSGTMLWLTVYPLDVV 263
              G   +F  YE+L   +AR       RN  E   W+L   GA +G     +++P D +
Sbjct: 209 ECAGGAVWFTTYESLKSYLARR------RNDTENHTWELLASGASAGVAFNASIFPADTI 262

Query: 264 KSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATFLTFE 320
           KS  Q   L        I    K I A+ G    ++G G T++R+AP N   F T+E
Sbjct: 263 KSTAQTQHL-------GIVDATKRILARSGPAGLYRGLGITLIRAAPANAIVFYTYE 312

 Score = 28.9 bits (63), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 33/78 (42%), Gaps = 11/78 (14%)

Query: 149 GLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQ---GGLMRGLFPT 205
           G + GV  +    P + I+   QTQ          G  D  K++ A+    GL RGL  T
Sbjct: 245 GASAGVAFNASIFPADTIKSTAQTQ--------HLGIVDATKRILARSGPAGLYRGLGIT 296

Query: 206 MIRAGHGLGTYFLVYEAL 223
           +IRA       F  YE L
Sbjct: 297 LIRAAPANAIVFYTYETL 314

>KLLA0E02772g complement(261895..262749) similar to sp|Q12375
           Saccharomyces cerevisiae YOR130c ARG11 ornithine
           transport protein of mitochondria involved in arginine
           metabolism, member of the mitochondrial carrier family
           (MCF), start by similarity
          Length = 284

 Score = 95.1 bits (235), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 76/299 (25%), Positives = 124/299 (41%), Gaps = 33/299 (11%)

Query: 35  LKDIFAGTIGGIAQVLVGQPFDXXXXXXXXXXXXX--XXXXXXXXXXKNEGVF-AFYKGA 91
           LKDI  G++ G    ++  PFD                          +EG++  FY+G 
Sbjct: 8   LKDIAYGSVAGAIGKVIEYPFDTVKVRLQTQPAHLYPTTWSCIRSTYTDEGIWKGFYQGI 67

Query: 92  LTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTLPLSQYYVCGLT 151
            +PL G  +  +V F        F   +   K                 PL++    G  
Sbjct: 68  ASPLFGAALENAVLFVSFNQCTNFLDEFTQLK-----------------PLTKTIYSGAF 110

Query: 152 GGVVNSFLASPIEQIRIRLQ-TQTSNGGDREFKGP--WDCIKK-LKAQG--GLMRGLFPT 205
            G   SF+ +P+E ++ +LQ +  SN   +  +    W  IK  +K +G  GL +G   T
Sbjct: 111 AGACASFILTPVELVKCKLQVSNISNSLSQTTRHTSVWPTIKSVIKEKGLLGLWQGQLST 170

Query: 206 MIRAGHGLGTYFLVYEALVAREIGTGLTRNEIPPWKLCLFGAFSGTMLWLTVYPLDVVKS 265
            +R   G   +F  YE +  +         E   W+L + GA +G +   +V+P D VKS
Sbjct: 171 FVRECLGGAVWFTTYEIMKMKFASLHPAEKENHTWELLVSGASAGVLFNASVFPADTVKS 230

Query: 266 IIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATFLTFELVMR 324
           + Q + +       SI    K +    GI  F++G G T++R+AP N   F T+E + +
Sbjct: 231 VCQTEHV-------SIVNALKKVLRTHGITGFYRGLGITLIRAAPANATVFYTYETLKK 282

>Sklu_2127.5 YOR130C, Contig c2127 7354-8190 reverse complement
          Length = 278

 Score = 94.7 bits (234), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 78/291 (26%), Positives = 122/291 (41%), Gaps = 31/291 (10%)

Query: 36  KDIFAGTIGGIAQVLVGQPFDXXXXXXXXXXXXX--XXXXXXXXXXKNEGVF-AFYKGAL 92
           KDI  G+I G    ++  PFD                          NEG++  FY+G  
Sbjct: 8   KDILYGSIAGAVGKVIEYPFDTVKVRLQTQPAHMFPTTWSCIKFTYDNEGLWRGFYQGIG 67

Query: 93  TPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTLPLSQYYVCGLTG 152
           +PL G  +  +V F      KR                DV+   S   PLS+    G   
Sbjct: 68  SPLAGAALENAVLFVSFNQAKRLL--------------DVE---SLLSPLSKTVWAGAFA 110

Query: 153 GVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQGG---LMRGLFPTMIRA 209
           G   SF+ +P+E I+ +LQ    +            IK + ++ G   L +G   T IR 
Sbjct: 111 GACASFVLTPVELIKCKLQVSNLSTTKTSHTKILPTIKSVLSERGFLGLWQGQSGTFIRE 170

Query: 210 GHGLGTYFLVYEALVAREIGTGLTRNEIPPWKLCLFGAFSGTMLWLTVYPLDVVKSIIQN 269
             G   +F  YE +V   + +     +   W+L   GA +G     +++P D +KS +Q 
Sbjct: 171 SGGGAAWFTTYE-VVKNYLASRRQAEQNTTWELLASGASAGLAFNASIFPADTIKSTMQT 229

Query: 270 DDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATFLTFE 320
           D +        +S   + IYA++GI  F++G G T++R+ P N A F T+E
Sbjct: 230 DHI-------DLSSATRKIYARQGIAGFYRGLGITLIRAVPANAAIFYTYE 273

 Score = 33.1 bits (74), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 41/86 (47%), Gaps = 6/86 (6%)

Query: 241 KLCLFGAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVA-KTIYAKEGI-RAFF 298
           K  L+G+ +G +  +  YP D VK  +Q     +P +    ++   K  Y  EG+ R F+
Sbjct: 8   KDILYGSIAGAVGKVIEYPFDTVKVRLQT----QPAHMFPTTWSCIKFTYDNEGLWRGFY 63

Query: 299 KGFGPTMVRSAPVNGATFLTFELVMR 324
           +G G  +  +A  N   F++F    R
Sbjct: 64  QGIGSPLAGAALENAVLFVSFNQAKR 89

>Sklu_2075.3 , Contig c2075 6414-7451 reverse complement
          Length = 345

 Score = 95.5 bits (236), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 85/295 (28%), Positives = 123/295 (41%), Gaps = 32/295 (10%)

Query: 40  AGTIGGIAQVLVGQPFDXXXXXXXXXXXXXXXXXXXXXXXKN---EGVFAFYKGALTPLL 96
           +G   GIA+  VG PFD                       K    +G+  FY G   PL+
Sbjct: 66  SGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGIRGFYLGFTPPLV 125

Query: 97  GVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTLPLSQYYVCGLTGGVVN 156
           G  +  SV  G     +   + Y                    LPLS   + G+  G   
Sbjct: 126 GWILMDSVMLGCLHNYRMLLKKYV-------------YYNEEKLPLSGCIISGVMAGWSV 172

Query: 157 SFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQGG---LMRGLFPTMIRAGH-- 211
           SF+A+P+E  + +LQ Q  +    ++ GP D IKK+ +  G   L +GL  T+I   +  
Sbjct: 173 SFIAAPVELAKAKLQVQY-DAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLIFRTNFV 231

Query: 212 -GLGTYFLVYEALVAREIGTGLTRNEIPPWKLCLFGAFSGTM-LWLTVYPLDVVKSIIQN 269
              G+Y L+          T ++   I  W     G FS +   W T YP DV+K ++  
Sbjct: 232 FWWGSYELLTRWFKEH---TNMSDTAINFWS----GGFSASFGFWTTAYPSDVIKQVVLC 284

Query: 270 DDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATFLTFELVMR 324
           +D     ++ S    AK I+   G R FFKGF P+ +RS P N A    FE V+R
Sbjct: 285 NDKYDGTFR-SWKLAAKDIWRTRGYRGFFKGFVPSFLRSFPANAAALAAFEFVLR 338

>YPL134C (ODC1) [5311] chr16 complement(298570..299502)
           2-Oxodicarboxylate transporter, has specificity for
           2-oxoadipate and 2-oxoglutarate, member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [933 bp, 310 aa]
          Length = 310

 Score = 92.4 bits (228), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 78/252 (30%), Positives = 117/252 (46%), Gaps = 34/252 (13%)

Query: 80  KNEGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNT 139
           K EG    YKG  +P+L      +++F  N+  + F++    + N  M+ +    S    
Sbjct: 73  KKEGFSHLYKGITSPILMEAPKRAIKFSGNDTFQTFYKKIFPTPNGEMTQKIAIYS---- 128

Query: 140 LPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQGG-- 197
                    G + G V +F+ +P E ++IRLQ   S     +FK P + +K    +GG  
Sbjct: 129 ---------GASAGAVEAFVVAPFELVKIRLQDVNS-----QFKTPIEVVKNSVVKGGVL 174

Query: 198 -LMRGLFPTMIR-----AGHGLGTYFLVYEALVAREIGTGLTRNEIPPWKLCLFGAFSGT 251
            L  GL  T+ R     AG+  G  F + + L A +  T  TRN++      + GA  GT
Sbjct: 175 SLFNGLEATIWRHVLWNAGY-FGIIFQIRKLLPAAKTSTEKTRNDL------IAGAIGGT 227

Query: 252 MLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPV 311
           +  L   P DVVKS IQ       KY  S+  V   +Y +EG +A +KGF P ++R AP 
Sbjct: 228 VGCLLNTPFDVVKSRIQRSSGPLRKYNWSLPSVL-LVYREEGFKALYKGFAPKVMRLAPG 286

Query: 312 NGATFLTFELVM 323
            G   + F  VM
Sbjct: 287 GGLLLVVFTNVM 298

 Score = 36.2 bits (82), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 44/198 (22%), Positives = 80/198 (40%), Gaps = 32/198 (16%)

Query: 140 LPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGD----------REFKGPWDCI 189
           LP    +  G   GV    +  P++ ++ R+Q Q +  G             + G  DC+
Sbjct: 9   LPFIYQFTAGAIAGVSELLVMYPLDVVKTRMQLQVTTKGHPAVVAAKAAVDHYTGVMDCL 68

Query: 190 KKLKAQGG---LMRGLF-PTMIRAGH------GLGTYFLVYEALVAREIGTGLTRNEIPP 239
            K+  + G   L +G+  P ++ A        G  T+   Y+ +         T N    
Sbjct: 69  TKIVKKEGFSHLYKGITSPILMEAPKRAIKFSGNDTFQTFYKKIFP-------TPNGEMT 121

Query: 240 WKLCLF-GAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFF 298
            K+ ++ GA +G +    V P ++VK  +Q+ +    ++K  I  V  ++  K G+ + F
Sbjct: 122 QKIAIYSGASAGAVEAFVVAPFELVKIRLQDVN---SQFKTPIEVVKNSV-VKGGVLSLF 177

Query: 299 KGFGPTMVRSAPVNGATF 316
            G   T+ R    N   F
Sbjct: 178 NGLEATIWRHVLWNAGYF 195

>CAGL0B03883g 383602..384522 weakly similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 or sp|P38087
           Saccharomyces cerevisiae YBR104w YMC2, hypothetical
           start
          Length = 306

 Score = 90.9 bits (224), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 86/318 (27%), Positives = 133/318 (41%), Gaps = 43/318 (13%)

Query: 28  ELSSNRVLKDIFAGTIGGIAQVLVGQPFDXXXXXXXXXXXXXXXXXX-------XXXXXK 80
           E + +RV+  + AG   G+A+  VG PFD                              K
Sbjct: 4   EETYSRVMGFV-AGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLK 62

Query: 81  NEGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTL 140
           N+G+   Y G   PL G  +  S   G     +     Y   ++             + L
Sbjct: 63  NQGIRGLYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEH-------------DKL 109

Query: 141 PLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQG---- 196
           PLS   + G+  G   SF+A+P+E  + +LQ Q  +    ++ GP D ++K+  QG    
Sbjct: 110 PLSGCIISGVMAGWTVSFIAAPVELAKAKLQVQY-DAKTTKYTGPIDVVQKVFKQGMATN 168

Query: 197 -------GLMRGLFPTMIRAGH---GLGTYFLVYEALVAREIGTGLTRNEIPPWKLCLFG 246
                   L +GL  T+I   +     G+Y L+ +     +  T L+   I  W   L  
Sbjct: 169 GILGGVRSLYKGLISTLIFRSNFVFWWGSYELITQWF---QKNTNLSAPAINFWAGGLSA 225

Query: 247 AFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMV 306
           +F     W + YP DVVK ++  +D     +K+  + V+  IY + GI  FFKGF P+ +
Sbjct: 226 SFG---FWTSAYPSDVVKQVVLCNDKYDGSFKSWRTAVSD-IYRQRGIHGFFKGFLPSFL 281

Query: 307 RSAPVNGATFLTFELVMR 324
           RS P N A    FE V+R
Sbjct: 282 RSFPANAAALAAFEFVLR 299

>YOR130C (ORT1) [4932] chr15 complement(569929..570807) Ornithine
           transport protein of mitochondria involved in arginine
           metabolism, member of the mitochondrial carrier family
           (MCF) of membrane transporters [879 bp, 292 aa]
          Length = 292

 Score = 88.2 bits (217), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 76/310 (24%), Positives = 131/310 (42%), Gaps = 39/310 (12%)

Query: 24  NEKRELSSNRVLKDIFAGTIGGIAQVLVGQPFDXXXXXXXXXXXXX--XXXXXXXXXXKN 81
           ++K+ L    +L DI  G+I G    ++  PFD                         +N
Sbjct: 4   SKKKGLIEGAIL-DIINGSIAGACGKVIEFPFDTVKVRLQTQASNVFPTTWSCIKFTYQN 62

Query: 82  EGVF-AFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTL 140
           EG+   F++G  +PL+G  +  +  F       +F + +                 +N  
Sbjct: 63  EGIARGFFQGIASPLVGACLENATLFVSYNQCSKFLEKH-----------------TNVF 105

Query: 141 PLSQYYVCGLTGGVVNSFLASPIEQIRIRLQT---QTSNGGDREFKGPWDCIKKL---KA 194
           PL Q  + G   G   S + +P+E ++ +LQ    Q ++   +  K     IK +   + 
Sbjct: 106 PLGQILISGGVAGSCASLVLTPVELVKCKLQVANLQVASAKTKHTK-VLPTIKAIITERG 164

Query: 195 QGGLMRGLFPTMIRAGHG----LGTYFLVYEALVAREIGTGLTRNEIPPWKLCLFGAFSG 250
             GL +G   T IR   G      TY +V ++L  R       R+E   W+L + G  +G
Sbjct: 165 LAGLWQGQSGTFIRESFGGVAWFATYEIVKKSLKDRHSLDDPKRDESKIWELLISGGSAG 224

Query: 251 TMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAP 310
                +++P D VKS++Q + +       S++   K I+ K G++ F++G G T+ R+ P
Sbjct: 225 LAFNASIFPADTVKSVMQTEHI-------SLTNAVKKIFGKFGLKGFYRGLGITLFRAVP 277

Query: 311 VNGATFLTFE 320
            N A F  FE
Sbjct: 278 ANAAVFYIFE 287

>AGL311C [4001] [Homologous to ScYJR095W (SFC1) - SH]
           (119645..120733) [1089 bp, 362 aa]
          Length = 362

 Score = 87.8 bits (216), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 73/250 (29%), Positives = 116/250 (46%), Gaps = 24/250 (9%)

Query: 82  EGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTLP 141
           EG+ AFYKG    ++G+   ++++F   E    F++   A +      Q   +S  NT  
Sbjct: 111 EGLLAFYKGLGAVVIGIIPKMAIRFSSYE----FYRTLLADR------QTGVVSTGNT-- 158

Query: 142 LSQYYVCGLTGGVVNSFLA-SPIEQIRIRLQTQTSNGGDREFK-----GPWDCIKKLKAQ 195
               ++ G+  GV  + L  +P+E ++IRLQ Q  +G   + K          I K +  
Sbjct: 159 ----FLAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGI 214

Query: 196 GGLMRGLFPTMIRAGHGLGTYFLVYEALVAREIGTGLTRNEIPPWKLCLFGAFSGTMLWL 255
           G L RG+  T  R     G  F VY  L+ R      ++N +P W+  L G  SG +   
Sbjct: 215 GALYRGVSLTAARQATNQGANFTVYSKLMERLQEYHGSQN-LPSWETSLIGLVSGAIGPF 273

Query: 256 TVYPLDVVKSIIQND-DLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGA 314
           +  PLD +K+ +Q D   R       I+ + + +  +EG RA +KG  P ++R AP    
Sbjct: 274 SNAPLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAV 333

Query: 315 TFLTFELVMR 324
           TF  +E V R
Sbjct: 334 TFTVYEFVRR 343

 Score = 48.5 bits (114), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 54/194 (27%), Positives = 83/194 (42%), Gaps = 29/194 (14%)

Query: 147 VCGLTGGVVNSFLASPIEQIRIRLQT-QTSNGGDRE----------FKGPWDCIKKLKAQ 195
           V G T G+  +    P++ I++R+Q  + +N G +           + G    +   K  
Sbjct: 62  VAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGE-GLLAFYKGL 120

Query: 196 GGLMRGLFPTM-IRAGHGLGTYFLVYEALVAREIGTGLTRNEIPPWKLCLFGAFSG-TML 253
           G ++ G+ P M IR      +Y      L  R+ G   T N        L G  +G T  
Sbjct: 121 GAVVIGIIPKMAIR----FSSYEFYRTLLADRQTGVVSTGNTF------LAGVGAGVTEA 170

Query: 254 WLTVYPLDVVKSIIQNDDLR----KPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSA 309
            L V P++VVK  +Q   L     + KY+N+I   A  I  +EGI A ++G   T  R A
Sbjct: 171 VLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQ-AAYLIVKEEGIGALYRGVSLTAARQA 229

Query: 310 PVNGATFLTFELVM 323
              GA F  +  +M
Sbjct: 230 TNQGANFTVYSKLM 243

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 38/156 (24%), Positives = 59/156 (37%), Gaps = 18/156 (11%)

Query: 80  KNEGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNT 139
           K EG+ A Y+G               F V   +    Q Y+ S+N               
Sbjct: 210 KEEGIGALYRGVSLTAARQATNQGANFTVYSKLMERLQEYHGSQN--------------- 254

Query: 140 LPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQGG-- 197
           LP  +  + GL  G +  F  +P++ I+ RLQ   S      +       ++L  + G  
Sbjct: 255 LPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFR 314

Query: 198 -LMRGLFPTMIRAGHGLGTYFLVYEALVAREIGTGL 232
            L +G+ P ++R   G    F VYE +     G GL
Sbjct: 315 ALYKGITPRVMRVAPGQAVTFTVYEFVRRHLEGLGL 350

>YOR222W (ODC2) [5014] chr15 (758330..759253) 2-Oxodicarboxylate
           transporter, specific for 2-oxoadipate and
           2-oxoglutarate, member of the mitochondrial carrier
           family (MCF) of membrane transporters [924 bp, 307 aa]
          Length = 307

 Score = 84.7 bits (208), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 77/254 (30%), Positives = 119/254 (46%), Gaps = 37/254 (14%)

Query: 80  KNEGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNT 139
           K EG    Y+G  +P+L      + +F  N+  ++ F+N     N N ++Q + ++    
Sbjct: 71  KKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLF---NTNETTQKISIA---- 123

Query: 140 LPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKK-LKAQG-- 196
                    G + G+  + +  P E I+IR+Q   S+     + GP DC+KK +K +G  
Sbjct: 124 --------AGASAGMTEAAVIVPFELIKIRMQDVKSS-----YLGPMDCLKKTIKNEGIM 170

Query: 197 GLMRGLFPTMIRAGHGLGTYF-LVYEAL----VAREIGTGLTRNEIPPWKLCLFGAFSGT 251
           GL +G+  TM R     G YF ++Y+      VA+  G   TRN++      + GA  GT
Sbjct: 171 GLYKGIESTMWRNALWNGGYFGVIYQVRNSMPVAKTKGQK-TRNDL------IAGAIGGT 223

Query: 252 MLWLTVYPLDVVKSIIQNDDLRKPKYK--NSISYVAKTIYAKEGIRAFFKGFGPTMVRSA 309
           +  +   P DVVKS IQ+ D      K  N        IY +EG RA +KGF P + R A
Sbjct: 224 VGTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLA 283

Query: 310 PVNGATFLTFELVM 323
           P      + F  +M
Sbjct: 284 PGGSLMLVVFTGMM 297

 Score = 47.4 bits (111), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 50/195 (25%), Positives = 80/195 (41%), Gaps = 21/195 (10%)

Query: 135 SRSNTLPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQ------TQTSNGGDRE-FKGPWD 187
           S +  LP    ++ G   G+    +  P++ ++ R Q      T  + G   E + G  D
Sbjct: 5   SNAKPLPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVID 64

Query: 188 CIKKLKAQGG---LMRGLFPTMIRAGHGLGTYFLV---YEALVAREIGTGLTRNEIPPWK 241
           C+KK+  + G   L RG+   M+       T F     Y+ +      T  T  +I    
Sbjct: 65  CLKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKIS--- 121

Query: 242 LCLFGAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGF 301
               GA +G      + P +++K  +Q+    K  Y   +  + KTI   EGI   +KG 
Sbjct: 122 -IAAGASAGMTEAAVIVPFELIKIRMQD---VKSSYLGPMDCLKKTI-KNEGIMGLYKGI 176

Query: 302 GPTMVRSAPVNGATF 316
             TM R+A  NG  F
Sbjct: 177 ESTMWRNALWNGGYF 191

>ACR109W [1156] [Homologous to ScYOR222W (ODC2) - SH; ScYPL134C
           (ODC1) - SH] complement(546745..547644) [900 bp, 299 aa]
          Length = 299

 Score = 84.0 bits (206), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 87/307 (28%), Positives = 134/307 (43%), Gaps = 47/307 (15%)

Query: 35  LKDIFAGTIGGIAQVLVGQPFDXXXXXXXXXX------XXXXXXXXXXXXXKNEGVFAFY 88
           L   FAG + G++++LV  P D                               EGV   Y
Sbjct: 12  LYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLY 71

Query: 89  KGALTPLLGVGICVSVQFGVNEAMKRFF-QNYNASKNPNMSSQDVDLSRSNTLPLSQYYV 147
           KG  +P+L      + +F  N+  ++ + Q +   K          LS+    PLS   +
Sbjct: 72  KGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEK----------LSQ----PLSM--L 115

Query: 148 CGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQGGLM---RGLFP 204
            G + G V +F+  P E ++IRLQ  +S+     +KGP D ++K+ A+ G++    GL  
Sbjct: 116 AGASAGCVEAFVVVPFELVKIRLQDASSS-----YKGPVDVVRKIVAREGVLAMYNGLES 170

Query: 205 TMIRAGHGLGTYF-LVYEA---LVAREIGTGLTRNEIPPWKL-CLFGAFSGTMLWLTVYP 259
           T+ R     G YF ++++A   L A    T    N++    + C  G    T       P
Sbjct: 171 TLWRHALWNGGYFGIIFQARALLPAAHNKTQCITNDLISDSIGCSIGCMLST-------P 223

Query: 260 LDVVKSIIQNDDLRK---PKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATF 316
            DVVKS IQN  +      KY  S+  +  TIY +EG RA +KGF P ++R  P  G   
Sbjct: 224 FDVVKSRIQNTAVIPGVVRKYNWSLPSLL-TIYREEGFRALYKGFVPKVLRLGPGGGILL 282

Query: 317 LTFELVM 323
           + F  V+
Sbjct: 283 VVFTGVL 289

 Score = 58.9 bits (141), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 52/196 (26%), Positives = 83/196 (42%), Gaps = 19/196 (9%)

Query: 127 MSSQDVDLSRSNTLPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPW 186
           MSS D     + +LP    +  G   GV    +  P++ ++ R+Q Q   G    + G  
Sbjct: 1   MSSSD-----TKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVV 55

Query: 187 DCIKKLKAQGG---LMRGLFPTMIRAGHGLGTYFLV---YEALVAREIGTGLTRNEIPPW 240
           DC+KK+ A  G   L +G+   ++       T F     ++ L  +  G       +   
Sbjct: 56  DCLKKIVAGEGVGRLYKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLS-- 113

Query: 241 KLCLFGAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKG 300
              L GA +G +    V P ++VK  +Q+       YK  +  V K I A+EG+ A + G
Sbjct: 114 --MLAGASAGCVEAFVVVPFELVKIRLQDAS---SSYKGPVDVVRK-IVAREGVLAMYNG 167

Query: 301 FGPTMVRSAPVNGATF 316
              T+ R A  NG  F
Sbjct: 168 LESTLWRHALWNGGYF 183

>Scas_632.9
          Length = 292

 Score = 82.4 bits (202), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 80/316 (25%), Positives = 129/316 (40%), Gaps = 36/316 (11%)

Query: 18  QKVTTPNEKRELSSNRVLKDIFAGTIGGIAQVLVGQPFDXXXXXXXXXXXXX--XXXXXX 75
           + +  P EK   S    L DI  G+I G    ++  PFD                     
Sbjct: 3   ESIDHPIEKS--SVQNALSDIVNGSIAGAFGKIIEYPFDTVKVRLQTQGSHIFPTTWSCI 60

Query: 76  XXXXKNEGVF-AFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDL 134
                NEGV+  F++G  +PL G  +               F +YN   N       V  
Sbjct: 61  KYTYHNEGVWRGFFQGIGSPLFGAAL----------ENATLFVSYNQCSN-------VLE 103

Query: 135 SRSNTLPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQT---QTS-NGGDREFKGPWDCIK 190
             +N  PLS   + G   G   SF+ +P+E I+ +LQ    QT+  G  +  K     + 
Sbjct: 104 KFTNVSPLSNILLSGAFAGSCASFVLTPVELIKCKLQVSNLQTAVEGQIKHTKIIPTLMY 163

Query: 191 KLKAQG--GLMRGLFPTMIRAGHGLGTYFLVYEALVAREIGTGLTRNEIPPWKLCLFGAF 248
            L+ +G  GL +G   T IR   G   +F  YE +  + +       E   W+L + GA 
Sbjct: 164 VLREKGILGLWQGQSSTFIRESLGGVAWFATYEVM-KQGLKDRRKDTENKTWELLVSGAS 222

Query: 249 SGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRS 308
           +G     +++P D VKS++Q + +       ++    K +    GI  F++G G T++R+
Sbjct: 223 AGLAFNASIFPADTVKSMMQTEHI-------TLINAVKKVLTTYGITGFYRGLGITLIRA 275

Query: 309 APVNGATFLTFELVMR 324
            P N   F  +E + +
Sbjct: 276 VPANATVFYMYETLSK 291

>Kwal_26.8669
          Length = 296

 Score = 82.4 bits (202), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 82/302 (27%), Positives = 130/302 (43%), Gaps = 47/302 (15%)

Query: 40  AGTIGGIAQVLVGQPFDXXXXXXXXXXX------XXXXXXXXXXXXKNEGVFAFYKGALT 93
           AG + GI+++LV  P D                               EG    YKG  +
Sbjct: 15  AGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKGISS 74

Query: 94  PLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTLPLSQYYVCGLTGG 153
           P+L      + +F  N+  ++ ++     +          L++S ++      + G + G
Sbjct: 75  PVLMEAPKRATKFACNDEFQKIYKREFGVEK---------LTQSLSI------LSGASAG 119

Query: 154 VVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQGGLM---RGLFPTMIRAG 210
              +F+  P E ++IRLQ  +S+     +KGP D ++K+ AQ G++    GL  T+ R  
Sbjct: 120 CCEAFVVVPFELVKIRLQDVSSS-----YKGPIDVVRKIIAQEGVLAMYNGLESTLWR-- 172

Query: 211 HGL------GTYFLVYEALVAREIGTGLTRNEIPPWKLCLFGAFSGTMLWLTVYPLDVVK 264
           HG+      G  F V   L   +  +  TRN++      + G+  GT+  L   P DVVK
Sbjct: 173 HGVWNAGYFGIIFQVRALLPEAKSKSQQTRNDL------IAGSIGGTIGSLMSTPFDVVK 226

Query: 265 SIIQNDDLRK---PKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATFLTFEL 321
           S IQN  +      KY  S   +  TIY +EG RA +KGF P ++R  P  G   + F  
Sbjct: 227 SRIQNTAVVAGGARKYNWSWPSIF-TIYKEEGFRALYKGFVPKVLRLGPGGGILLVVFTG 285

Query: 322 VM 323
            M
Sbjct: 286 CM 287

 Score = 60.1 bits (144), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 49/189 (25%), Positives = 82/189 (43%), Gaps = 14/189 (7%)

Query: 134 LSRSNTLPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLK 193
           ++ +  LP    +  G   G+    +  P++ ++ R+Q Q S G   ++KG  DCIK++ 
Sbjct: 1   MTDARPLPFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIV 60

Query: 194 AQGG---LMRGLFPTMIRAGHGLGTYFLV---YEALVAREIGTGLTRNEIPPWKLCLFGA 247
           A+ G   L +G+   ++       T F     ++ +  RE G       +      L GA
Sbjct: 61  AKEGASRLYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLS----ILSGA 116

Query: 248 FSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVR 307
            +G      V P ++VK  +Q+       YK  I  V K I A+EG+ A + G   T+ R
Sbjct: 117 SAGCCEAFVVVPFELVKIRLQDVS---SSYKGPIDVVRKII-AQEGVLAMYNGLESTLWR 172

Query: 308 SAPVNGATF 316
               N   F
Sbjct: 173 HGVWNAGYF 181

>CAGL0K10362g complement(1009155..1010060) similar to sp|Q12375
           Saccharomyces cerevisiae YOR130c ARG11, start by
           similarity
          Length = 301

 Score = 82.0 bits (201), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 75/311 (24%), Positives = 124/311 (39%), Gaps = 45/311 (14%)

Query: 35  LKDIFAGTIGGIAQVLVGQPFDXXXXXXXXXXXXX--XXXXXXXXXXKNEGVF-AFYKGA 91
            +DI  G+I G    ++  PFD                         KNEG+   F++G 
Sbjct: 14  FRDILYGSIAGALGKVIEYPFDTVKVRLQTQGRHVFPDTWSCITYTYKNEGIIKGFFQGI 73

Query: 92  LTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTLPLSQYYVCGLT 151
            +PL G  I  +  F       +F Q+Y                 +N   L+   + G  
Sbjct: 74  ASPLAGAAIENAALFLSYNQCSKFLQHY-----------------TNVSDLTNILISGAF 116

Query: 152 GGVVNSFLASPIEQIRIRLQTQTSN-------GGDREFKGPWDCIKKLKA----QG--GL 198
            G   SF+ +P+E I+ +LQ            GG+   +     I  ++A    +G  GL
Sbjct: 117 AGSCASFVLTPVELIKCKLQVSNLQSLPLGVAGGNTVTERHTRIIPTIQAVIKNRGFIGL 176

Query: 199 MRGLFPTMIRAGHGLGTYFLVYEAL-----VAREIGTGLTRNEIPPWKLCLFGAFSGTML 253
            +G   T IR   G   +F  YE +         I      N+   W+L   GA +G   
Sbjct: 177 WQGQSGTFIRESFGGVAWFATYELMKKYLKSRHNIEDPSLPNDNKTWELLASGASAGLAF 236

Query: 254 WLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNG 313
             +++P D VKS++Q + L        +    K I+ ++G+R F++G G T++R+ P N 
Sbjct: 237 NASIFPADTVKSMMQTEHL-------GLKTAIKKIFVEKGLRGFYRGLGITLIRAIPANA 289

Query: 314 ATFLTFELVMR 324
             F  +E + +
Sbjct: 290 TVFYVYETLSK 300

>KLLA0D07073g 606857..607750 similar to sp|Q03028 Saccharomyces
           cerevisiae YPL134c ODC1, start by similarity
          Length = 297

 Score = 81.6 bits (200), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 81/301 (26%), Positives = 124/301 (41%), Gaps = 45/301 (14%)

Query: 40  AGTIGGIAQVLVGQPFDXXXXXXXXXXX------XXXXXXXXXXXXKNEGVFAFYKGALT 93
           AG + G++++LV  P D                               EG    YKG  +
Sbjct: 15  AGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLYKGISS 74

Query: 94  PLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTLPLSQYYVCGLTGG 153
           P+L      + +F  N+  ++ ++             D+  +   T PLS   + G + G
Sbjct: 75  PILMEAPKRATKFACNDEFQKIYK-------------DLFGAEKLTQPLS--ILSGASAG 119

Query: 154 VVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQGGLM---RGLFPTMIRAG 210
           +  SF+  P E ++IRLQ  +S     +F  P   +K +  + G++    GL  TM R  
Sbjct: 120 ICESFVVVPFELVKIRLQDVSS-----KFTSPIAVVKNIVEKEGILAMYNGLESTMWR-- 172

Query: 211 HGL------GTYFLVYEALVAREIGTGLTRNEIPPWKLCLFGAFSGTMLWLTVYPLDVVK 264
           HG+      G  F V   L      +  TRN++      L G   GT+  L   P DVVK
Sbjct: 173 HGIWNAGYFGIIFQVRALLPKASTKSEQTRNDL------LAGTVGGTLSSLLSTPFDVVK 226

Query: 265 SIIQNDDLRK--PKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATFLTFELV 322
           S +QN  +    P+  N       TIY +EG +A +KGF P ++R  P  G   + F  V
Sbjct: 227 SRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVFTGV 286

Query: 323 M 323
           M
Sbjct: 287 M 287

 Score = 58.5 bits (140), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 53/193 (27%), Positives = 86/193 (44%), Gaps = 22/193 (11%)

Query: 134 LSRSNTLPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLK 193
           +S    LP    ++ G   GV    +  P++ ++  +Q Q S G   ++KG +DC+K++ 
Sbjct: 1   MSDQKPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIA 60

Query: 194 AQGG---LMRGLFPTMIRAGHGLGTYFL-------VYEALVAREIGTGLTRNEIPPWKLC 243
           A+ G   L +G+   ++       T F        +Y+ L   E    LT+    P  + 
Sbjct: 61  AKEGPSRLYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGAE---KLTQ----PLSI- 112

Query: 244 LFGAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGP 303
           L GA +G      V P ++VK  +Q+      K+ + I+ V K I  KEGI A + G   
Sbjct: 113 LSGASAGICESFVVVPFELVKIRLQDVS---SKFTSPIA-VVKNIVEKEGILAMYNGLES 168

Query: 304 TMVRSAPVNGATF 316
           TM R    N   F
Sbjct: 169 TMWRHGIWNAGYF 181

>KLLA0F03212g 302915..303832 highly similar to sp|P33303
           Saccharomyces cerevisiae YJR095w ACR1 succinate-fumarate
           transporter, start by similarity
          Length = 305

 Score = 80.9 bits (198), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 70/253 (27%), Positives = 112/253 (44%), Gaps = 26/253 (10%)

Query: 80  KNEGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNT 139
           +NEG  AFYKG    ++G+   ++++F   E    F++   A K          +S  NT
Sbjct: 63  RNEGFLAFYKGLGAVVIGITPKMAIRFSSYE----FYRTLLADKETG------KVSTGNT 112

Query: 140 LPLSQYYVCGLTGGVVNSFLASPIEQI-RIRLQTQTSN---GGDREFKGPWDCIKKLKAQ 195
                 ++ G+  G+  + +     ++ +IRLQ Q  N   G  +       C   +K +
Sbjct: 113 ------FIAGVGAGITEAVVVVNPMEVVKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEE 166

Query: 196 G--GLMRGLFPTMIRAGHGLGTYFLVYEALVAREIGTGLTRNE-IPPWKLCLFGAFSGTM 252
           G   L RG+  T  R     G  F VY  L  +E   G    E +P W+  L G  SG +
Sbjct: 167 GFSALYRGVSLTAARQATNQGANFTVYSKL--KEFLQGYHNQEMLPSWETSLIGLISGAI 224

Query: 253 LWLTVYPLDVVKSIIQNDDLRKPKYK-NSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPV 311
              +  PLD +K+ +Q D   K       I+ + K +  +EG RA +KG  P ++R AP 
Sbjct: 225 GPFSNAPLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPG 284

Query: 312 NGATFLTFELVMR 324
              TF  +E + +
Sbjct: 285 QAVTFTAYEFIRK 297

 Score = 36.6 bits (83), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 36/85 (42%), Gaps = 16/85 (18%)

Query: 246 GAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKT---------IYAKEGIRA 296
           G  +G M  L  +PLD +K       +R   YKN++    K          IY  EG  A
Sbjct: 17  GGGAGLMEGLCCHPLDTIK-------VRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLA 69

Query: 297 FFKGFGPTMVRSAPVNGATFLTFEL 321
           F+KG G  ++   P     F ++E 
Sbjct: 70  FYKGLGAVVIGITPKMAIRFSSYEF 94

>ADL049W [1692] [Homologous to ScYPR021C - SH]
           complement(598135..600873) [2739 bp, 912 aa]
          Length = 912

 Score = 82.8 bits (203), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 88/351 (25%), Positives = 136/351 (38%), Gaps = 50/351 (14%)

Query: 1   MSEEFPTPQLLDELEDQQKVTTPN--------------EKRELSSNRVLKDIFA------ 40
           +S+E+    L   LED  K+  PN              E    SSN     IF       
Sbjct: 472 LSDEYVNEAL--TLEDIMKIVNPNYLNDLVHHMELRRIESESRSSNLYFYPIFDSIYNFT 529

Query: 41  -GTIGGIAQVLVGQPFDXXXXXXXXXXXXXXXXXXXXXXXK---NEGVFAFYKGALTPLL 96
            G++ G    +V  P D                       K    EGV   Y G    L+
Sbjct: 530 LGSVAGCIGAMVVYPIDMVKTRMQAQRDFSKYKNSIDCLLKILSKEGVRGLYSGLGPQLI 589

Query: 97  GVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTLPLSQYYVCGLTGGVVN 156
           GV    +++  VN+ M+             ++ +D  LS    LP     + G T G   
Sbjct: 590 GVAPEKAIKLTVNDHMR-----------ATLAGRDGKLS----LPCE--IISGATAGACQ 632

Query: 157 SFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQG--GLMRGLFPTMIRAGHGLG 214
               +P+E ++IRLQ ++    D   +   + I  +K  G  GL RG    ++R      
Sbjct: 633 VVFTNPLEIVKIRLQVKSDYVADAA-RNSVNAISVIKNLGLIGLYRGAGACLLRDIPFSA 691

Query: 215 TYFLVYEALVAREIG----TGLTRNEIPPWKLCLFGAFSGTMLWLTVYPLDVVKSIIQND 270
            YF  Y  + +            RN++  W+L + G  +G        P DV+K+ +Q D
Sbjct: 692 IYFPTYAHIKSNVFNFDPKDSDKRNKLNTWQLLVSGGLAGMPAAFLTTPFDVIKTRLQID 751

Query: 271 DLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATFLTFEL 321
             +     N I   A+TI  +EGI++FFKG    ++RS+P  G T   +E+
Sbjct: 752 PKKGESVYNGIWDAARTILKEEGIKSFFKGGPARVLRSSPQFGFTLAAYEI 802

>CAGL0M09020g complement(896312..897358) highly similar to sp|P33303
           Saccharomyces cerevisiae YJR095w succinate-fumarate
           transporter, start by similarity
          Length = 348

 Score = 80.9 bits (198), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 72/256 (28%), Positives = 112/256 (43%), Gaps = 30/256 (11%)

Query: 81  NEGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTL 140
            EG  A YKG    ++G+   ++++F   E    F++   A K   +      +S SNT 
Sbjct: 92  QEGFLALYKGLGAVVIGIIPKMAIRFSSYE----FYRTLLADKQTGV------VSTSNT- 140

Query: 141 PLSQYYVCGLTGGVVNSFLA-SPIEQIRIRLQTQTSNGGDREFKGPWD-------CIKKL 192
                ++ G+  GV  + L  +P+E ++IRLQ Q  N      K  +         I K 
Sbjct: 141 -----FIAGVGAGVTEAVLVVNPMEVVKIRLQAQHLNPNHDLAKPKYTNAVQAGYTIIKE 195

Query: 193 KAQGGLMRGLFPTMIRAGHGLGTYFLVYEALVAREIGTGLTRNE-IPPWKLCLFGAFSGT 251
           +    L RG+  T  R     G  F VY  L  RE        E +P W+    G  SG 
Sbjct: 196 EGISALYRGVSLTAARQATNQGANFTVYSKL--REFLQEYHGTETLPSWETSCIGLISGA 253

Query: 252 MLWLTVYPLDVVKSIIQNDDLRKPKYKNS---ISYVAKTIYAKEGIRAFFKGFGPTMVRS 308
           +   +  PLD +K+ +Q D     K ++    I+++   +  +EG RA +KG  P ++R 
Sbjct: 254 IGPFSNAPLDTIKTRLQKDKSTSFKGESGWKRIAHIGTQLLKEEGFRALYKGITPRVMRV 313

Query: 309 APVNGATFLTFELVMR 324
           AP    TF  +E V R
Sbjct: 314 APGQAVTFTVYEFVRR 329

>KLLA0E13453g complement(1184806..1187526) similar to sgd|S0006225
           Saccharomyces cerevisiae YPR021c, start by similarity
          Length = 906

 Score = 82.0 bits (201), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 65/249 (26%), Positives = 114/249 (45%), Gaps = 26/249 (10%)

Query: 80  KNEGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNT 139
           + +G+   Y G    L+GV    +++  VN+ M+++F N                 +S T
Sbjct: 553 QTKGIRGLYSGLGPQLIGVAPEKAIKLTVNDFMRQYFMN-----------------KSRT 595

Query: 140 LPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGD--REFKGPWDCIKKLKAQGG 197
           +   Q  + G T G       +P+E ++IRLQ ++   G+  R   G    I++L  +G 
Sbjct: 596 IKWYQEILSGATAGACQVVFTNPLEIVKIRLQMRSDYVGENARPQLGAVGIIRQLGLRG- 654

Query: 198 LMRGLFPTMIRAGHGLGTYFLVYEALVAREI-----GTGLTRNEIPPWKLCLFGAFSGTM 252
           L +G    ++R       YF  Y A + +++          RN++  W+L L G  +G  
Sbjct: 655 LYKGAAACLLRDVPFSAIYFPTY-AHLKKDVFNFDPNDKNKRNKLKTWELLLAGGIAGMP 713

Query: 253 LWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVN 312
                 P DV+K+ +Q D  +       + + A+TI  +E I++FFKG    ++RS+P  
Sbjct: 714 AAYLTTPFDVIKTRLQIDPRKGETTYTGVIHAARTILKEESIKSFFKGGPARVLRSSPQF 773

Query: 313 GATFLTFEL 321
           G T   FE+
Sbjct: 774 GFTLAAFEM 782

 Score = 44.7 bits (104), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 30/79 (37%), Positives = 43/79 (54%), Gaps = 3/79 (3%)

Query: 246 GAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTM 305
           G+ +G +    VYP+D+VK+ +Q       +YKNSI  V K I+  +GIR  + G GP +
Sbjct: 511 GSIAGCIGATVVYPIDLVKTRMQAQR-NSVQYKNSIDCVVK-IFQTKGIRGLYSGLGPQL 568

Query: 306 VRSAPVNGATFLTFELVMR 324
           +  AP   A  LT    MR
Sbjct: 569 IGVAP-EKAIKLTVNDFMR 586

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 42/178 (23%), Positives = 77/178 (43%), Gaps = 12/178 (6%)

Query: 146 YVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKL---KAQGGLMRGL 202
           +  G   G + + +  PI+ ++ R+Q Q ++    ++K   DC+ K+   K   GL  GL
Sbjct: 508 FTLGSIAGCIGATVVYPIDLVKTRMQAQRNSV---QYKNSIDCVVKIFQTKGIRGLYSGL 564

Query: 203 FPTMIRAGHGLGTYFLVYEALVAREIGTGLTRNEIPPWKLCLFGAFSGTMLWLTVYPLDV 262
            P +I           V + +  R+     +R  I  ++  L GA +G    +   PL++
Sbjct: 565 GPQLIGVAPEKAIKLTVNDFM--RQYFMNKSRT-IKWYQEILSGATAGACQVVFTNPLEI 621

Query: 263 VKSIIQ-NDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATFLTF 319
           VK  +Q   D      +  +  V   I  + G+R  +KG    ++R  P +   F T+
Sbjct: 622 VKIRLQMRSDYVGENARPQLGAVG--IIRQLGLRGLYKGAAACLLRDVPFSAIYFPTY 677

>Kwal_23.4731
          Length = 314

 Score = 78.6 bits (192), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 63/240 (26%), Positives = 110/240 (45%), Gaps = 13/240 (5%)

Query: 88  YKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNAS--KNPNMSSQDVDLSRSNTLPLSQY 145
           Y+G    L+G  I   + FG+    K     Y  +  K P  SS   D +   +L L+  
Sbjct: 75  YRGLGVNLIGNSIAWGLYFGLYRFTKDMVYRYGVAQMKTPTQSSFQKDKAMGPSLYLASA 134

Query: 146 YVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQ---GGLMRGL 202
            + GL   +    L +PI  I+ R+ + +S   +R +K  WD I+K+ A     G  RGL
Sbjct: 135 ALSGLGTAI----LTNPIWVIKTRIMSTSSQASER-YKTTWDGIRKVYAHEGFSGFWRGL 189

Query: 203 FPTMIRAGHGLGTYFLVYEALVAREIGT-GLTRNE-IPPWKLCLFGAFSGTMLWLTVYPL 260
            P++     G   YF +Y++L  +     G+T +E +   +     + S  +    VYP 
Sbjct: 190 VPSLFGVAQG-AIYFTIYDSLRHQYFARRGITEDEKMGNLENIAITSVSKMLSVTAVYPF 248

Query: 261 DVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATFLTFE 320
            ++KS +Q+    + +       + K+I+ KEG++  +KG    ++R+ P    TF  +E
Sbjct: 249 QLLKSNLQSFAAVEKRDSYRFWNLVKSIHQKEGLQGLYKGLSANLLRAIPSTCITFCIYE 308

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 50/209 (23%), Positives = 83/209 (39%), Gaps = 27/209 (12%)

Query: 137 SNTLPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQ----TQTSNGGDREFKGPWDCIKKL 192
           S+  PL +  + GL  G + +    P++ +++RLQ    T  S+G     K     I+  
Sbjct: 8   SDFTPLQREIIAGLAAGTLTTIATHPLDLVKLRLQLLVNTTHSHGYKEVIK---TIIRDS 64

Query: 193 KAQGGLM----RGLFPTMIRAGHGLGTYFLVYEALVAREIGTGLTRNEIP---------- 238
           KA   +     RGL   +I      G YF +Y          G+ + + P          
Sbjct: 65  KADSNVFREAYRGLGVNLIGNSIAWGLYFGLYRFTKDMVYRYGVAQMKTPTQSSFQKDKA 124

Query: 239 --PWKLCLFGAFSGTMLWLTVYPLDVVKS-IIQNDDLRKPKYKNSISYVAKTIYAKEGIR 295
             P       A SG    +   P+ V+K+ I+        +YK +   + K +YA EG  
Sbjct: 125 MGPSLYLASAALSGLGTAILTNPIWVIKTRIMSTSSQASERYKTTWDGIRK-VYAHEGFS 183

Query: 296 AFFKGFGPTMVRSAPVNGATFLTFELVMR 324
            F++G  P++   A   GA + T    +R
Sbjct: 184 GFWRGLVPSLFGVA--QGAIYFTIYDSLR 210

>YPR021C (AGC1) [5455] chr16 complement(600644..603352) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [2709 bp, 902 aa]
          Length = 902

 Score = 79.7 bits (195), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 64/246 (26%), Positives = 103/246 (41%), Gaps = 23/246 (9%)

Query: 82  EGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTLP 141
           EG+   Y G    L+GV    +++  VN+ M+    + N                   L 
Sbjct: 581 EGIKGLYSGLGPQLIGVAPEKAIKLTVNDFMRNRLTDKNGK-----------------LS 623

Query: 142 LSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQG--GLM 199
           L    + G + G       +P+E ++IRLQ Q+   G+   +      + +K  G  GL 
Sbjct: 624 LFPEIISGASAGACQVIFTNPLEIVKIRLQVQSDYVGENIQQANETATQIVKKLGLRGLY 683

Query: 200 RGLFPTMIRAGHGLGTYFLVY----EALVAREIGTGLTRNEIPPWKLCLFGAFSGTMLWL 255
            G+   ++R       YF  Y    + L   +      RN +  W+L   GA +G     
Sbjct: 684 NGVAACLMRDVPFSAIYFPTYAHLKKDLFDFDPNDKTKRNRLKTWELLTAGAIAGMPAAF 743

Query: 256 TVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGAT 315
              P DV+K+ +Q D  +     N I +  +TI  +E  R+FFKG G  ++RS+P  G T
Sbjct: 744 LTTPFDVIKTRLQIDPRKGETKYNGIFHAIRTILKEESFRSFFKGGGARVLRSSPQFGFT 803

Query: 316 FLTFEL 321
              +EL
Sbjct: 804 LAAYEL 809

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 47/186 (25%), Positives = 78/186 (41%), Gaps = 27/186 (14%)

Query: 146 YVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQGGLMRGLFPT 205
           +  G   G + + +  PI+ I+ R+Q Q S     ++K   DC+ K+ ++ G+ +GL+  
Sbjct: 534 FSLGSIAGCIGATVVYPIDFIKTRMQAQRSLA---QYKNSIDCLLKIISREGI-KGLYS- 588

Query: 206 MIRAGHGLGTYFLVYEALVAREIGTGLTRNEI-------PPWKLCLF-----GAFSGTML 253
                 GLG   +     VA E    LT N+           KL LF     GA +G   
Sbjct: 589 ------GLGPQLIG----VAPEKAIKLTVNDFMRNRLTDKNGKLSLFPEIISGASAGACQ 638

Query: 254 WLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNG 313
            +   PL++VK  +Q       +     +  A  I  K G+R  + G    ++R  P + 
Sbjct: 639 VIFTNPLEIVKIRLQVQSDYVGENIQQANETATQIVKKLGLRGLYNGVAACLMRDVPFSA 698

Query: 314 ATFLTF 319
             F T+
Sbjct: 699 IYFPTY 704

>AFR146W [3338] [Homologous to ScYOR130C (ORT1) - SH]
           complement(702404..703249) [846 bp, 281 aa]
          Length = 281

 Score = 76.3 bits (186), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 77/304 (25%), Positives = 123/304 (40%), Gaps = 46/304 (15%)

Query: 31  SNRVLKDIFAGTIGGIAQVLVGQPFDXXXXXXXXXXXXX--XXXXXXXXXXKNEGVF-AF 87
           +++  KD+  G + G    LV  PFD                         K EG++  F
Sbjct: 5   ADKAYKDLLYGGVAGSLGKLVEYPFDTVKVRLQTQSAALFPTTWSCVSHTYKQEGLWRGF 64

Query: 88  YKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTLPLSQYYV 147
           Y+G  +P+ G  +  +V           F ++N        +Q V  +  +  PL +   
Sbjct: 65  YQGMASPVFGAFLEHAV----------LFVSFN-------RAQAVLENCYSCGPLEKVVF 107

Query: 148 CGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGP--------WDCIKKLKAQGGLM 199
            G   G   S++ +P+E ++ +LQ     G      GP           I K    GGL 
Sbjct: 108 AGAIAGACTSYVLTPVELVKCKLQVSNLTG----VSGPRYTAVLPTLRAIVKQNGLGGLW 163

Query: 200 RGLFPTMIRAGHGLGTYFLVYEAL---VAREIGTGLTRNEIPPWKLCLFGAFSGTMLWLT 256
           +G   T IR   G   +F  YE L   +AR  G+  T N +  W+L   GA +G     +
Sbjct: 164 QGQSGTFIRESAGGAVWFTAYEVLKGWLARRRGS--TENTV--WELLASGAGAGAAFHAS 219

Query: 257 VYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATF 316
           ++P D VKS +Q + L        +    +T+  K G   F++G G T++R+ P N   F
Sbjct: 220 IFPADTVKSTMQTEHL-------GLGPAVRTVLKKHGPTGFYRGVGITLLRALPANAVIF 272

Query: 317 LTFE 320
             +E
Sbjct: 273 YVYE 276

>CAGL0J02002g 198226..199311 similar to sp|P40556 Saccharomyces
           cerevisiae YIL006w or sp|P39953 Saccharomyces cerevisiae
           YEL006w, hypothetical start
          Length = 361

 Score = 76.6 bits (187), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 64/252 (25%), Positives = 114/252 (45%), Gaps = 29/252 (11%)

Query: 80  KNEGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNT 139
           ++EGV   YKG +  ++G      + F V E  K                 D   + S+ 
Sbjct: 123 RDEGVRGLYKGLVPIIMGYFPTWMIYFSVYEFCK-----------------DNLRTNSSN 165

Query: 140 LPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDR-EFKGPWDCIKKLKAQGG- 197
                +    +T G V++ + +PI  ++ RL  QT  G +   ++G +D  KK+  Q G 
Sbjct: 166 WSFVSHSFSAITAGAVSTVVTNPIWVVKTRLMLQTHIGSNTTHYQGTYDAFKKIINQEGV 225

Query: 198 --LMRGLFPTMIRAGHGLGTYFLVYEALVAR----EIGTGLTRNEIPPWKLCLFGAFSGT 251
             L  GL P+++   H +  +F VYE L       +       ++I   +L L  + S  
Sbjct: 226 KALYAGLVPSLLGLLH-VAIHFPVYERLKVSFKCYQRDESSNESKINLKRLILASSVSKM 284

Query: 252 MLWLTVYPLDVVKSIIQ-NDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAP 310
           +  +  YP +++++ +Q   DL  P ++  +  + K  Y +EGI  F+ GFG  + R+ P
Sbjct: 285 VASVLSYPHEILRTRLQLKSDL--PSHQRRLIPLIKITYIQEGIFGFYSGFGTNLFRTLP 342

Query: 311 VNGATFLTFELV 322
            +  T ++FE V
Sbjct: 343 ASAITLVSFEYV 354

 Score = 35.8 bits (81), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 38/81 (46%), Gaps = 6/81 (7%)

Query: 246 GAFSGTMLWLTVYPLDVVKSIIQNDDLRKPK-----YKNSISYVAKTIYAKEGIRAFFKG 300
           GA +G +  + V PLDV K+ +Q   L+        Y+ SI  +  TI   EG+R  +KG
Sbjct: 75  GALAGLLSGIVVCPLDVAKTRLQAQGLQTRTTENLYYRGSIGTMT-TIVRDEGVRGLYKG 133

Query: 301 FGPTMVRSAPVNGATFLTFEL 321
             P ++   P     F  +E 
Sbjct: 134 LVPIIMGYFPTWMIYFSVYEF 154

 Score = 32.7 bits (73), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 39/171 (22%), Positives = 67/171 (39%), Gaps = 17/171 (9%)

Query: 147 VCGLTGGVVNSFLASPIEQIRIRLQTQ------TSNGGDREFKGPWDCIKKLKAQGGLMR 200
           + G   G+++  +  P++  + RLQ Q      T N   R   G    I + +   GL +
Sbjct: 73  ISGALAGLLSGIVVCPLDVAKTRLQAQGLQTRTTENLYYRGSIGTMTTIVRDEGVRGLYK 132

Query: 201 GLFPTMIRAGHGLGTYFLVYEALVAREIGTGLTRNEIPPWKLC--LFGAFS-GTMLWLTV 257
           GL P ++        YF VY      E      R     W      F A + G +  +  
Sbjct: 133 GLVPIIMGYFPTWMIYFSVY------EFCKDNLRTNSSNWSFVSHSFSAITAGAVSTVVT 186

Query: 258 YPLDVVKS--IIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMV 306
            P+ VVK+  ++Q        +        K I  +EG++A + G  P+++
Sbjct: 187 NPIWVVKTRLMLQTHIGSNTTHYQGTYDAFKKIINQEGVKALYAGLVPSLL 237

>YJR095W (SFC1) [2987] chr10 (609690..610658) Mitochondrial membrane
           succinate-fumarate transporter, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [969 bp, 322 aa]
          Length = 322

 Score = 75.9 bits (185), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 70/255 (27%), Positives = 108/255 (42%), Gaps = 30/255 (11%)

Query: 80  KNEGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNT 139
           + EG  A YKG     LG     +V  G+   M   F +Y   +   ++ +   +S  NT
Sbjct: 64  QKEGFLALYKG-----LG-----AVVIGIIPKMAIRFSSYEFYRTLLVNKESGIVSTGNT 113

Query: 140 LPLSQYYVCGLTGGVVNSFLA-SPIEQIRIRLQTQ-----TSNGGDREFKGPWDCIKKLK 193
                 +V G+  G+  + L  +P+E ++IRLQ Q       N G +           +K
Sbjct: 114 ------FVAGVGAGITEAVLVVNPMEVVKIRLQAQHLTPSEPNAGPKYNNAIHAAYTIVK 167

Query: 194 AQG--GLMRGLFPTMIRAGHGLGTYFLVYEALVAREIGTGLTRNEI-PPWKLCLFGAFSG 250
            +G   L RG+  T  R     G  F VY  L  +E      + ++ P W+    G  SG
Sbjct: 168 EEGVSALYRGVSLTAARQATNQGANFTVYSKL--KEFLQNYHQMDVLPSWETSCIGLISG 225

Query: 251 TMLWLTVYPLDVVKSIIQND---DLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVR 307
            +   +  PLD +K+ +Q D    L K      I  +   +  +EG RA +KG  P ++R
Sbjct: 226 AIGPFSNAPLDTIKTRLQKDKSISLEKQSGMKKIITIGAQLLKEEGFRALYKGITPRVMR 285

Query: 308 SAPVNGATFLTFELV 322
            AP    TF  +E V
Sbjct: 286 VAPGQAVTFTVYEYV 300

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 53/193 (27%), Positives = 79/193 (40%), Gaps = 31/193 (16%)

Query: 147 VCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGP------------WDCIKKLKA 194
           + G T G+  +    P++ I++R+Q      G    K P               +   K 
Sbjct: 15  MAGGTAGLFEALCCHPLDTIKVRMQIYRRVAGIEHVKPPGFIKTGRTIYQKEGFLALYKG 74

Query: 195 QGGLMRGLFPTM-IRAGHGLGTYFLVYEALVAREIGTGLTRNEIPPWKLCLFGAFSG-TM 252
            G ++ G+ P M IR      +Y      LV +E G   T N        + G  +G T 
Sbjct: 75  LGAVVIGIIPKMAIR----FSSYEFYRTLLVNKESGIVSTGNTF------VAGVGAGITE 124

Query: 253 LWLTVYPLDVVKSIIQNDDLRK------PKYKNSISYVAKTIYAKEGIRAFFKGFGPTMV 306
             L V P++VVK  +Q   L        PKY N+I + A TI  +EG+ A ++G   T  
Sbjct: 125 AVLVVNPMEVVKIRLQAQHLTPSEPNAGPKYNNAI-HAAYTIVKEEGVSALYRGVSLTAA 183

Query: 307 RSAPVNGATFLTF 319
           R A   GA F  +
Sbjct: 184 RQATNQGANFTVY 196

 Score = 34.3 bits (77), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 38/85 (44%), Gaps = 11/85 (12%)

Query: 244 LFGAFSGTMLWLTVYPLDVVKSIIQN-------DDLRKPKYKNSISYVAKTIYAKEGIRA 296
           + G  +G    L  +PLD +K  +Q        + ++ P +  +     +TIY KEG  A
Sbjct: 15  MAGGTAGLFEALCCHPLDTIKVRMQIYRRVAGIEHVKPPGFIKT----GRTIYQKEGFLA 70

Query: 297 FFKGFGPTMVRSAPVNGATFLTFEL 321
            +KG G  ++   P     F ++E 
Sbjct: 71  LYKGLGAVVIGIIPKMAIRFSSYEF 95

>Scas_640.25
          Length = 306

 Score = 75.9 bits (185), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 88/309 (28%), Positives = 129/309 (41%), Gaps = 56/309 (18%)

Query: 40  AGTIGGIAQVLVGQPFDXXXXXXXXXXXXXXXXXXXXX----------XXKNEGVFAFYK 89
           AG I GI++++V  P D                                 K EG    YK
Sbjct: 19  AGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMHMYK 78

Query: 90  GALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTLPLSQYYVCG 149
           G  +P+L      +V+F  N+   + +++   +K   ++ Q   LS             G
Sbjct: 79  GISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQ--LTQQISVLS-------------G 123

Query: 150 LTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQGGLMRGLFP----T 205
            + G+  + +  P E ++IRLQ   S     +FKGP + +K +  Q GL +GL+     T
Sbjct: 124 ASAGITEALVIVPFELVKIRLQDVNS-----KFKGPVEVLKHIIKQDGL-KGLYSGVEST 177

Query: 206 MIR-----AGHGLGTYFLVYEALVAREIGTGLTRNEIPPWKLCLFGAFSGTMLWLTVYPL 260
           + R     AG+  G  F V E L   +     TRN+     LC  G   GT   +   P 
Sbjct: 178 VWRNAVWNAGY-FGVIFQVRELLPVAKSKQEKTRND-----LCA-GFVGGTFGVMFNTPF 230

Query: 261 DVVKSIIQNDD------LRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGA 314
           DVVKS IQ+D       +RK  Y  +   V K IY +EG RA +KGF P ++R  P    
Sbjct: 231 DVVKSRIQSDGNEIINGVRK--YNWTWPSVMK-IYHEEGFRALYKGFVPKVLRLGPGGAV 287

Query: 315 TFLTFELVM 323
             + F  VM
Sbjct: 288 LLVVFTNVM 296

 Score = 47.0 bits (110), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 46/195 (23%), Positives = 82/195 (42%), Gaps = 21/195 (10%)

Query: 135 SRSNT---LPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGG----DREFKGPWD 187
           S  NT   LP    ++ G   G+    +  P++ ++ R+Q Q S G        +KG  D
Sbjct: 3   SNHNTQAPLPFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVID 62

Query: 188 CIKKLKAQGGLM---RGLFPTMIRAGHGLGTYFLVYEALV---AREIGTGLTRNEIPPWK 241
           C+ ++  + G M   +G+   M+         F   +  +       GT     +I    
Sbjct: 63  CLSQIVKKEGPMHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQIS--- 119

Query: 242 LCLFGAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGF 301
             L GA +G    L + P ++VK  +Q+ +    K+K  +  V K I  ++G++  + G 
Sbjct: 120 -VLSGASAGITEALVIVPFELVKIRLQDVN---SKFKGPVE-VLKHIIKQDGLKGLYSGV 174

Query: 302 GPTMVRSAPVNGATF 316
             T+ R+A  N   F
Sbjct: 175 ESTVWRNAVWNAGYF 189

>Sklu_2334.2 YJR095W, Contig c2334 6303-7262 reverse complement
          Length = 319

 Score = 75.5 bits (184), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 70/250 (28%), Positives = 104/250 (41%), Gaps = 25/250 (10%)

Query: 81  NEGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTL 140
            EG+ A YKG     LG     +V  G+   M   F +Y   ++     Q   +S  NT 
Sbjct: 64  EEGLLALYKG-----LG-----AVVIGIIPKMAIRFSSYEFYRSALADKQTGSVSTGNT- 112

Query: 141 PLSQYYVCGLTGGVVNSFLA-SPIEQIRIRLQTQT----SNGGDREFKGPWDC--IKKLK 193
                ++ G+  G   + L  +P+E ++IRLQ Q     +    R       C  I K +
Sbjct: 113 -----FLAGVGAGTTEAVLVVNPMEVVKIRLQAQHLHPETAASPRYRNALQACYLIVKEE 167

Query: 194 AQGGLMRGLFPTMIRAGHGLGTYFLVYEALVAREIGTGLTRNEIPPWKLCLFGAFSGTML 253
             G L RG+  T  R     G  F VY  L    +      + +P W+    G  SG + 
Sbjct: 168 GIGALYRGVSLTAARQATNQGANFTVYSKL-KEFLQEHHKTDALPSWETSCIGLISGAIG 226

Query: 254 WLTVYPLDVVKSIIQNDDLRKPKYKNS-ISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVN 312
             +  PLD +K+ +Q D         S I  + K +  +EG RA +KG  P ++R AP  
Sbjct: 227 PFSNAPLDTIKTRLQKDKSTANMSGWSRIVTIGKQLIKEEGFRALYKGITPRVMRVAPGQ 286

Query: 313 GATFLTFELV 322
             TF  +E V
Sbjct: 287 AVTFTVYEFV 296

 Score = 47.4 bits (111), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 48/191 (25%), Positives = 78/191 (40%), Gaps = 29/191 (15%)

Query: 147 VCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGD-----------REFKGPWDCIKKLKAQ 195
           + G T G+  +    P++ I++R+Q    +  +           R        +   K  
Sbjct: 15  IAGGTAGLFEALCCHPLDTIKVRMQIYRRSALEGIKPPGFIKTGRNIYTEEGLLALYKGL 74

Query: 196 GGLMRGLFPTM-IRAGHGLGTYFLVYEALVAREIGTGLTRNEIPPWKLCLFGAFSGTM-L 253
           G ++ G+ P M IR      +Y     AL  ++ G+  T N        L G  +GT   
Sbjct: 75  GAVVIGIIPKMAIR----FSSYEFYRSALADKQTGSVSTGNTF------LAGVGAGTTEA 124

Query: 254 WLTVYPLDVVKSIIQNDDLR-----KPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRS 308
            L V P++VVK  +Q   L       P+Y+N++      I  +EGI A ++G   T  R 
Sbjct: 125 VLVVNPMEVVKIRLQAQHLHPETAASPRYRNALQ-ACYLIVKEEGIGALYRGVSLTAARQ 183

Query: 309 APVNGATFLTF 319
           A   GA F  +
Sbjct: 184 ATNQGANFTVY 194

 Score = 32.0 bits (71), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 20/84 (23%), Positives = 38/84 (45%), Gaps = 10/84 (11%)

Query: 244 LFGAFSGTMLWLTVYPLDVVKSIIQN------DDLRKPKYKNSISYVAKTIYAKEGIRAF 297
           + G  +G    L  +PLD +K  +Q       + ++ P +  +     + IY +EG+ A 
Sbjct: 15  IAGGTAGLFEALCCHPLDTIKVRMQIYRRSALEGIKPPGFIKT----GRNIYTEEGLLAL 70

Query: 298 FKGFGPTMVRSAPVNGATFLTFEL 321
           +KG G  ++   P     F ++E 
Sbjct: 71  YKGLGAVVIGIIPKMAIRFSSYEF 94

>Sklu_2037.2 YIL134W, Contig c2037 1645-2577 reverse complement
          Length = 310

 Score = 74.7 bits (182), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 64/247 (25%), Positives = 111/247 (44%), Gaps = 25/247 (10%)

Query: 88  YKGALTPLLGVGICVSVQFGVNEAMKRF-FQ--NYNASKNPNMSSQDVDLSRSNTLPLSQ 144
           Y+G    LLG  +   + FG+  A K + FQ  N +  +  N  + D +++         
Sbjct: 69  YRGLGVNLLGNSVAWGLYFGLYRASKDWVFQWCNTDVKRFNNTMNNDKEMTSL------M 122

Query: 145 YYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKL---KAQGGLMRG 201
           Y +     GV  S L +PI  I+ R+ + TS    R ++   D IKKL   +   G  RG
Sbjct: 123 YLLAAAMSGVATSVLTNPIWVIKTRIMS-TSFVDSRSYRSTVDGIKKLYRIEGLAGFWRG 181

Query: 202 LFPTMIRAGHGLGTYFLVYEAL-----VAREIGTGLTRNEIPPWKLCLFGAFSGTMLWLT 256
           L P++     G   YF VY+ L      A+ +     + ++   +     + S  +    
Sbjct: 182 LVPSLFGVSQG-AIYFTVYDTLKYHYFAAKHVDK---KKKLSNLEYITITSLSKMVSVTA 237

Query: 257 VYPLDVVKSIIQNDDLR---KPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNG 313
           VYPL ++KS +Q+ ++     PK  + +  +  TIY ++G+   +KG    ++R+ P   
Sbjct: 238 VYPLQLLKSNLQSFEVSTVINPKTSHRVWKLITTIYVRDGVTGLYKGLLANLIRAVPSTC 297

Query: 314 ATFLTFE 320
            TF  +E
Sbjct: 298 ITFCVYE 304

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 41/184 (22%), Positives = 82/184 (44%), Gaps = 23/184 (12%)

Query: 141 PLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQGG--- 197
           P+ +  + GLT G + +    P++ +++RLQ   +N   ++ +G +D +K++        
Sbjct: 7   PVQKEMISGLTAGTITTVSTHPLDLVKVRLQLLATN---KKPQGYYDVVKRIVKDSKQHS 63

Query: 198 ----LMRGLFPTMIRAGHGLGTYFLVYEA---LVAREIGTGLTR--------NEIPPWKL 242
                 RGL   ++      G YF +Y A    V +   T + R         E+     
Sbjct: 64  FFRETYRGLGVNLLGNSVAWGLYFGLYRASKDWVFQWCNTDVKRFNNTMNNDKEMTSLMY 123

Query: 243 CLFGAFSGTMLWLTVYPLDVVKSIIQNDDLRKPK-YKNSISYVAKTIYAKEGIRAFFKGF 301
            L  A SG    +   P+ V+K+ I +      + Y++++  + K +Y  EG+  F++G 
Sbjct: 124 LLAAAMSGVATSVLTNPIWVIKTRIMSTSFVDSRSYRSTVDGIKK-LYRIEGLAGFWRGL 182

Query: 302 GPTM 305
            P++
Sbjct: 183 VPSL 186

>CAGL0H10538g 1027739..1028632 highly similar to tr|Q07534
           Saccharomyces cerevisiae YDL119c, hypothetical start
          Length = 297

 Score = 73.9 bits (180), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 60/190 (31%), Positives = 97/190 (51%), Gaps = 26/190 (13%)

Query: 145 YYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQGGLMRGLFP 204
           + + G  GG+ ++    P++ ++ R Q QT  G        W  +K L     L RG  P
Sbjct: 7   HLIGGFAGGLSSAVALQPLDLLKTRFQ-QTKGGT------LWQTVKSLDTPWQLWRGTLP 59

Query: 205 TMIRAGHGLGTYF----LVYEALVARE-------IGTGLTRN--EIPPWKLCLFGAFS-G 250
           + IR   G   Y     L+  AL  R+       + TG + N  ++  ++  + GAF+ G
Sbjct: 60  SAIRTSVGSALYLSSLNLMRTALAKRKQFDTADSVVTGKSSNLPQLSMYENLVTGAFARG 119

Query: 251 TMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAP 310
           T+ ++T+ P+ ++K   ++       YK SI+  AK+I A+EGIR FF+GFGPT +R AP
Sbjct: 120 TVGYITM-PITIIKVRYESTLY---NYK-SIAEAAKSIAAQEGIRGFFRGFGPTCLRDAP 174

Query: 311 VNGATFLTFE 320
            +G   L +E
Sbjct: 175 YSGLYVLLYE 184

 Score = 35.0 bits (79), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 50/215 (23%), Positives = 86/215 (40%), Gaps = 28/215 (13%)

Query: 128 SSQDVDLSRSNTLPLSQYYVCGLTGGVVNS---FLASPIEQIRIRLQTQTSNGGDREFKG 184
           ++  V   +S+ LP    Y   +TG        ++  PI  I++R ++   N     +K 
Sbjct: 90  TADSVVTGKSSNLPQLSMYENLVTGAFARGTVGYITMPITIIKVRYESTLYN-----YKS 144

Query: 185 PWDCIKKLKAQGGL---MRGLFPTMIRAGHGLGTYFLVYEALVAREIGTGLTRNEIPPWK 241
             +  K + AQ G+    RG  PT +R     G Y L+YE L    + T L ++ +    
Sbjct: 145 IAEAAKSIAAQEGIRGFFRGFGPTCLRDAPYSGLYVLLYEKL-KHTLPTILPKSLLQLDS 203

Query: 242 LCLFGAFSGT------------MLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIY 289
              + A++ T            M      P D +K+ +Q   L   K+K   S +  TI 
Sbjct: 204 EGRYTAYTSTAINSTSAILSASMATTVTAPFDTIKTRMQ---LEPTKFKTFWSTLT-TIV 259

Query: 290 AKEGIRAFFKGFGPTMVRSAPVNGATFLTFELVMR 324
            +E     F G    + R A   G  +  +E +++
Sbjct: 260 TQEHPIKIFSGLSMRLTRKALSAGIAWGIYEELIK 294

>KLLA0C11363g complement(975442..976995) similar to sp|P48233
           Saccharomyces cerevisiae YNL083w singleton, start by
           similarity
          Length = 517

 Score = 75.1 bits (183), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 69/256 (26%), Positives = 115/256 (44%), Gaps = 29/256 (11%)

Query: 83  GVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTLPL 142
           G+ AFY G    ++ V    +++FG  E  KR        K+ +      +LSR +T   
Sbjct: 272 GLRAFYVGNGLNVVKVFPESAIKFGSFEMAKRIMARLENVKDTS------ELSRLST--- 322

Query: 143 SQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQGGL---- 198
              Y+ G  GGV   F   PI+ ++ R+Q    N   ++        K++  QGG+    
Sbjct: 323 ---YIAGGLGGVAAQFSVYPIDTLKYRIQCAPLNTNLKKSSILLQTAKEMYQQGGIRLFY 379

Query: 199 ------MRGLFPTMIRAGHGLGTYFLVYEALVAREIG-TGLTRNEIPPWKLCLF--GAFS 249
                 + G+FP    A   LGT+  + +  + +E   TGL  +E+    L +   GAFS
Sbjct: 380 RGVHIGVMGIFPY---AALDLGTFSALKKWYIKKEAKKTGLPEDEVIISNLIVLPMGAFS 436

Query: 250 GTMLWLTVYPLDVVKSIIQND-DLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRS 308
           GT+    VYP++++++ +Q       P   N  S V K    +EG +  FKG  P + + 
Sbjct: 437 GTVGATLVYPINLLRTRLQAQGTYAHPHTYNGFSDVLKKTIQREGYQGLFKGLVPNLAKV 496

Query: 309 APVNGATFLTFELVMR 324
            P    ++L +E + R
Sbjct: 497 CPAVSISYLCYENLKR 512

 Score = 33.9 bits (76), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 31/56 (55%), Gaps = 2/56 (3%)

Query: 269 NDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATFLTFELVMR 324
           N DL   K K+ +   A T+Y + G+RAF+ G G  +V+  P +   F +FE+  R
Sbjct: 250 NADL--SKIKSPLIKAATTLYRQGGLRAFYVGNGLNVVKVFPESAIKFGSFEMAKR 303

>Scas_709.9
          Length = 365

 Score = 74.7 bits (182), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 66/252 (26%), Positives = 111/252 (44%), Gaps = 32/252 (12%)

Query: 81  NEGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTL 140
           +EGV   YKG +  +LG      + F V E  K  +        P +      +S S   
Sbjct: 118 DEGVRGLYKGLIPIILGYFPTWMIYFSVYEFAKDLY--------PRVLPNSDFISHS--- 166

Query: 141 PLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDR-EFKGPWDCIKKLKAQGG-- 197
                    +T G  ++ L +PI  ++ RL  QT  G  R  ++G  D  KK+  Q G  
Sbjct: 167 ------CSAITAGAASTVLTNPIWVVKTRLMLQTPLGESRTHYRGTIDAFKKIITQEGVR 220

Query: 198 -LMRGLFPTMIRAGHGLGTYFLVYEALVAREIGTGLT------RNEIPPWKLCLFGAFSG 250
            L  GL P+M    H +  +F VYE L  R     +T       + +   +L +  + S 
Sbjct: 221 TLYTGLVPSMFGLLH-VAIHFPVYEKLKNRLHCDTITGGHNSQEHSLHLTRLIIASSASK 279

Query: 251 TMLWLTVYPLDVVKSIIQ--NDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRS 308
            +  +  YP +++++ +Q  +D L   K+K  +  + K  Y  EG+  F+ GF   ++R+
Sbjct: 280 MLASILTYPHEILRTRMQLKSDKLLISKHK--LLDLIKRTYRYEGLLGFYSGFATNLLRT 337

Query: 309 APVNGATFLTFE 320
            P +  T ++FE
Sbjct: 338 VPASAITLVSFE 349

 Score = 37.4 bits (85), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 40/85 (47%), Gaps = 4/85 (4%)

Query: 239 PWKLCLFGAFSGTMLWLTVYPLDVVKSIIQND---DLRKPKYKNSISYVAKTIYAKEGIR 295
           P    L GA +G +  + V PLDV K+ +Q      +  P Y+  +  ++ TI   EG+R
Sbjct: 64  PKITALSGALAGFLSGIIVCPLDVTKTRLQAQGIQSIENPYYRGVLGTMS-TIVVDEGVR 122

Query: 296 AFFKGFGPTMVRSAPVNGATFLTFE 320
             +KG  P ++   P     F  +E
Sbjct: 123 GLYKGLIPIILGYFPTWMIYFSVYE 147

>YIL006W (YIL006W) [2659] chr9 (344059..345180) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1122 bp, 373 aa]
          Length = 373

 Score = 73.9 bits (180), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 66/252 (26%), Positives = 115/252 (45%), Gaps = 34/252 (13%)

Query: 80  KNEGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNT 139
           ++EG    YKG +  +LG      + F V E  K+FF          +  Q   +++S  
Sbjct: 131 RDEGPRGLYKGLVPIVLGYFPTWMIYFSVYEFSKKFFHG--------IFPQFDFVAQS-- 180

Query: 140 LPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDR--EFKGPWDCIKKLKAQGG 197
                     +T G  ++ L +PI  ++ RL  Q SN G+    +KG +D  +KL  Q G
Sbjct: 181 -------CAAITAGAASTTLTNPIWVVKTRLMLQ-SNLGEHPTHYKGTFDAFRKLFYQEG 232

Query: 198 ---LMRGLFPTMIRAGHGLGTYFLVYEAL------VAREIGTGLTRNEIPPWKLCLFGAF 248
              L  GL P+++   H +  +F +YE L       +RE  T    N I   +L +  + 
Sbjct: 233 FKALYAGLVPSLLGLFH-VAIHFPIYEDLKVRFHCYSRENNT----NSINLQRLIMASSV 287

Query: 249 SGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRS 308
           S  +     YP +++++ +Q         +  +  + K  YA+EG++ F+ GF   +VR+
Sbjct: 288 SKMIASAVTYPHEILRTRMQLKSDIPDSIQRRLFPLIKATYAQEGLKGFYSGFTTNLVRT 347

Query: 309 APVNGATFLTFE 320
            P +  T ++FE
Sbjct: 348 IPASAITLVSFE 359

 Score = 37.4 bits (85), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 47/101 (46%), Gaps = 8/101 (7%)

Query: 228 IGTGLTRNEIP---PWKLCLFGAFSGTMLWLTVYPLDVVKSIIQNDDLR----KPKYKNS 280
           IGT L +  +P        L GAF+G +  + V PLDV K+ +Q   L+     P Y+  
Sbjct: 63  IGTTLRKKWVPLSSTQITALSGAFAGFLSGVAVCPLDVAKTRLQAQGLQTRFENPYYRGI 122

Query: 281 ISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATFLTFEL 321
           +  ++ TI   EG R  +KG  P ++   P     F  +E 
Sbjct: 123 MGTLS-TIVRDEGPRGLYKGLVPIVLGYFPTWMIYFSVYEF 162

 Score = 34.7 bits (78), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 43/187 (22%), Positives = 80/187 (42%), Gaps = 25/187 (13%)

Query: 136 RSNTLPLSQYYVCGLTG---GVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPW------ 186
           R   +PLS   +  L+G   G ++     P++  + RLQ Q   G    F+ P+      
Sbjct: 68  RKKWVPLSSTQITALSGAFAGFLSGVAVCPLDVAKTRLQAQ---GLQTRFENPYYRGIMG 124

Query: 187 --DCIKKLKAQGGLMRGLFPTMIRAGHGLGTYFLVYEALVAREIGTGLTRNEIPPWKLC- 243
               I + +   GL +GL P ++        YF VYE   +++   G+        + C 
Sbjct: 125 TLSTIVRDEGPRGLYKGLVPIVLGYFPTWMIYFSVYE--FSKKFFHGIFPQFDFVAQSCA 182

Query: 244 --LFGAFSGTMLWLTVYPLDVVKS--IIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFK 299
               GA S T+      P+ VVK+  ++Q++    P +        + ++ +EG +A + 
Sbjct: 183 AITAGAASTTL----TNPIWVVKTRLMLQSNLGEHPTHYKGTFDAFRKLFYQEGFKALYA 238

Query: 300 GFGPTMV 306
           G  P+++
Sbjct: 239 GLVPSLL 245

>Scas_691.4
          Length = 334

 Score = 73.6 bits (179), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 79/329 (24%), Positives = 122/329 (37%), Gaps = 48/329 (14%)

Query: 23  PNEKRELSSNRVLKDIFAGTIGGIAQVLVGQPFDXXXXXXXXXXXXXXXX-----XXXXX 77
           PN+K+    +  L ++ AG   G+ + L   P D                          
Sbjct: 6   PNDKK----SSPLINLVAGGTAGLFEALCCHPLDTIKVRMQIAKRTEGMRPHGFITTGRN 61

Query: 78  XXKNEGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRS 137
              +EG  A YKG     LG     +V  G+   M   F +Y   +N     +   ++  
Sbjct: 62  IYSHEGFLALYKG-----LG-----AVVIGIIPKMAIRFSSYEFYRNALTDKETRTITTG 111

Query: 138 NTLPLSQYYVCGLTGGVVNSFLA-SPIEQIRIRLQTQTSN------------GGDREFKG 184
           NT      ++ G+  G+  + L  +P+E ++IRLQ Q  N            G       
Sbjct: 112 NT------FLAGVGAGITEAVLVVNPMEVVKIRLQAQHLNDLIPQPAGVSAAGTAATVTK 165

Query: 185 PWDC--------IKKLKAQGGLMRGLFPTMIRAGHGLGTYFLVYEALVAREIGTGLTRNE 236
           P           I K +  G L RG+  T  R     G  F VY  L    +     R  
Sbjct: 166 PKYANAIHAAYTIVKEEGAGALYRGVSLTAARQATNQGANFTVYSYL-KDYLQKYHNRES 224

Query: 237 IPPWKLCLFGAFSGTMLWLTVYPLDVVKSIIQND-DLRKPKYKNSISYVAKTIYAKEGIR 295
           +P W+    G  SG +   +  PLD +K+ +Q D  +        I  +   +  +EG R
Sbjct: 225 LPSWETSCIGLISGAIGPFSNAPLDTIKTRLQKDKSISSNSAWKKIYIIGTQLIKEEGFR 284

Query: 296 AFFKGFGPTMVRSAPVNGATFLTFELVMR 324
           A +KG  P ++R AP    TF  +E V +
Sbjct: 285 ALYKGITPRVMRVAPGQAVTFTVYEFVRK 313

>Kwal_47.17321
          Length = 881

 Score = 73.9 bits (180), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 65/247 (26%), Positives = 107/247 (43%), Gaps = 26/247 (10%)

Query: 82  EGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTLP 141
           EG+   Y G    L+GV    +++  VN+ +++                 +D +   TLP
Sbjct: 551 EGIRGIYSGLGPQLVGVAPEKAIKLTVNDYVRKLL---------------MDENNRLTLP 595

Query: 142 LSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQG--GLM 199
           L    + G   G       +P+E ++IRLQ + S   D   K     +  +K+ G  GL 
Sbjct: 596 LE--IISGAAAGACQVIFTNPLEIVKIRLQVR-SEYADSLPKSQLTALGVVKSLGLRGLY 652

Query: 200 RGLFPTMIRAGHGLGTYFLVYEALVAREI-----GTGLTRNEIPPWKLCLFGAFSGTMLW 254
           +GL   ++R       YF  Y A + R+I          R  +  W+L   G  +G    
Sbjct: 653 KGLVACLMRDVPFSAIYFPTY-AHLKRDIFNYDPQDKNKRARLHTWELLTAGGLAGMPAA 711

Query: 255 LTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGA 314
               P DV+K+ +Q D  +       I + A+TI  +E  ++FFKG G  ++RS+P  G 
Sbjct: 712 YLTTPFDVIKTRLQIDPRKGETRYTGILHAARTILKEERFKSFFKGGGARVLRSSPQFGF 771

Query: 315 TFLTFEL 321
           T   +E+
Sbjct: 772 TLAAYEI 778

 Score = 47.8 bits (112), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 40/67 (59%), Gaps = 2/67 (2%)

Query: 244 LFGAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGP 303
           L G+ +G +    VYP+D+VK+ +Q       +YKNSI    K I+++EGIR  + G GP
Sbjct: 505 LLGSVAGCIGATAVYPIDLVKTRMQAQR-NFSQYKNSIDCFVK-IFSREGIRGIYSGLGP 562

Query: 304 TMVRSAP 310
            +V  AP
Sbjct: 563 QLVGVAP 569

 Score = 38.9 bits (89), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 44/194 (22%), Positives = 81/194 (41%), Gaps = 34/194 (17%)

Query: 146 YVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQGGLMRGLFPT 205
           ++ G   G + +    PI+ ++ R+Q Q +     ++K   DC  K+ ++ G+ RG++  
Sbjct: 504 FLLGSVAGCIGATAVYPIDLVKTRMQAQRNFS---QYKNSIDCFVKIFSREGI-RGIYS- 558

Query: 206 MIRAGHGLGTYFLVYEALVAREIGTGLTRNEIPPWKL------------CLFGAFSGTML 253
                 GLG   +     VA E    LT N+     L             + GA +G   
Sbjct: 559 ------GLGPQLVG----VAPEKAIKLTVNDYVRKLLMDENNRLTLPLEIISGAAAGACQ 608

Query: 254 WLTVYPLDVVKSIIQNDDLRKPKYKNSI---SYVAKTIYAKEGIRAFFKGFGPTMVRSAP 310
            +   PL++VK  +Q     + +Y +S+      A  +    G+R  +KG    ++R  P
Sbjct: 609 VIFTNPLEIVKIRLQ----VRSEYADSLPKSQLTALGVVKSLGLRGLYKGLVACLMRDVP 664

Query: 311 VNGATFLTFELVMR 324
            +   F T+  + R
Sbjct: 665 FSAIYFPTYAHLKR 678

>AER366W [2867] [Homologous to ScYIL134W (FLX1) - SH]
           complement(1314627..1315508) [882 bp, 293 aa]
          Length = 293

 Score = 71.2 bits (173), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 58/241 (24%), Positives = 107/241 (44%), Gaps = 25/241 (10%)

Query: 87  FYKGALTPLLGVGICVSVQFGVNEAMKRFFQNY--NASKNPNMSSQDVDLSRSNTLPLSQ 144
            Y+G    LLG  +  ++ FG     K     +  N S    M  +         LP   
Sbjct: 65  LYRGLGVNLLGNSVAWALYFGCYRCAKDIALRHLGNESATGIMDRR---------LPAHA 115

Query: 145 YYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQGGLM---RG 201
           Y +   + G+  + L +PI  I+ R+   +  G    +K  +D + KL    G++   RG
Sbjct: 116 YMLAAGSSGIATAVLTNPIWVIKTRIMATSRAG---PYKSTFDGVYKLYQTEGVLAFWRG 172

Query: 202 LFPTMIRAGHGLGTYFLVYEALVAREIGTGLTRNE--IPPWKLCLFGAFSGTMLWLTVYP 259
           + P+++    G   YF +Y+ L    + +   + E  +   ++      S  +   +VYP
Sbjct: 173 VVPSLLGVSQG-AIYFALYDTLKFHYLHSSTDKAERRLSVSEIIGITCISKMISVTSVYP 231

Query: 260 LDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATFLTF 319
             ++KS +Q  D   P   + I+ + +T+Y++EGIR F++G    ++R+ P    TF  +
Sbjct: 232 FQLLKSKLQ--DFGAP---SGITQLVQTVYSREGIRGFYRGLSANLLRAVPATCITFFVY 286

Query: 320 E 320
           E
Sbjct: 287 E 287

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 43/173 (24%), Positives = 77/173 (44%), Gaps = 10/173 (5%)

Query: 142 LSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPW-DCIKKLKAQGGLMR 200
           L +  + GLT G + +  + P++ +++RLQ    N  +  + G   D  ++ +    L R
Sbjct: 8   LQREVISGLTAGTITTIASHPLDLLKLRLQLSAGNRANTTYTGLIRDIFERQQWGRELYR 67

Query: 201 GLFPTMIRAGHGLGTYFLVYEA---LVAREIG----TGLTRNEIPPWKLCLFGAFSGTML 253
           GL   ++        YF  Y     +  R +G    TG+    +P     L    SG   
Sbjct: 68  GLGVNLLGNSVAWALYFGCYRCAKDIALRHLGNESATGIMDRRLPAHAYMLAAGSSGIAT 127

Query: 254 WLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMV 306
            +   P+ V+K+ I       P YK++   V K +Y  EG+ AF++G  P+++
Sbjct: 128 AVLTNPIWVIKTRIMATSRAGP-YKSTFDGVYK-LYQTEGVLAFWRGVVPSLL 178

>Scas_714.18
          Length = 305

 Score = 71.2 bits (173), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 73/316 (23%), Positives = 123/316 (38%), Gaps = 59/316 (18%)

Query: 35  LKDIFAGTIGGIAQVLVGQPFDXXXXXXXXXXXXX--XXXXXXXXXXKNEGVF-AFYKGA 91
           L++I AG+I G     +  PFD                         +NEG+   FY+G 
Sbjct: 13  LREILAGSIAGAIGKFIEYPFDTVKVRLQTQEAYMFPSTWSCIKYTYENEGILEGFYQGI 72

Query: 92  LTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTLPLSQYYVCGLT 151
            +PL+G  +  ++ F        F   +             + S    + +S  +     
Sbjct: 73  ESPLIGAALENAILFLAYNQCSSFLNAFT------------EFSAFLIILISAGF----- 115

Query: 152 GGVVNSFLASPIEQIRIRLQTQTSN------------------------GGDREFKGPWD 187
            G   SF+ +P+E I+ +LQ    +                        G          
Sbjct: 116 AGSCASFVLTPVELIKCKLQISNLHYSLHDNDGEQQDEEDEDQGMVIGEGRHTRIIPTIK 175

Query: 188 CIKKLKAQGGLMRGLFPTMIRAGHGLGTYFLVYEAL--VAREIGTGLTRNEI-PPWKLCL 244
            I K K   GL +G   T IR   G   +F  YE +    R+      ++E+   W+L +
Sbjct: 176 SIIKEKGLFGLWQGQSSTFIRESIGSVVWFATYELMKQTLRD-----PKSEVNTTWQLLI 230

Query: 245 FGAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPT 304
            GA +G     +V+P D VKSI+Q + L       ++    ++I  ++G+  F++G G T
Sbjct: 231 SGATAGLAFNGSVFPADTVKSIMQTEHL-------ALMETVRSILERDGVAGFYRGLGIT 283

Query: 305 MVRSAPVNGATFLTFE 320
           ++R+ P N A F T+E
Sbjct: 284 LLRAVPSNAAVFYTYE 299

>Scas_582.7
          Length = 329

 Score = 70.1 bits (170), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 51/183 (27%), Positives = 81/183 (44%), Gaps = 8/183 (4%)

Query: 141 PLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQGG--- 197
           PLS   + G   G++      PI+ ++ R+Q+ T+ G ++        I K+    G   
Sbjct: 35  PLSHQLLAGAFAGIMEHSTMFPIDALKTRIQSTTTKGTEQTSTSIIKQISKISTMEGSLA 94

Query: 198 LMRGLFPTMIRAGHGLGTYFLVYEALVAREIGTGLTRNEIPPWKLCLFGAFSGTMLWLTV 257
           L +G+   ++ AG     YF  YE   A  I     R    P K+ + GA +       +
Sbjct: 95  LWKGVQSVILGAGPAHAVYFATYEFTKAHLIPDS-QRETHQPIKVAVSGATATVASDFFM 153

Query: 258 YPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATFL 317
            P D +K  +Q  DL+K K  N    VAK IY  EG+ AF+  +  T+  + P     F+
Sbjct: 154 NPFDTIKQRMQISDLKKEKVYN----VAKKIYNLEGLSAFYYSYPTTIAMNIPFAAFNFM 209

Query: 318 TFE 320
            +E
Sbjct: 210 IYE 212

 Score = 55.8 bits (133), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 61/247 (24%), Positives = 98/247 (39%), Gaps = 32/247 (12%)

Query: 82  EGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTLP 141
           EG  A +KG  + +LG G   +V F   E  K       A   P       D  R    P
Sbjct: 90  EGSLALWKGVQSVILGAGPAHAVYFATYEFTK-------AHLIP-------DSQRETHQP 135

Query: 142 LSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQGGLMRG 201
           + +  V G T  V + F  +P + I+ R+Q       D + +  ++  KK+    GL   
Sbjct: 136 I-KVAVSGATATVASDFFMNPFDTIKQRMQI-----SDLKKEKVYNVAKKIYNLEGLSAF 189

Query: 202 LF--PTMIRAGHGLGTY-FLVYEALVAREIGTGLTRNEIPPWKLCLFGAFSGTMLWLTVY 258
            +  PT I        + F++YE+  A +    L  +   P   CL G  SG +      
Sbjct: 190 YYSYPTTIAMNIPFAAFNFMIYES--ASKFFNPL--HHYNPLIHCLCGGISGAIAAAVTT 245

Query: 259 PLDVVKSIIQND-----DLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNG 313
           PLD +K++IQ        L   K  N+       I    G + F++G  P ++ + P   
Sbjct: 246 PLDCIKTVIQIRGSSVVSLEVMKKANTFKKATSAILMVYGWKGFWRGLQPRILANMPATA 305

Query: 314 ATFLTFE 320
            ++  +E
Sbjct: 306 ISWTAYE 312

>CAGL0G08910g complement(853693..854562) similar to sp|P40464
           Saccharomyces cerevisiae YIL134w FLX1, hypothetical
           start
          Length = 289

 Score = 69.7 bits (169), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 58/234 (24%), Positives = 101/234 (43%), Gaps = 16/234 (6%)

Query: 87  FYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTLPLSQYY 146
            Y+G    L+G  I   + F      K +  NYN     +    D DLS         Y 
Sbjct: 66  LYRGLTVNLVGNTIAWGLYFASYRVAKDYLINYN-----HRIRNDKDLSSW------MYL 114

Query: 147 VCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQGGLMRGLFPTM 206
               + G++ + L +P+  I+ R+ ++ +N      K   D IK    QG L +GL P +
Sbjct: 115 SASASSGMLTTVLTNPLWVIKTRMMSK-ANSDLTSMKVLRDLIKNDGVQG-LWKGLVPAL 172

Query: 207 IRAGHGLGTYFLVYEALVAREIGTGLTRNEIPPWKLCLFGAFSGTMLWLTVYPLDVVKSI 266
           +    G   +F  Y+ L  + +      +EI   +     + S  +    VYP  ++KS 
Sbjct: 173 VGVSQG-ALHFTCYDTLKHKLVLKNRDSDEITNLETIAVTSVSKMLSTSAVYPFQLLKSN 231

Query: 267 IQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATFLTFE 320
           +Q+    +  +K  +  ++K IY++ G+  F+KG    ++RS P    TF  +E
Sbjct: 232 LQSFQASENDFK--LLPLSKMIYSRSGLLGFYKGLSANLLRSVPSTCITFCIYE 283

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 44/176 (25%), Positives = 75/176 (42%), Gaps = 19/176 (10%)

Query: 141 PLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCI--KKLKAQGGL 198
           PL +  + GLT G V + +  P++  ++RLQ   ++   + ++  W  I    L     L
Sbjct: 7   PLQKEVISGLTAGSVTTLIVHPLDLFKVRLQLLITSTTKKGYRNLWSEIVGSDLSLTREL 66

Query: 199 MRGLFPTMIRAGHGLGTYFLVYEALVAREIGTGLT---RN--EIPPWKLCLFGAFSGTML 253
            RGL   ++      G YF  Y   VA++         RN  ++  W      A SG + 
Sbjct: 67  YRGLTVNLVGNTIAWGLYFASYR--VAKDYLINYNHRIRNDKDLSSWMYLSASASSGMLT 124

Query: 254 WLTVYPLDVVKSIIQ---NDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMV 306
            +   PL V+K+ +    N DL   K       V + +   +G++  +KG  P +V
Sbjct: 125 TVLTNPLWVIKTRMMSKANSDLTSMK-------VLRDLIKNDGVQGLWKGLVPALV 173

>CAGL0K02365g 212702..215461 highly similar to tr|Q12482
           Saccharomyces cerevisiae YPR021c, start by similarity
          Length = 919

 Score = 70.9 bits (172), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 60/247 (24%), Positives = 103/247 (41%), Gaps = 25/247 (10%)

Query: 82  EGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTLP 141
           EG+   Y G    L+GV    +++  VN+ M+   ++ N                   L 
Sbjct: 594 EGIRGVYSGLGPQLIGVAPEKAIKLTVNDYMRNKLKDKNGK-----------------LG 636

Query: 142 LSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQG--GLM 199
           L    + G + G       +P+E ++IRLQ +     +         ++ +K  G  GL 
Sbjct: 637 LLSEIISGASAGACQVIFTNPLEIVKIRLQVKGEYVAENAENAKLTALQIIKRLGLPGLY 696

Query: 200 RGLFPTMIRAGHGLGTYFLVYEALVAREI-----GTGLTRNEIPPWKLCLFGAFSGTMLW 254
           +G    ++R       YF  Y A + R++          R+ +  W+L   GA +G    
Sbjct: 697 KGAAACLLRDVPFSAIYFPTY-AHLKRDLFNFDPNDKNKRSRLNTWELLSAGALAGMPAA 755

Query: 255 LTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGA 314
               P DV+K+ +Q D  +       I + A+TI  +E  ++FFKG    ++RS+P  G 
Sbjct: 756 YLTTPFDVIKTRLQIDPKKGETIYKGIIHAARTILREESFKSFFKGGAARVLRSSPQFGF 815

Query: 315 TFLTFEL 321
           T   +EL
Sbjct: 816 TLAAYEL 822

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 30/79 (37%), Positives = 42/79 (53%), Gaps = 3/79 (3%)

Query: 246 GAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTM 305
           G+ +G +    VYP+D VK+ +Q       +YKNSI    K I ++EGIR  + G GP +
Sbjct: 550 GSVAGCIGATIVYPIDFVKTRMQ-AQRSLSQYKNSIDCFLK-ILSREGIRGVYSGLGPQL 607

Query: 306 VRSAPVNGATFLTFELVMR 324
           +  AP   A  LT    MR
Sbjct: 608 IGVAP-EKAIKLTVNDYMR 625

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 44/191 (23%), Positives = 78/191 (40%), Gaps = 27/191 (14%)

Query: 146 YVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQGGLMRGLFPT 205
           +  G   G + + +  PI+ ++ R+Q Q S     ++K   DC  K+ ++ G+ RG++  
Sbjct: 547 FSLGSVAGCIGATIVYPIDFVKTRMQAQRSLS---QYKNSIDCFLKILSREGI-RGVYS- 601

Query: 206 MIRAGHGLGTYFLVYEALVAREIGTGLTRNEIPPWKL------------CLFGAFSGTML 253
                 GLG   +     VA E    LT N+    KL             + GA +G   
Sbjct: 602 ------GLGPQLIG----VAPEKAIKLTVNDYMRNKLKDKNGKLGLLSEIISGASAGACQ 651

Query: 254 WLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNG 313
            +   PL++VK  +Q       +   +    A  I  + G+   +KG    ++R  P + 
Sbjct: 652 VIFTNPLEIVKIRLQVKGEYVAENAENAKLTALQIIKRLGLPGLYKGAAACLLRDVPFSA 711

Query: 314 ATFLTFELVMR 324
             F T+  + R
Sbjct: 712 IYFPTYAHLKR 722

>Sklu_2359.6 YPR021C, Contig c2359 14617-17325
          Length = 902

 Score = 70.9 bits (172), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 61/248 (24%), Positives = 105/248 (42%), Gaps = 28/248 (11%)

Query: 82  EGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTLP 141
           EG+   Y G    L+GV    +++  VN+ M+    + +A+                   
Sbjct: 569 EGIRGIYSGLGPQLIGVAPEKAIKLTVNDYMRGRLMDKHAN------------------- 609

Query: 142 LSQYY--VCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQG--G 197
           L  Y+  + G   G       +P+E ++IRLQ ++   GD   K     +  +K  G  G
Sbjct: 610 LKWYFEILSGACAGACQVVFTNPLEVVKIRLQVRSEYAGDV-LKSQVTALGVIKQLGIKG 668

Query: 198 LMRGLFPTMIRAGHGLGTYFLVYEAL----VAREIGTGLTRNEIPPWKLCLFGAFSGTML 253
           L +G+   ++R       YF  Y  L       +      RN++  W+L + G  +G   
Sbjct: 669 LYKGIAACLMRDVPFSAIYFPTYAHLKKDVFKYDPKDKKQRNKLKTWELLVAGGLAGMPA 728

Query: 254 WLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNG 313
                P DV+K+ +Q D  +       I + A+TI  +E  ++FFKG    ++RS+P  G
Sbjct: 729 AYLTTPFDVIKTRLQIDPRKGETRYEGIFHAARTILKEESFKSFFKGGSARVLRSSPQFG 788

Query: 314 ATFLTFEL 321
            T   +E+
Sbjct: 789 FTLAAYEI 796

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 45/79 (56%), Gaps = 3/79 (3%)

Query: 246 GAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTM 305
           G+ +G +    VYP+D+VK+ +Q       +YKNSI   AK I+++EGIR  + G GP +
Sbjct: 525 GSIAGCIGATVVYPIDLVKTRMQAQR-SFSQYKNSIDCFAK-IFSREGIRGIYSGLGPQL 582

Query: 306 VRSAPVNGATFLTFELVMR 324
           +  AP   A  LT    MR
Sbjct: 583 IGVAP-EKAIKLTVNDYMR 600

 Score = 41.6 bits (96), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 45/189 (23%), Positives = 79/189 (41%), Gaps = 34/189 (17%)

Query: 146 YVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQGGLMRGLFPT 205
           +  G   G + + +  PI+ ++ R+Q Q S     ++K   DC  K+ ++ G+ RG++  
Sbjct: 522 FTLGSIAGCIGATVVYPIDLVKTRMQAQRSFS---QYKNSIDCFAKIFSREGI-RGIYS- 576

Query: 206 MIRAGHGLGTYFLVYEALVAREIGTGLTRNEIPPWKL------------CLFGAFSGTML 253
                 GLG   +     VA E    LT N+    +L             L GA +G   
Sbjct: 577 ------GLGPQLIG----VAPEKAIKLTVNDYMRGRLMDKHANLKWYFEILSGACAGACQ 626

Query: 254 WLTVYPLDVVKSIIQNDDLRKPKYKNSI---SYVAKTIYAKEGIRAFFKGFGPTMVRSAP 310
            +   PL+VVK  +Q     + +Y   +      A  +  + GI+  +KG    ++R  P
Sbjct: 627 VVFTNPLEVVKIRLQ----VRSEYAGDVLKSQVTALGVIKQLGIKGLYKGIAACLMRDVP 682

Query: 311 VNGATFLTF 319
            +   F T+
Sbjct: 683 FSAIYFPTY 691

>Kwal_47.18216
          Length = 333

 Score = 68.6 bits (166), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 70/281 (24%), Positives = 113/281 (40%), Gaps = 57/281 (20%)

Query: 81  NEGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTL 140
            EG  A YKG    ++G+   ++++F   E    FF+   A +   +      +S  NT 
Sbjct: 64  QEGFLALYKGLGAVVIGIIPKMAIRFTSYE----FFRTLLADRQTGV------VSTGNT- 112

Query: 141 PLSQYYVCGLTGGVVNSFLA-SPIEQIRIRLQTQ-------------------------- 173
                +V G+  G+  + +  +P+E ++IRLQ Q                          
Sbjct: 113 -----FVAGVGAGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVTSSSATFSSAT 167

Query: 174 ------TSNGGDREFKGPWDCIKKLKAQGGLMRGLFPTMIRAGHGLGTYFLVYEALVARE 227
                  +    R        I K +    L RG+  T  R     G  F VY  L +R 
Sbjct: 168 TATENVAATPKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRL 227

Query: 228 IGTGLTRNEIPPWKLCLFGAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNS----ISY 283
                T + +P W+  L G  SG +   +  PLD +K+ +Q D   K   K+S    I  
Sbjct: 228 QEYHQT-DMLPSWETSLIGLISGALGPFSNAPLDTIKTRLQKD---KSTSKDSGWSRILA 283

Query: 284 VAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATFLTFELVMR 324
           + + +  +EG RA +KG  P ++R AP    TF  +EL+ +
Sbjct: 284 IGRQLIREEGFRALYKGITPRVMRVAPGQAVTFTVYELIRK 324

 Score = 41.2 bits (95), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 35/145 (24%), Positives = 56/145 (38%), Gaps = 18/145 (12%)

Query: 80  KNEGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNT 139
           K EG  A Y+G               F V   +K   Q Y+               +++ 
Sbjct: 191 KEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYH---------------QTDM 235

Query: 140 LPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQGG-- 197
           LP  +  + GL  G +  F  +P++ I+ RLQ   S   D  +       ++L  + G  
Sbjct: 236 LPSWETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFR 295

Query: 198 -LMRGLFPTMIRAGHGLGTYFLVYE 221
            L +G+ P ++R   G    F VYE
Sbjct: 296 ALYKGITPRVMRVAPGQAVTFTVYE 320

 Score = 32.7 bits (73), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 21/89 (23%), Positives = 40/89 (44%), Gaps = 2/89 (2%)

Query: 234 RNEIPPWKLCLFGAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYV--AKTIYAK 291
           +N   P    + G  +G    L  +PLD +K  +Q     + + + +  ++  A+ I  +
Sbjct: 5   KNSSHPAINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQ 64

Query: 292 EGIRAFFKGFGPTMVRSAPVNGATFLTFE 320
           EG  A +KG G  ++   P     F ++E
Sbjct: 65  EGFLALYKGLGAVVIGIIPKMAIRFTSYE 93

>KLLA0E08877g complement(791157..792041) similar to sgd|S0002277
           Saccharomyces cerevisiae YDL119c, start by similarity
          Length = 294

 Score = 65.9 bits (159), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 45/185 (24%), Positives = 85/185 (45%), Gaps = 18/185 (9%)

Query: 143 SQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQGGLMRGL 202
           + + + G +GG+V++ +  P + ++ RLQ   ++         W  +K ++    L RG 
Sbjct: 8   TTHLIGGFSGGLVSAIILQPFDLLKTRLQQDKTST-------LWKTLKSIETPSQLWRGA 60

Query: 203 FPTMIRAGHGLGTYFLVYEAL---VAREIGTGLTRNEIPP----WKLCLFGAFSGTMLWL 255
            P+ IR   G   Y  +  ++   +++   TG T +   P    ++    GA +  +  L
Sbjct: 61  LPSCIRTSVGSAMYLTMLNSIRQAISKGKNTGSTGSSYLPQLNMYENMFSGAVTRALTGL 120

Query: 256 TVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGAT 315
              P+ V+K   ++   +      S+ Y    I+  EG+R FF+GFG T +R AP  G  
Sbjct: 121 ITMPITVIKVRYESTLYQY----TSLRYATSHIFRTEGLRGFFRGFGATALRDAPYAGLY 176

Query: 316 FLTFE 320
            L ++
Sbjct: 177 MLFYD 181

 Score = 35.0 bits (79), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 58/306 (18%), Positives = 111/306 (36%), Gaps = 34/306 (11%)

Query: 33  RVLKDIFAGTIGGIAQVLVGQPFDXXXXXXXXXXXXXXXXXXXXXXXKNEGVFAFYKGAL 92
           R    +  G  GG+   ++ QPFD                        ++     ++GAL
Sbjct: 6   RATTHLIGGFSGGLVSAIILQPFDLLKTRLQQDKTSTLWKTLKSIETPSQ----LWRGAL 61

Query: 93  TPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTLPLSQYYVCGLTG 152
                   C+    G   AM  +    N+ +      ++   + S+ LP    Y    +G
Sbjct: 62  PS------CIRTSVG--SAM--YLTMLNSIRQAISKGKNTGSTGSSYLPQLNMYENMFSG 111

Query: 153 GVVNSF---LASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQGGLMRGLFPTMIRA 209
            V  +    +  PI  I++R ++         +      I + +   G  RG   T +R 
Sbjct: 112 AVTRALTGLITMPITVIKVRYESTLYQYTSLRYAT--SHIFRTEGLRGFFRGFGATALRD 169

Query: 210 GHGLGTYFLVYE---ALVAREIGTGLTR----NEIPPWKLCLF---GAFSGTMLWLTVY- 258
               G Y L Y+    LV   + + + +    N    +   L     AFS  ++  ++  
Sbjct: 170 APYAGLYMLFYDRMKVLVPTLLPSNVVKLNSDNRYSTYASTLINGSSAFSAAVIATSITA 229

Query: 259 PLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATFLT 318
           P D VK+ +Q +  +   + ++  ++A     KE +R  F G    + R A   G  +  
Sbjct: 230 PFDTVKTRMQLEPAKFHSFTSTFWHIA----TKESVRNLFAGISLRLTRKAFSAGIAWGI 285

Query: 319 FELVMR 324
           +E +++
Sbjct: 286 YEEIVK 291

>Kwal_23.3042
          Length = 542

 Score = 66.6 bits (161), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 65/256 (25%), Positives = 110/256 (42%), Gaps = 29/256 (11%)

Query: 83  GVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTLPL 142
           G+ AFY G     + V    +++FG  E  KR        ++         LSR +T   
Sbjct: 297 GIRAFYVGNGLNAMKVFPESAIKFGSFELAKRLMAQLEGVQDT------AGLSRFST--- 347

Query: 143 SQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQGGL---- 198
              Y+ G  GGV+      PI+ ++ R+Q    N   +  +      K +  +GGL    
Sbjct: 348 ---YLAGGLGGVMAQLSVYPIDTLKYRVQCAPLNTESKGRQLLISTAKDMYKEGGLRIFY 404

Query: 199 ------MRGLFPTMIRAGHGLGTYFLVYEALVAREIG-TGLTRNEIPPWKL--CLFGAFS 249
                 + G+FP    A   LGT+  + +  +AR+   TGL  +++    +   L GAFS
Sbjct: 405 RGITVGIMGIFPY---AAMDLGTFSALKKWYIARQARLTGLPEDQVTMSNMFVLLMGAFS 461

Query: 250 GTMLWLTVYPLDVVKSIIQ-NDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRS 308
           GT+    VYP++++++ +Q       P   N    V      +EG +  FKG  P + + 
Sbjct: 462 GTVGATAVYPVNLLRTRLQAQGTFAHPHRYNGFRDVLLKTVQREGYQGLFKGLVPNLAKV 521

Query: 309 APVNGATFLTFELVMR 324
            P    ++L +E + R
Sbjct: 522 CPAVSISYLCYENLKR 537

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 36/147 (24%), Positives = 64/147 (43%), Gaps = 10/147 (6%)

Query: 80  KNEGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNT 139
           K  G+  FY+G    ++G+    ++  G   A+K+++    A        Q   ++ SN 
Sbjct: 396 KEGGLRIFYRGITVGIMGIFPYAAMDLGTFSALKKWYIARQARLTGLPEDQ---VTMSNM 452

Query: 140 LPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDC-IKKLKAQG-- 196
             L    + G   G V +    P+  +R RLQ Q +      + G  D  +K ++ +G  
Sbjct: 453 FVL----LMGAFSGTVGATAVYPVNLLRTRLQAQGTFAHPHRYNGFRDVLLKTVQREGYQ 508

Query: 197 GLMRGLFPTMIRAGHGLGTYFLVYEAL 223
           GL +GL P + +    +   +L YE L
Sbjct: 509 GLFKGLVPNLAKVCPAVSISYLCYENL 535

 Score = 34.7 bits (78), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 33/64 (51%), Gaps = 2/64 (3%)

Query: 261 DVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATFLTFE 320
           D++     N DL   K K+ +   A T+Y + GIRAF+ G G   ++  P +   F +FE
Sbjct: 267 DIILEKNPNADL--SKIKSPLVKAATTLYRQGGIRAFYVGNGLNAMKVFPESAIKFGSFE 324

Query: 321 LVMR 324
           L  R
Sbjct: 325 LAKR 328

>Scas_602.8
          Length = 885

 Score = 66.2 bits (160), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 61/247 (24%), Positives = 101/247 (40%), Gaps = 25/247 (10%)

Query: 82  EGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTLP 141
           EG+   Y G    L+GV    +++  VN+ M++                   + +   L 
Sbjct: 549 EGIRGLYSGLGPQLIGVAPEKAIKLTVNDFMRKSL-----------------VDKKGNLQ 591

Query: 142 LSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKG---PWDCIKKLKAQGGL 198
           L    + G T G       +P+E ++IRLQ ++        K     +  IK+LK  G L
Sbjct: 592 LGAEVLSGATAGACQVVFTNPLEIVKIRLQVKSEYTNAMIPKSQLTAFQIIKELKLIG-L 650

Query: 199 MRGLFPTMIRAGHGLGTYFLVYEALVAR----EIGTGLTRNEIPPWKLCLFGAFSGTMLW 254
            +G+   ++R       YF  Y  L       +      R+ +  W+L   GA +G    
Sbjct: 651 YKGVGACLLRDVPFSAIYFPTYAHLKKNVFQFDPNDKDKRDRLKTWELLTAGALAGVPAA 710

Query: 255 LTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGA 314
               P DV+K+ +Q +          I +  +TI  +E  R+FFKG    ++RS+P  G 
Sbjct: 711 FLTTPFDVIKTRLQIEPGVGETRYTGILHAVRTILKEESFRSFFKGGAARVMRSSPQFGF 770

Query: 315 TFLTFEL 321
           T   +EL
Sbjct: 771 TLAAYEL 777

 Score = 46.2 bits (108), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 43/79 (54%), Gaps = 3/79 (3%)

Query: 246 GAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTM 305
           G+ +G +    VYP+D +K+ +Q       KYKNSI  + K I+ KEGIR  + G GP +
Sbjct: 505 GSVAGCIGATLVYPIDFIKTRMQ-AQRSLTKYKNSIDCLVK-IFGKEGIRGLYSGLGPQL 562

Query: 306 VRSAPVNGATFLTFELVMR 324
           +  AP   A  LT    MR
Sbjct: 563 IGVAP-EKAIKLTVNDFMR 580

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 49/190 (25%), Positives = 79/190 (41%), Gaps = 35/190 (18%)

Query: 146 YVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQGGLMRGLFPT 205
           +  G   G + + L  PI+ I+ R+Q Q S     ++K   DC+ K+  + G+ RGL+  
Sbjct: 502 FSLGSVAGCIGATLVYPIDFIKTRMQAQRSLT---KYKNSIDCLVKIFGKEGI-RGLYS- 556

Query: 206 MIRAGHGLGTYFLVYEALVAREIGTGLTRNEIPPWKL------------CLFGAFSGTML 253
                 GLG   +     VA E    LT N+     L             L GA +G   
Sbjct: 557 ------GLGPQLIG----VAPEKAIKLTVNDFMRKSLVDKKGNLQLGAEVLSGATAGACQ 606

Query: 254 WLTVYPLDVVKSIIQNDDLRKPKYKNSI----SYVAKTIYAKEGIRAFFKGFGPTMVRSA 309
            +   PL++VK  +Q     K +Y N++       A  I  +  +   +KG G  ++R  
Sbjct: 607 VVFTNPLEIVKIRLQ----VKSEYTNAMIPKSQLTAFQIIKELKLIGLYKGVGACLLRDV 662

Query: 310 PVNGATFLTF 319
           P +   F T+
Sbjct: 663 PFSAIYFPTY 672

>YJL133W (MRS3) [2785] chr10 (160537..161481) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses mitochondrial
           splicing defects [945 bp, 314 aa]
          Length = 314

 Score = 64.7 bits (156), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 60/250 (24%), Positives = 102/250 (40%), Gaps = 38/250 (15%)

Query: 81  NEGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTL 140
           +EG  A +KG  + +LG G   +V FG  E  K+           N+    +D S + T 
Sbjct: 84  SEGTLALWKGVQSVILGAGPAHAVYFGTYEFCKK-----------NL----IDSSDTQTH 128

Query: 141 PLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQGGLMR 200
              +  + G      +  L +P + I+ R+Q  TS          W   K++    GL  
Sbjct: 129 HPFKTAISGACATTASDALMNPFDTIKQRIQLNTS-------ASVWQTTKQIYQSEGLAA 181

Query: 201 GLF--PTMIRAGHGLGTY-FLVYEALVAREIGTGLTR--NEIPPWKLCLFGAFSGTMLWL 255
             +  PT +        + F++YE+       T      NE  P   CL G+ SG+    
Sbjct: 182 FYYSYPTTLVMNIPFAAFNFVIYES------STKFLNPSNEYNPLIHCLCGSISGSTCAA 235

Query: 256 TVYPLDVVKSII-----QNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAP 310
              PLD +K+++     Q   L   +  ++ S  A  IY   G + F++G+ P +V + P
Sbjct: 236 ITTPLDCIKTVLQIRGSQTVSLEIMRKADTFSKAASAIYQVYGWKGFWRGWKPRIVANMP 295

Query: 311 VNGATFLTFE 320
               ++  +E
Sbjct: 296 ATAISWTAYE 305

 Score = 53.9 bits (128), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 45/183 (24%), Positives = 76/183 (41%), Gaps = 12/183 (6%)

Query: 141 PLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQGG--- 197
           PL    + G   G++   +  PI+ ++ R+Q+  +N      K     I  +    G   
Sbjct: 32  PLYHQLIAGAFAGIMEHSVMFPIDALKTRIQS--ANAKSLSAKNMLSQISHISTSEGTLA 89

Query: 198 LMRGLFPTMIRAGHGLGTYFLVYEALVAREIGTGLTRNEIPPWKLCLFGAFSGTMLWLTV 257
           L +G+   ++ AG     YF  YE      I +  T+    P+K  + GA + T     +
Sbjct: 90  LWKGVQSVILGAGPAHAVYFGTYEFCKKNLIDSSDTQTH-HPFKTAISGACATTASDALM 148

Query: 258 YPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATFL 317
            P D +K  IQ +         S+    K IY  EG+ AF+  +  T+V + P     F+
Sbjct: 149 NPFDTIKQRIQLNT------SASVWQTTKQIYQSEGLAAFYYSYPTTLVMNIPFAAFNFV 202

Query: 318 TFE 320
            +E
Sbjct: 203 IYE 205

>AER419W [2919] [Homologous to ScYNL083W - SH]
           complement(1442595..1444076) [1482 bp, 493 aa]
          Length = 493

 Score = 65.5 bits (158), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 64/259 (24%), Positives = 110/259 (42%), Gaps = 29/259 (11%)

Query: 80  KNEGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNT 139
           +  G+ AFY G    ++ V    +++FG  E  KR                  +LSR +T
Sbjct: 245 RQGGLRAFYLGNGLNVIKVFPESAMKFGSFELAKRVLAGLEGCGETG------ELSRLST 298

Query: 140 LPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQGGL- 198
                 YV G  GG++  F   PI+ ++ R+Q    +   R         K +  +GGL 
Sbjct: 299 ------YVAGGLGGIMAQFSVYPIDTLKFRIQCAPLDTRCRGLPLLIKTAKDMYREGGLR 352

Query: 199 ---------MRGLFPTMIRAGHGLGTYFLVYEALVAREIGT-GLTRNEIPPWKLCLF--G 246
                    + G+FP    A   LGT+  +    + R     G++ NE+    L +   G
Sbjct: 353 LFYRGLGVGILGVFPY---AALDLGTFSALKRWYITRRANALGISENEVVMSNLVVLPMG 409

Query: 247 AFSGTMLWLTVYPLDVVKSIIQ-NDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTM 305
           AFSGT+    VYP++++++ +Q       P   +    V +    +EG+   +KG  PT+
Sbjct: 410 AFSGTVGATVVYPINLLRTRLQAQGTYAHPHRYDGFQDVFRKTVQREGLPGLYKGLVPTL 469

Query: 306 VRSAPVNGATFLTFELVMR 324
            +  P    ++L +E + R
Sbjct: 470 AKVCPAVAISYLCYENLKR 488

 Score = 32.3 bits (72), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 28/49 (57%)

Query: 276 KYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATFLTFELVMR 324
           K ++ +   A ++Y + G+RAF+ G G  +++  P +   F +FEL  R
Sbjct: 231 KIRSPLVKAATSLYRQGGLRAFYLGNGLNVIKVFPESAMKFGSFELAKR 279

>Kwal_55.20868
          Length = 380

 Score = 64.7 bits (156), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 59/256 (23%), Positives = 109/256 (42%), Gaps = 33/256 (12%)

Query: 80  KNEGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNT 139
           ++EG    YKG +  ++G      + F V E  K+ +        P +      +S S  
Sbjct: 128 RDEGARGLYKGLVPIIMGYFPTWMIYFSVYERSKKLY--------PRIFPSFDFISHS-- 177

Query: 140 LPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTS-NGGDREFKGPWDCIKKLKAQGGL 198
                     LT G V++ L +P+  ++ RL  QT  N     +   +D   K+    GL
Sbjct: 178 -------ASALTAGTVSTILTNPVWVVKTRLMLQTHVNKNSTHYTSTFDAFHKMYTTEGL 230

Query: 199 ---MRGLFPTMIRAGHGLGTYFLVYEAL-VAREIGTGLTRNE---IPPWKLCLFGAFSGT 251
                GL P+++   H +  +F +YE L V       ++R E   +   +L +  + S  
Sbjct: 231 RTFYAGLLPSLLGLFH-VAIHFPIYEKLKVWLHCTPSMSRTEDHNLNLARLIIASSASKM 289

Query: 252 MLWLTVYPLDVVKSIIQ-----NDDLR--KPKYKNSISYVAKTIYAKEGIRAFFKGFGPT 304
           +     YP +++++ +Q      D L   +   ++ +  + K  Y  EG+R F+ GF   
Sbjct: 290 VASTLTYPHEILRTRMQLKAYPTDPLAALQKTSRHGLIRLIKHTYKSEGLRGFYSGFTAN 349

Query: 305 MVRSAPVNGATFLTFE 320
           + R+ P +  T ++FE
Sbjct: 350 LARTLPASAITLVSFE 365

>Scas_662.12
          Length = 308

 Score = 63.5 bits (153), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 58/244 (23%), Positives = 109/244 (44%), Gaps = 30/244 (12%)

Query: 88  YKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTLPLSQYYV 147
           Y+G    LLG  +  S+ F +          YN++K+     Q+  L  +NT   + +  
Sbjct: 78  YRGLPINLLGNAVAWSLYFTI----------YNSTKDYMF--QNNYLHNNNT---TIFLT 122

Query: 148 CGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQGG---LMRGLFP 204
            GL  G+  + L +P+  I+ R+ + + +  D  +K      K L  + G   +  GL P
Sbjct: 123 SGLISGISTTLLTNPLWVIKTRIMSTSRHHKD-SYKSIRHGFKSLLTKEGPKAIWMGLLP 181

Query: 205 TMIRAGHGLGTYFLVYEALVAR---EIGTGLTRNEIPPWKLCLFGAFSGTMLWLTVYPLD 261
           +++    G   YF++Y+ L       +      N     K+ L  + S  +  ++VYP  
Sbjct: 182 SLLGVSQG-AIYFMIYDNLKLHFNVNLNKSKKDNANANLKIVLISSLSKMLSVMSVYPFQ 240

Query: 262 VVKSIIQN-----DDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATF 316
           ++KS +Q      +++ +  Y + I+ + K IY   GI+  +KG    ++R+ P    TF
Sbjct: 241 LLKSNLQTFRSVTNNIPQNDY-HFITLIRK-IYRDNGIKGLYKGLSANLLRAIPSTCITF 298

Query: 317 LTFE 320
             +E
Sbjct: 299 CIYE 302

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 45/181 (24%), Positives = 76/181 (41%), Gaps = 17/181 (9%)

Query: 141 PLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCI-------KKLK 193
           P+ +  + GL+ G + + +  P++ I++RLQ   +    +  KG    I       KK+ 
Sbjct: 6   PIQKEIISGLSAGSLTTLIVHPLDLIKVRLQLLATTTTQQHQKGYTYLINELINNSKKMG 65

Query: 194 AQGGLM-------RGLFPTMIRAGHGLGTYFLVYEALVAREIGTGLTRNEIPPWKLCLFG 246
           +QG +        RGL   ++        YF +Y +            N      L   G
Sbjct: 66  SQGPIYNLIKESYRGLPINLLGNAVAWSLYFTIYNSTKDYMFQNNYLHNNNTTIFLT-SG 124

Query: 247 AFSGTMLWLTVYPLDVVKS-IIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTM 305
             SG    L   PL V+K+ I+      K  YK SI +  K++  KEG +A + G  P++
Sbjct: 125 LISGISTTLLTNPLWVIKTRIMSTSRHHKDSYK-SIRHGFKSLLTKEGPKAIWMGLLPSL 183

Query: 306 V 306
           +
Sbjct: 184 L 184

>KLLA0E15532g complement(1383230..1384210) similar to sp|P23500
           Saccharomyces cerevisiae YKR052c MRS4 RNA splicing
           protein and member of the mitochondrial carrier family
           (MCF), start by similarity
          Length = 326

 Score = 63.5 bits (153), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 54/248 (21%), Positives = 98/248 (39%), Gaps = 27/248 (10%)

Query: 81  NEGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTL 140
            EG  A ++G  + ++G G   +V F   E  K                Q +D    NT 
Sbjct: 88  TEGSLALWRGVQSMVMGAGPAHAVYFATYEFCKE---------------QLIDAKDFNTH 132

Query: 141 PLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQGGLMR 200
              +  V G+   V    L +P + I+ RLQ Q+ +     ++  ++  K          
Sbjct: 133 QPLKTAVSGVAATVAADALMNPFDTIKQRLQLQSKSSDSSMWRMAFNIYKNEGPMAFFYS 192

Query: 201 GLFPTMIRAGHGLGTY-FLVYEALVAREIGTGLTRNEIPPWKLCLFGAFSGTMLWLTVYP 259
             +PT +          F++YE+       T    N   PW  CL G  +G        P
Sbjct: 193 --YPTTLAMNIPFAALNFVIYESSTKFFNPT----NAYNPWIHCLCGGIAGATCAAVTTP 246

Query: 260 LDVVKSIIQ---NDDLRKPKYK--NSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGA 314
           LD +K+++Q   +D +    +K  N+    A+ I+   G + F++G  P ++ + P    
Sbjct: 247 LDCIKTVLQIRGSDTVHVESFKTANTFKKAAQAIWQSYGWKGFWRGLQPRVISNIPATAI 306

Query: 315 TFLTFELV 322
           ++ ++E  
Sbjct: 307 SWTSYEFA 314

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 46/210 (21%), Positives = 81/210 (38%), Gaps = 23/210 (10%)

Query: 130 QDVDL-SRSNTLPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTS------------- 175
           Q++D  +  +T PLS   + G   G++   +  PI+ ++ R+Q  +              
Sbjct: 7   QEIDYEALPDTAPLSYQLIAGAFAGIMEHSIMFPIDALKTRMQAVSEIKAAASASASGGA 66

Query: 176 --NGGDREFKGPWDCIKKLKAQGG---LMRGLFPTMIRAGHGLGTYFLVYEALVAREIGT 230
               G          I ++ +  G   L RG+   ++ AG     YF  YE     ++  
Sbjct: 67  GAASGGAGAGTLLQQISRISSTEGSLALWRGVQSMVMGAGPAHAVYFATYE-FCKEQLID 125

Query: 231 GLTRNEIPPWKLCLFGAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYA 290
               N   P K  + G  +       + P D +K  +Q   L+     +S+  +A  IY 
Sbjct: 126 AKDFNTHQPLKTAVSGVAATVAADALMNPFDTIKQRLQ---LQSKSSDSSMWRMAFNIYK 182

Query: 291 KEGIRAFFKGFGPTMVRSAPVNGATFLTFE 320
            EG  AFF  +  T+  + P     F+ +E
Sbjct: 183 NEGPMAFFYSYPTTLAMNIPFAALNFVIYE 212

>Scas_721.27
          Length = 374

 Score = 63.5 bits (153), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 71/265 (26%), Positives = 118/265 (44%), Gaps = 40/265 (15%)

Query: 80  KNEGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNT 139
           K EG  + +KG    L+GV    S+ F      K  +     SK  N + Q+  L     
Sbjct: 127 KREGFRSLFKGLGPNLVGVIPARSINFFTYGTTKEIY-----SKAFN-NGQETPLI---- 176

Query: 140 LPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKK-LKAQG-- 196
                + +   T G   S   +PI  I+ R+Q   + G  R++K  WDC+K  LK++G  
Sbjct: 177 -----HLMSAATAGWATSTATNPIWMIKTRVQLDKA-GTTRKYKNSWDCLKTVLKSEGIY 230

Query: 197 GLMRGLFPTMIRAGHGLGTYFLVYEAL-----------VAREIGTGLTRNE-IPPWKLCL 244
           GL RGL  + + +  G+   +L+YE +              E     +R E I  W  C 
Sbjct: 231 GLYRGLSASYLGSIEGI-LQWLLYEQMKHLIKQRSIEKFGHEGQLTKSRTEKIKEW--CQ 287

Query: 245 FGAFSGTMLWLT---VYPLDVVKSIIQNDDLR--KPKYKNSISYVAKTIYAKEGIRAFFK 299
               +G   ++     YP +VV++ ++   +   KPKY   +    + I  +EG+ + + 
Sbjct: 288 RSGSAGVAKFIASIVTYPHEVVRTRLRQMPMENGKPKYTGLVQSF-RVIIKEEGLASMYS 346

Query: 300 GFGPTMVRSAPVNGATFLTFELVMR 324
           G  P ++R+ P +   F T+ELV+R
Sbjct: 347 GLTPHLMRTVPNSIIMFGTWELVIR 371

 Score = 35.4 bits (80), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 26/108 (24%), Positives = 42/108 (38%), Gaps = 26/108 (24%)

Query: 237 IPPWKLCLFGAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKT--------- 287
           + PW   + G   G    +   P D+VK+ +Q+D + +  YK+  + V            
Sbjct: 50  VKPWVHFVAGGIGGMAGAVVTCPFDLVKTRLQSD-IYQSVYKSKAATVTAAHNSKIANSL 108

Query: 288 ----------------IYAKEGIRAFFKGFGPTMVRSAPVNGATFLTF 319
                           +Y +EG R+ FKG GP +V   P     F T+
Sbjct: 109 VQAGTHFKETFGILGNVYKREGFRSLFKGLGPNLVGVIPARSINFFTY 156

>YIL134W (FLX1) [2542] chr9 (97395..98330) Protein involved in
           transport of FAD from cytosol into the mitochondrial
           matrix, member of mitochondrial carrier (MCF) family of
           membrane transporters [936 bp, 311 aa]
          Length = 311

 Score = 63.2 bits (152), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 59/243 (24%), Positives = 104/243 (42%), Gaps = 19/243 (7%)

Query: 87  FYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTLPLSQYY 146
            Y+G    L G  I   V FG+    K     Y +   P   +Q   +   + +    Y 
Sbjct: 73  LYRGLSINLFGNAIAWGVYFGLYGVTKELI--YKSVAKPG-ETQLKGVGNDHKMNSLIYL 129

Query: 147 VCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKL-KAQG--GLMRGLF 203
             G + G++ + L +PI  I+ R+ + TS G    +   ++ +++L +  G  GL +GL 
Sbjct: 130 SAGASSGLMTAILTNPIWVIKTRIMS-TSKGAQGAYTSMYNGVQQLLRTDGFQGLWKGLV 188

Query: 204 PTMIRAGHGLGTYFLVYEALVAREI------GTGLTRNEIPPWKLCLFGAFSGTMLWLTV 257
           P +     G   YF VY+ L  R++      G  +    +   ++   G      L   V
Sbjct: 189 PALFGVSQG-ALYFAVYDTLKQRKLRRKRENGLDIHLTNLETIEITSLGKMVSVTL---V 244

Query: 258 YPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATFL 317
           YP  ++KS +Q+    + K++  +  + K I A +G    +KG    +VR+ P    TF 
Sbjct: 245 YPFQLLKSNLQSFRANEQKFR--LFPLIKLIIANDGFVGLYKGLSANLVRAIPSTCITFC 302

Query: 318 TFE 320
            +E
Sbjct: 303 VYE 305

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 41/186 (22%), Positives = 78/186 (41%), Gaps = 23/186 (12%)

Query: 141 PLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKL---KAQGG 197
           PL +  + GL+ G V + +  P++ +++RLQ   ++     + GP+  IK++    A  G
Sbjct: 8   PLQKEVISGLSAGSVTTLVVHPLDLLKVRLQLSATSAQKAHY-GPFMVIKEIIRSSANSG 66

Query: 198 ------LMRGLFPTMIRAGHGLGTYFLVY---EALVAREI---------GTGLTRNEIPP 239
                 L RGL   +       G YF +Y   + L+ + +         G G   +++  
Sbjct: 67  RSVTNELYRGLSINLFGNAIAWGVYFGLYGVTKELIYKSVAKPGETQLKGVG-NDHKMNS 125

Query: 240 WKLCLFGAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFK 299
                 GA SG M  +   P+ V+K+ I +          S+    + +   +G +  +K
Sbjct: 126 LIYLSAGASSGLMTAILTNPIWVIKTRIMSTSKGAQGAYTSMYNGVQQLLRTDGFQGLWK 185

Query: 300 GFGPTM 305
           G  P +
Sbjct: 186 GLVPAL 191

>Kwal_23.3965
          Length = 307

 Score = 62.8 bits (151), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 52/194 (26%), Positives = 89/194 (45%), Gaps = 14/194 (7%)

Query: 133 DLSRSNTLPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKL 192
            L +   +P+ Q  V G   G+    + +P++ ++IRLQ Q +N  + ++ G     K+L
Sbjct: 5   HLRKGQEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLAN--EAQYGGILVTFKRL 62

Query: 193 KAQGG---LMRGLFPTMIRAGHGLGTYFLVYEALVAREIGTGLTRNEIPPW-KLCLFGAF 248
             Q G   L +G  P M        T F  Y  L        L+++++P      + GA 
Sbjct: 63  VRQEGVRALWKGNVPAMAMYILYGSTQFTSYAIL-----NKLLSKSQLPAQIHTGMVGAL 117

Query: 249 SGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRS 308
           SGT   +  YP DV+++    +  R+    +++   A+ I+  EG R FFKG   ++V  
Sbjct: 118 SGTCSAIASYPCDVLRTRFIANHSREL---STMLSTAQEIWRHEGFRGFFKGVSSSIVSI 174

Query: 309 APVNGATFLTFELV 322
           A    +   T+E V
Sbjct: 175 AVATSSILATYESV 188

 Score = 32.3 bits (72), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 20/92 (21%), Positives = 41/92 (44%), Gaps = 14/92 (15%)

Query: 80  KNEGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNT 139
           ++EG   F+KG  + ++ + +  S      E++K F +     + P+  S  + L  S+ 
Sbjct: 156 RHEGFRGFFKGVSSSIVSIAVATSSILATYESVKIFCE-----QRPDRDSSVIQLLESSA 210

Query: 140 LPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQ 171
                     +  G+V+  +  PI+ +R R Q
Sbjct: 211 ---------SVIAGIVSKTIVFPIDTVRKRYQ 233

>ADL009W [1733] [Homologous to ScYIL006W - SH; ScYEL006W - SH]
           complement(693078..694217) [1140 bp, 379 aa]
          Length = 379

 Score = 63.2 bits (152), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 62/254 (24%), Positives = 107/254 (42%), Gaps = 37/254 (14%)

Query: 80  KNEGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNT 139
           ++EGV   YKG    +LG      + F V E  K+ + +Y                    
Sbjct: 136 RDEGVAGLYKGLAPIVLGYFPTWMLYFSVYEKCKQRYPSY-------------------- 175

Query: 140 LP--LSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDR-EFKGPWDCIKKLKAQG 196
           LP     +    LT G +++ L +PI  ++ RL  Q+    D   ++   D  +K+    
Sbjct: 176 LPGGFVSHAASALTAGAISTALTNPIWVVKTRLMIQSDVSRDSTNYRSTLDAFRKMYRSE 235

Query: 197 GL---MRGLFPTMIRAGHGLGTYFLVYEAL---VAREI----GTGLTRNEIPPWKLCLFG 246
           GL     GL P++    H +  +F VYE L   + R      G  L  N++   +L +  
Sbjct: 236 GLKVFYSGLVPSLFGLFH-VAIHFPVYEKLKIWLHRNTPAADGQRLDHNKLQLDRLIVAS 294

Query: 247 AFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMV 306
             S  +  +  YP +++++ +Q   +R      S+  +   I A EG   F+ GF   +V
Sbjct: 295 CLSKVVASVITYPHEILRTRMQ---VRHSGVPPSLLNLLGRIRASEGYVGFYSGFATNLV 351

Query: 307 RSAPVNGATFLTFE 320
           R+ P +  T ++FE
Sbjct: 352 RTVPASVITLVSFE 365

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/167 (25%), Positives = 71/167 (42%), Gaps = 15/167 (8%)

Query: 147 VCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFK---GPWDCIKKLKAQGGLMRGLF 203
           V G   G V+  +  P++  + RLQ Q +  G+R ++   G    I + +   GL +GL 
Sbjct: 89  VSGALAGFVSGIMVCPLDVAKTRLQAQGAGSGERYYRGIVGTLSAILRDEGVAGLYKGLA 148

Query: 204 PTMIRAGHGLGTYFLVYEALVAR---EIGTGLTRNEIPPWKLCLFGAFSGTMLWLTVYPL 260
           P ++        YF VYE    R    +  G   +          GA S  +      P+
Sbjct: 149 PIVLGYFPTWMLYFSVYEKCKQRYPSYLPGGFVSHAASALTA---GAISTAL----TNPI 201

Query: 261 DVVKS--IIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTM 305
            VVK+  +IQ+D  R      S     + +Y  EG++ F+ G  P++
Sbjct: 202 WVVKTRLMIQSDVSRDSTNYRSTLDAFRKMYRSEGLKVFYSGLVPSL 248

 Score = 30.4 bits (67), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 32/76 (42%), Gaps = 1/76 (1%)

Query: 246 GAFSGTMLWLTVYPLDVVKSIIQNDDL-RKPKYKNSISYVAKTIYAKEGIRAFFKGFGPT 304
           GA +G +  + V PLDV K+ +Q        +Y   I      I   EG+   +KG  P 
Sbjct: 91  GALAGFVSGIMVCPLDVAKTRLQAQGAGSGERYYRGIVGTLSAILRDEGVAGLYKGLAPI 150

Query: 305 MVRSAPVNGATFLTFE 320
           ++   P     F  +E
Sbjct: 151 VLGYFPTWMLYFSVYE 166

>CAGL0J04114g complement(384321..385232) similar to sp|Q99297
           Saccharomyces cerevisiae YOR222w ODC2 or sp|Q03028
           Saccharomyces cerevisiae YPL134c ODC1, start by
           similarity
          Length = 303

 Score = 62.4 bits (150), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 72/259 (27%), Positives = 111/259 (42%), Gaps = 42/259 (16%)

Query: 80  KNEGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNT 139
           K EG    YKG  +P+L      + +F  N++ ++ F+               DL   + 
Sbjct: 62  KREGFSRLYKGISSPMLMEAPKRATKFACNDSYQKMFK---------------DLYGVDK 106

Query: 140 LPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQGGLM 199
           L      + G   GV  + +  P E ++IRLQ   S     +F GP + + K   + G++
Sbjct: 107 LTQQISILSGSLAGVTEACVIVPFELVKIRLQDVNS-----KFNGPMEVVFKTIRETGIL 161

Query: 200 ---RGLFPTMIRAGHGLGTYFLVY---EALVAR-EIGTGLTRNEIPPWKLCLFGAFSGTM 252
               GL  TM R     G YF V     AL+ + +  T  T N++      + G   G  
Sbjct: 162 SLYNGLESTMWRNAFWNGGYFGVIFQIRALLPKAKTNTEKTTNDL------IAGTIGGYC 215

Query: 253 LWLTVYP-LDVVKSIIQN-------DDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPT 304
            + T +  L VVKS IQ+       D    PKY  +   + K IY++EG  A +KGF P 
Sbjct: 216 RYSTEHTILSVVKSRIQSGATTTLADGTVVPKYNWTWPSLFK-IYSEEGFTALYKGFIPK 274

Query: 305 MVRSAPVNGATFLTFELVM 323
           ++R  P  G   + F  +M
Sbjct: 275 ILRLGPGGGIMLVVFNGMM 293

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 45/185 (24%), Positives = 78/185 (42%), Gaps = 16/185 (8%)

Query: 140 LPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQ--TSNGGDREFKGPWDCIKKLKAQGG 197
           LP    +V G   GV    +  P++ ++ R+Q Q  +  G    + G  DC+ ++  + G
Sbjct: 6   LPFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREG 65

Query: 198 ---LMRGLFPTMIRAGHGLGTYFLV---YEALVAREIGTGLTRNEIPPWKLCLFGAFSGT 251
              L +G+   M+       T F     Y+ +     G      +I      L G+ +G 
Sbjct: 66  FSRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQIS----ILSGSLAGV 121

Query: 252 MLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPV 311
                + P ++VK  +Q+ +    K+   +  V KTI  + GI + + G   TM R+A  
Sbjct: 122 TEACVIVPFELVKIRLQDVN---SKFNGPMEVVFKTI-RETGILSLYNGLESTMWRNAFW 177

Query: 312 NGATF 316
           NG  F
Sbjct: 178 NGGYF 182

>KLLA0D14036g complement(1203522..1204817) some similarities with
           sp|P40556 Saccharomyces cerevisiae YIL006w, hypothetical
           start
          Length = 431

 Score = 62.8 bits (151), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 66/267 (24%), Positives = 107/267 (40%), Gaps = 50/267 (18%)

Query: 80  KNEGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNT 139
           ++E +   YKG +  +LG      + F V E  K  +  Y                  N 
Sbjct: 170 RDESIRGLYKGIVPIVLGYFPTWMIYFSVYERCKLSYPRY-----------------FNN 212

Query: 140 LPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNG--GDREFKGPWDC-IKKLKAQG 196
                + +  LT G +++ L +PI  ++ RL  Q+     G   +K   D  IK  K +G
Sbjct: 213 SEFLSHSMSALTAGAISTTLTNPIWVVKTRLMLQSGKNIKGMTHYKNTLDAFIKIYKVEG 272

Query: 197 --GLMRGLFPTMIRAGHGLGTYFLVYEALV---------------------AREIGTGLT 233
                 GL P++    H +  +F VYE L                      +    TG T
Sbjct: 273 IKSFYSGLIPSLFGLLH-VAIHFPVYEKLKKVLHCYPSGRPNQETMNVNGNSNPQTTGST 331

Query: 234 RNEIPPWKLCLFGAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEG 293
             ++   +L +    S  +     YP +++++ +Q     KP    SI  + +T YAKEG
Sbjct: 332 NFQLG--RLIVASCGSKMIASTLTYPHEILRTRLQLKSDMKP----SIKSIIRTTYAKEG 385

Query: 294 IRAFFKGFGPTMVRSAPVNGATFLTFE 320
           IR F+ GF   M R+ P +  T ++FE
Sbjct: 386 IRGFYSGFLTNMFRTVPASAITLVSFE 412

>ACR260W [1307] [Homologous to ScYJL133W (MRS3) - SH; ScYKR052C
           (MRS4) - SH] complement(823895..824830) [936 bp, 311 aa]
          Length = 311

 Score = 62.4 bits (150), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 59/249 (23%), Positives = 102/249 (40%), Gaps = 34/249 (13%)

Query: 82  EGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTLP 141
           EG  A +KG  + +LG G   +V          +F  Y   K+  +  +D    R    P
Sbjct: 74  EGSLALWKGVQSVVLGAGPAHAV----------YFATYEMCKSRLIDPED----RQTHQP 119

Query: 142 LSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQGGLMRG 201
           L +  + G    V    L +P + I+ RLQ   S+   +       C  ++  + G+   
Sbjct: 120 L-KTALSGTLATVAADALMNPFDTIKQRLQLHPSDSMTK-------CAVRMYQREGIAAF 171

Query: 202 LF--PTMIRAGHGLGTY-FLVYEALVAREIGTGLTRNEIPPWKLCLFGAFSGTMLWLTVY 258
            +  PT I          F++YE+  + +I      N   PW  CL G  SG        
Sbjct: 172 FYSYPTTIAMNIPFAALNFVIYES--STKIFN--PSNNYNPWIHCLCGGISGATCAAITT 227

Query: 259 PLDVVKSIIQ---NDDLRKPKYKNSISY--VAKTIYAKEGIRAFFKGFGPTMVRSAPVNG 313
           PLD VK+++Q    D ++   +K + ++   A  I+   G   FF+G  P ++ + P   
Sbjct: 228 PLDCVKTVLQIRGADSVQSQLFKEADTFRKAASAIHKTYGWSGFFRGLKPRIISNMPATA 287

Query: 314 ATFLTFELV 322
            ++ ++E  
Sbjct: 288 ISWTSYEFA 296

 Score = 56.2 bits (134), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 46/186 (24%), Positives = 76/186 (40%), Gaps = 13/186 (6%)

Query: 141 PLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDC---IKKLKAQGG 197
           PL      G   G++   +  PI+ I+ R+Q  ++ G     + P +    I K+    G
Sbjct: 16  PLVYQLAAGAFAGIMEHSIMFPIDAIKTRMQAVSTTGSSAATRLPSNMLAQIAKISTTEG 75

Query: 198 ---LMRGLFPTMIRAGHGLGTYFLVYEALVAREIGTGLTRNEIPPWKLCLFGAFSGTMLW 254
              L +G+   ++ AG     YF  YE   +R I     R    P K  L G  +     
Sbjct: 76  SLALWKGVQSVVLGAGPAHAVYFATYEMCKSRLIDPE-DRQTHQPLKTALSGTLATVAAD 134

Query: 255 LTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGA 314
             + P D +K  +Q          +S++  A  +Y +EGI AFF  +  T+  + P    
Sbjct: 135 ALMNPFDTIKQRLQLHP------SDSMTKCAVRMYQREGIAAFFYSYPTTIAMNIPFAAL 188

Query: 315 TFLTFE 320
            F+ +E
Sbjct: 189 NFVIYE 194

 Score = 35.8 bits (81), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 42/84 (50%), Gaps = 10/84 (11%)

Query: 246 GAFSGTMLWLTVYPLDVVKSIIQ-------NDDLRKPKYKNSISYVAKTIYAKEGIRAFF 298
           GAF+G M    ++P+D +K+ +Q       +   R P   N ++ +AK I   EG  A +
Sbjct: 24  GAFAGIMEHSIMFPIDAIKTRMQAVSTTGSSAATRLPS--NMLAQIAK-ISTTEGSLALW 80

Query: 299 KGFGPTMVRSAPVNGATFLTFELV 322
           KG    ++ + P +   F T+E+ 
Sbjct: 81  KGVQSVVLGAGPAHAVYFATYEMC 104

>YEL006W (YEL006W) [1417] chr5 (144326..145333) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1008 bp, 335 aa]
          Length = 335

 Score = 62.4 bits (150), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 62/253 (24%), Positives = 105/253 (41%), Gaps = 33/253 (13%)

Query: 80  KNEGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNT 139
           K+EG    YKG    +LG    + + F V +    F + Y+    P+             
Sbjct: 93  KDEGAAGLYKGLQPTVLGYIPTLMIYFSVYD----FCRKYSVDIFPHS------------ 136

Query: 140 LPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGG-DREFKGPWDCIKKLKAQGG- 197
            P        +T G +++   +PI  ++ RL  QT  G     +KG  D  +K+  Q G 
Sbjct: 137 -PFLSNASSAITAGAISTVATNPIWVVKTRLMLQTGIGKYSTHYKGTIDTFRKIIQQEGA 195

Query: 198 --LMRGLFPTMIRAGHGLGTYFLVYEALVAR-------EIGTGLTRNEIPPWKLCLFGAF 248
             L  GL P ++     +   F +YE L  R       ++ T +T +     KL L    
Sbjct: 196 KALYAGLVPALL-GMLNVAIQFPLYENLKIRFGYSESTDVSTDVTSSNF--QKLILASML 252

Query: 249 SGTMLWLTVYPLDVVKSIIQ-NDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVR 307
           S  +     YP +++++ +Q   DL     ++ +  + K  Y +EG   F+ GF   +VR
Sbjct: 253 SKMVASTVTYPHEILRTRMQLKSDLPNTVQRHLLPLI-KITYRQEGFAGFYSGFATNLVR 311

Query: 308 SAPVNGATFLTFE 320
           + P    T ++FE
Sbjct: 312 TVPAAVVTLVSFE 324

 Score = 37.0 bits (84), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 44/173 (25%), Positives = 72/173 (41%), Gaps = 21/173 (12%)

Query: 147 VCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDRE------FKGPWDCIKKLKAQGGLMR 200
           + G   G +++ L  P +  + RLQ Q       +      F G +  I K +   GL +
Sbjct: 43  ISGALSGALSAMLVCPFDVAKTRLQAQGLQNMTHQSQHYKGFFGTFATIFKDEGAAGLYK 102

Query: 201 GLFPTMIRAGHGLGTYFLVYEALVAREIGTGLTRNEIPPWKLCLFGAFS----GTMLWLT 256
           GL PT++     L  YF VY+      +       +I P    L  A S    G +  + 
Sbjct: 103 GLQPTVLGYIPTLMIYFSVYDFCRKYSV-------DIFPHSPFLSNASSAITAGAISTVA 155

Query: 257 VYPLDVVKS-IIQNDDLRK--PKYKNSISYVAKTIYAKEGIRAFFKGFGPTMV 306
             P+ VVK+ ++    + K    YK +I    K I  +EG +A + G  P ++
Sbjct: 156 TNPIWVVKTRLMLQTGIGKYSTHYKGTIDTFRKII-QQEGAKALYAGLVPALL 207

 Score = 33.5 bits (75), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 34/77 (44%), Gaps = 6/77 (7%)

Query: 239 PWKLCLFGAFSGTMLWLTVYPLDVVKSIIQNDDLR-----KPKYKNSISYVAKTIYAKEG 293
           P    + GA SG +  + V P DV K+ +Q   L+        YK      A TI+  EG
Sbjct: 38  PRVAAISGALSGALSAMLVCPFDVAKTRLQAQGLQNMTHQSQHYKGFFGTFA-TIFKDEG 96

Query: 294 IRAFFKGFGPTMVRSAP 310
               +KG  PT++   P
Sbjct: 97  AAGLYKGLQPTVLGYIP 113

>YNL083W (YNL083W) [4507] chr14 (471377..473014) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1638 bp, 545 aa]
          Length = 545

 Score = 62.8 bits (151), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 64/255 (25%), Positives = 112/255 (43%), Gaps = 35/255 (13%)

Query: 83  GVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTLPL 142
           G+ AFY G    ++ V    S++FG  E  K+        ++        DLS+ +T   
Sbjct: 300 GIKAFYVGNGLNVIKVFPESSIKFGSFEVTKKIMTKLEGCRDTK------DLSKFST--- 350

Query: 143 SQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGP---WDCIKKLKAQGGL- 198
              Y+ G   G+   F   PI+ ++ R+Q       D + KG    +   K +  +GGL 
Sbjct: 351 ---YIAGGLAGMAAQFSVYPIDTLKFRVQCAPL---DTKLKGNNLLFQTAKDMFREGGLR 404

Query: 199 ---------MRGLFPTMIRAGHGLGTYFLVYEALVAREIGT-GLTRNEIPPWKLCLF--G 246
                    + G+FP    A   LGT+  + +  +A++  T  L ++++    L +   G
Sbjct: 405 LFYRGVTVGIVGIFPY---AALDLGTFSALKKWYIAKQAKTLNLPQDQVTLSNLVVLPMG 461

Query: 247 AFSGTMLWLTVYPLDVVKSIIQND-DLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTM 305
           AFSGT+    VYP++++++ +Q       P   N    V      +EG +  FKG  PT+
Sbjct: 462 AFSGTVGASVVYPINLLRTRLQAQGTYAHPYVYNGFKDVLLKTLEREGYQGLFKGLVPTL 521

Query: 306 VRSAPVNGATFLTFE 320
            +  P    ++L +E
Sbjct: 522 AKVCPAVSISYLCYE 536

 Score = 51.6 bits (122), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 41/144 (28%), Positives = 67/144 (46%), Gaps = 10/144 (6%)

Query: 83  GVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTLPL 142
           G+  FY+G    ++G+    ++  G   A+K+++    A K  N+    V LS    LP+
Sbjct: 402 GLRLFYRGVTVGIVGIFPYAALDLGTFSALKKWYIAKQA-KTLNLPQDQVTLSNLVVLPM 460

Query: 143 SQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCI-KKLKAQG--GLM 199
                 G   G V + +  PI  +R RLQ Q +      + G  D + K L+ +G  GL 
Sbjct: 461 ------GAFSGTVGASVVYPINLLRTRLQAQGTYAHPYVYNGFKDVLLKTLEREGYQGLF 514

Query: 200 RGLFPTMIRAGHGLGTYFLVYEAL 223
           +GL PT+ +    +   +L YE L
Sbjct: 515 KGLVPTLAKVCPAVSISYLCYENL 538

 Score = 37.7 bits (86), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 51/227 (22%), Positives = 93/227 (40%), Gaps = 31/227 (13%)

Query: 129 SQDVDLSRSNTLPLSQ-------YYVCGLTGGVVNSFLASPIEQIRIRLQTQT------- 174
           ++DVDLS    + L         +++ G   GV++    +P +++++ L  +T       
Sbjct: 207 NEDVDLSSEGDVTLINDFIRGFGFFIAGGISGVISRTCTAPFDRLKVFLIARTDLSSILL 266

Query: 175 SNGGDREFKGPWDCIKKL-----KAQGGLMRGLFPTMIRAGHGLGTYFLVYEAL------ 223
           ++  D   K P   I K+     KA   L R         G+GL    +  E+       
Sbjct: 267 NSKTDLLAKNPNADINKISSPLAKAVKSLYRQGGIKAFYVGNGLNVIKVFPESSIKFGSF 326

Query: 224 -VAREIGTGL----TRNEIPPWKLCLFGAFSGTMLWLTVYPLDVVKSIIQNDDLR-KPKY 277
            V ++I T L       ++  +   + G  +G     +VYP+D +K  +Q   L  K K 
Sbjct: 327 EVTKKIMTKLEGCRDTKDLSKFSTYIAGGLAGMAAQFSVYPIDTLKFRVQCAPLDTKLKG 386

Query: 278 KNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATFLTFELVMR 324
            N +   AK ++ + G+R F++G    +V   P       TF  + +
Sbjct: 387 NNLLFQTAKDMFREGGLRLFYRGVTVGIVGIFPYAALDLGTFSALKK 433

>CAGL0J05522g complement(524930..526489) highly similar to sp|P48233
           Saccharomyces cerevisiae YNL083w, hypothetical start
          Length = 519

 Score = 61.6 bits (148), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 65/253 (25%), Positives = 109/253 (43%), Gaps = 31/253 (12%)

Query: 83  GVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTLPL 142
           G+ +FY G     L V    S++FG  E  K+        K+        DLS+ +T   
Sbjct: 273 GIKSFYVGNGLNALKVFPESSIKFGSFEITKKLMTKVENCKDTK------DLSKLST--- 323

Query: 143 SQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQGGL---- 198
              ++ G   GV   F   PI+ ++ R+Q    N   +  K      K++  +GGL    
Sbjct: 324 ---FIAGGLAGVCAQFSVYPIDTLKFRMQCAPLNAELKGRKLMIQTAKEMYTEGGLKLFY 380

Query: 199 ------MRGLFPTMIRAGHGLGTYFLV---YEALVAREIGTGLTRNEIPPWKLCLFGAFS 249
                 + G+FP    A   LGT+ ++   Y +  A+++       E+    +   GAFS
Sbjct: 381 RGVTVGVLGIFPY---AALDLGTFSMLKKWYISSKAKKLNKKEEDVELSNLVVLPMGAFS 437

Query: 250 GTMLWLTVYPLDVVKSIIQND-DLRKP-KYKNSISYVAKTIYAKEGIRAFFKGFGPTMVR 307
           GT     VYP++++++ +Q       P +Y      + KTI  +EG    FKG  PT+ +
Sbjct: 438 GTFGATVVYPINLLRTRLQAQGTFAHPYRYDGFRDVLLKTI-QREGYPGLFKGLVPTLAK 496

Query: 308 SAPVNGATFLTFE 320
             P    ++L +E
Sbjct: 497 VCPAVSISYLCYE 509

 Score = 53.9 bits (128), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 40/144 (27%), Positives = 68/144 (47%), Gaps = 10/144 (6%)

Query: 83  GVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTLPL 142
           G+  FY+G    +LG+    ++  G    +K+++ +  A K  N   +DV+LS    LP+
Sbjct: 375 GLKLFYRGVTVGVLGIFPYAALDLGTFSMLKKWYISSKA-KKLNKKEEDVELSNLVVLPM 433

Query: 143 SQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCI-KKLKAQG--GLM 199
                 G   G   + +  PI  +R RLQ Q +      + G  D + K ++ +G  GL 
Sbjct: 434 ------GAFSGTFGATVVYPINLLRTRLQAQGTFAHPYRYDGFRDVLLKTIQREGYPGLF 487

Query: 200 RGLFPTMIRAGHGLGTYFLVYEAL 223
           +GL PT+ +    +   +L YE L
Sbjct: 488 KGLVPTLAKVCPAVSISYLCYENL 511

 Score = 30.4 bits (67), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 49/233 (21%), Positives = 94/233 (40%), Gaps = 43/233 (18%)

Query: 129 SQDVDLSRSNTLPLSQ-------YYVCGLTGGVVNSFLASPIEQIRIRLQTQT------- 174
           ++DVDLS    + L         +++ G   GV++    +P +++++ L  +T       
Sbjct: 180 NEDVDLSSEGDMTLINDFIKGFGFFIAGGISGVISRTCTAPFDRLKVFLIARTDLSSTLL 239

Query: 175 SNGGDREFKGPWDCIKKLKA-----------QGGLMRGLFPTMIRAGHGLGTYFLVYEAL 223
           ++  D   K P     KL++           QGG+           G+GL    +  E+ 
Sbjct: 240 NSTEDVLAKNPHAKPNKLRSPLVKAIISLYRQGGI------KSFYVGNGLNALKVFPESS 293

Query: 224 V---AREIGTGL------TRNEIPPWKLCLF--GAFSGTMLWLTVYPLDVVKSIIQNDDL 272
           +   + EI   L       ++     KL  F  G  +G     +VYP+D +K  +Q   L
Sbjct: 294 IKFGSFEITKKLMTKVENCKDTKDLSKLSTFIAGGLAGVCAQFSVYPIDTLKFRMQCAPL 353

Query: 273 RKP-KYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATFLTFELVMR 324
               K +  +   AK +Y + G++ F++G    ++   P       TF ++ +
Sbjct: 354 NAELKGRKLMIQTAKEMYTEGGLKLFYRGVTVGVLGIFPYAALDLGTFSMLKK 406

>Scas_578.3*
          Length = 524

 Score = 61.6 bits (148), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 65/256 (25%), Positives = 105/256 (41%), Gaps = 37/256 (14%)

Query: 83  GVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTLPL 142
           G+ AFY G    +  +    S++FG  E  KR   N +  K  N      DLS+  T   
Sbjct: 279 GLRAFYVGNGLSVFKICPESSIKFGTFELAKRLMANLSGDKLVN------DLSKLQT--- 329

Query: 143 SQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQGGL---- 198
              YV G   GV+      PI+ ++ R+Q     G  +         K++  +GG+    
Sbjct: 330 ---YVAGGIAGVMAQISIYPIDTLKFRIQCAPLEGNLKGNALLISTAKEMYKEGGIRVFY 386

Query: 199 ------MRGLFPTMIRAGHGLGTYFLVYEALVAREIGTGLTRNEIPPWKLCL-------F 245
                   G+FP    A   LGT+  + +  + R+      +  IP   + L        
Sbjct: 387 RGVLLGALGIFPY---AALDLGTFSALKKWYIKRQS----KKLNIPEKDVMLSYLLVLPM 439

Query: 246 GAFSGTMLWLTVYPLDVVKSIIQ-NDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPT 304
           GAFSGT+    VYP++++++ +Q       P        V      +EG+  F+KG  PT
Sbjct: 440 GAFSGTVGATAVYPINLLRTRLQAQGTYAHPYTYTGFRDVFMQTLKREGVPGFYKGLVPT 499

Query: 305 MVRSAPVNGATFLTFE 320
           +V+  P     +L +E
Sbjct: 500 LVKVCPAVSIGYLCYE 515

 Score = 56.6 bits (135), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 44/149 (29%), Positives = 69/149 (46%), Gaps = 10/149 (6%)

Query: 80  KNEGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNT 139
           K  G+  FY+G L   LG+    ++  G   A+K+++     SK  N+  +DV LS    
Sbjct: 378 KEGGIRVFYRGVLLGALGIFPYAALDLGTFSALKKWYIK-RQSKKLNIPEKDVMLSYLLV 436

Query: 140 LPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDC-IKKLKAQG-- 196
           LP+      G   G V +    PI  +R RLQ Q +      + G  D  ++ LK +G  
Sbjct: 437 LPM------GAFSGTVGATAVYPINLLRTRLQAQGTYAHPYTYTGFRDVFMQTLKREGVP 490

Query: 197 GLMRGLFPTMIRAGHGLGTYFLVYEALVA 225
           G  +GL PT+++    +   +L YE   A
Sbjct: 491 GFYKGLVPTLVKVCPAVSIGYLCYEKFKA 519

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 50/208 (24%), Positives = 89/208 (42%), Gaps = 43/208 (20%)

Query: 129 SQDVDLSRSNTLPLSQ-------YYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGD-- 179
           ++DVDLS    + L         Y++ G   GV++    +P+++I++ L  +T       
Sbjct: 188 NEDVDLSSEGDMTLINDFIKGFGYFIAGGLSGVISRTCTAPLDRIKVFLIARTDLSSTLL 247

Query: 180 -------------REFKGP-WDCIKKLKAQGGLMRGLFPTMIRAGHGLGTY--------- 216
                         + + P    I+ L  QGGL R  +      G+GL  +         
Sbjct: 248 NPKMHLRIQGLNLAKIRSPIIKAIRSLYRQGGL-RAFY-----VGNGLSVFKICPESSIK 301

Query: 217 ---FLVYEALVAREIGTGLTRNEIPPWKLCLFGAFSGTMLWLTVYPLDVVKSIIQNDDLR 273
              F + + L+A   G  L  N++   +  + G  +G M  +++YP+D +K  IQ   L 
Sbjct: 302 FGTFELAKRLMANLSGDKLV-NDLSKLQTYVAGGIAGVMAQISIYPIDTLKFRIQCAPLE 360

Query: 274 KPKYKNSISY-VAKTIYAKEGIRAFFKG 300
                N++    AK +Y + GIR F++G
Sbjct: 361 GNLKGNALLISTAKEMYKEGGIRVFYRG 388

 Score = 33.5 bits (75), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 32/129 (24%), Positives = 54/129 (41%), Gaps = 19/129 (14%)

Query: 215 TYFLVYEALV--AREIGTGLTRNEIPPWKLCLFGAFSGTMLWLTVYPLDVVKS-IIQNDD 271
           +YF ++   V  + E    L  + I  +   + G  SG +      PLD +K  +I   D
Sbjct: 182 SYFYLFNEDVDLSSEGDMTLINDFIKGFGYFIAGGLSGVISRTCTAPLDRIKVFLIARTD 241

Query: 272 LRK----------------PKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGAT 315
           L                   K ++ I    +++Y + G+RAF+ G G ++ +  P +   
Sbjct: 242 LSSTLLNPKMHLRIQGLNLAKIRSPIIKAIRSLYRQGGLRAFYVGNGLSVFKICPESSIK 301

Query: 316 FLTFELVMR 324
           F TFEL  R
Sbjct: 302 FGTFELAKR 310

>CAGL0K08250g complement(820185..821078) highly similar to sp|P23500
           Saccharomyces cerevisiae YKR052c Mitochondrial RNA
           splicing protein, hypothetical start
          Length = 297

 Score = 60.1 bits (144), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 58/252 (23%), Positives = 100/252 (39%), Gaps = 44/252 (17%)

Query: 82  EGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTLP 141
           EG  A +KG  + +LG G   +V          +F  Y  SK+  +  QD+   +     
Sbjct: 67  EGSLALWKGVQSVILGAGPAHAV----------YFATYEFSKSKLIDPQDMHTHQPIKTA 116

Query: 142 LSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQGGLMRG 201
           +S     G+    V   L +P + I+ R+Q  T     RE    W   K +  + G    
Sbjct: 117 IS-----GMAATTVADALMNPFDVIKQRMQLNT-----RE--SVWHVTKNIYHKEGFAAF 164

Query: 202 L--FPTMIRAGHGLGTY-FLVYEALVAREIGTGLTR--NEIPPWKLCLFGAFSGTMLWLT 256
              +PT +        + F +YE+       T      NE  P+  C+ G  SG      
Sbjct: 165 YYSYPTTLVMNIPFAAFNFAIYES------ATKFMNPSNEYNPFIHCISGGLSGATCAAI 218

Query: 257 VYPLDVVKSIIQ--------NDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRS 308
             PLD +K+++Q        N+ +++    N+    A  IY   G + F +G  P ++ +
Sbjct: 219 TTPLDCIKTVLQVRGSETVSNEIMKQ---ANTFQRAASAIYKIHGWKGFLRGLKPRVIAN 275

Query: 309 APVNGATFLTFE 320
            P    ++ ++E
Sbjct: 276 MPATAISWTSYE 287

 Score = 59.3 bits (142), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 43/180 (23%), Positives = 76/180 (42%), Gaps = 7/180 (3%)

Query: 141 PLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQGGLMR 200
           PL    + G   G++   +  P++ I+ R+Q+ +S    +        I   +    L +
Sbjct: 15  PLHHQLLAGAFAGIMEHSVLFPVDAIKTRIQSSSSGAATQGLIKQISKITTAEGSLALWK 74

Query: 201 GLFPTMIRAGHGLGTYFLVYEALVAREIGTGLTRNEIPPWKLCLFGAFSGTMLWLTVYPL 260
           G+   ++ AG     YF  YE   ++ I          P K  + G  + T+    + P 
Sbjct: 75  GVQSVILGAGPAHAVYFATYEFSKSKLIDPQDMHTH-QPIKTAISGMAATTVADALMNPF 133

Query: 261 DVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATFLTFE 320
           DV+K  +Q +       + S+ +V K IY KEG  AF+  +  T+V + P     F  +E
Sbjct: 134 DVIKQRMQLNT------RESVWHVTKNIYHKEGFAAFYYSYPTTLVMNIPFAAFNFAIYE 187

>KLLA0F04697g complement(461126..462049) similar to sp|P40464
           Saccharomyces cerevisiae YIL134w FLX1 FAD carrier
           protein (MCF), mitochondrial, start by similarity
          Length = 307

 Score = 60.1 bits (144), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 57/242 (23%), Positives = 109/242 (45%), Gaps = 23/242 (9%)

Query: 88  YKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTLPLSQYYV 147
           Y+G    ++G  +   + FG+    K     Y+ S  P + ++ ++      +  S Y V
Sbjct: 74  YRGLGINIIGNAVAWGLYFGLYRCSKDVV--YSLSSEPALQNKFMN---DRKMTSSMYLV 128

Query: 148 CGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQGGL---MRGLFP 204
                G+  + L +P+  I+ R+ +  S+ G   +    + I ++  + GL    RGL P
Sbjct: 129 SAGASGLATALLTNPMWVIKTRIMSTKSSQG---YTSILNAITRIYTEEGLKTFWRGLVP 185

Query: 205 TMIRAGHGLGTYFLVYEALVAREIGTGLTRNEIPPWKLCLFG-----AFSGTMLWLTVYP 259
           ++     G   YF +Y+ L  + +     RN+I   +L         + S  +   +VYP
Sbjct: 186 SLFGVTQG-ALYFAIYDTLKLKYLHD---RNDIQERRLNAVETIGIISLSKMISVSSVYP 241

Query: 260 LDVVKSIIQNDDLRKPKYKNS-ISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATFLT 318
           L ++K+ +Q    R    +NS ++ + ++I+   GI  F+KG    +VR+ P    TF  
Sbjct: 242 LQLLKTNLQT--FRTEHNENSKMNSLIRSIWHTNGIAGFYKGLFANLVRAIPSTCITFGV 299

Query: 319 FE 320
           +E
Sbjct: 300 YE 301

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/185 (22%), Positives = 78/185 (42%), Gaps = 28/185 (15%)

Query: 141 PLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQGG--- 197
           PL +  + GLT G + + +  P++ I++RLQ       D +    ++ ++++   G    
Sbjct: 11  PLQKEIISGLTAGTITTIVTHPLDLIKLRLQLA---AIDLKPSSYYNQVQRIIKDGSGTQ 67

Query: 198 -----LMRGLFPTMIRAGHGLGTYFLVYEALVAREIGTGLT------------RNEIPPW 240
                  RGL   +I      G YF +Y    ++++   L+            R      
Sbjct: 68  QLLKEAYRGLGINIIGNAVAWGLYFGLYRC--SKDVVYSLSSEPALQNKFMNDRKMTSSM 125

Query: 241 KLCLFGAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKG 300
            L   GA SG    L   P+ V+K+ I +   +  +   SI      IY +EG++ F++G
Sbjct: 126 YLVSAGA-SGLATALLTNPMWVIKTRIMST--KSSQGYTSILNAITRIYTEEGLKTFWRG 182

Query: 301 FGPTM 305
             P++
Sbjct: 183 LVPSL 187

>Kwal_27.12081
          Length = 369

 Score = 60.1 bits (144), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 53/199 (26%), Positives = 94/199 (47%), Gaps = 23/199 (11%)

Query: 145 YYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKL-KAQG--GLMRG 201
           + +   T G   S   +PI  I+ RLQ   + G  R++K  WDC+K + + +G  GL +G
Sbjct: 170 HLISAATAGWATSTATNPIWLIKTRLQLDKA-GHTRQYKNSWDCLKHIIQKEGFFGLYKG 228

Query: 202 LFPTMIRAGHGLGTYFLVYEALVA----REI--------GTGLTRNEIPPWKLCLFGAFS 249
           L  + + +  G+   +L+YE +      R I        G   T  +I  W  C     +
Sbjct: 229 LSASYLGSVEGI-LQWLLYEQMKQMIKMRSIEKFGHISEGEKNTSEKIKEW--CQRSGSA 285

Query: 250 GTMLWLT---VYPLDVVKSIIQNDDLRKPKYKNS-ISYVAKTIYAKEGIRAFFKGFGPTM 305
           G   +L     YP +VV++ ++   L   K K + +    + I  +EG+ + + G  P +
Sbjct: 286 GLAKFLASIVTYPHEVVRTRLRQAPLENDKLKYTGLIQSFRVIIKEEGLASMYGGLTPHL 345

Query: 306 VRSAPVNGATFLTFELVMR 324
           +R+ P +   F T+ELV++
Sbjct: 346 LRTVPNSIIMFGTWELVIK 364

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 42/101 (41%), Gaps = 17/101 (16%)

Query: 236 EIPPWKLCLFGAFSGTMLWLTVYPLDVVKSIIQND-------DLRKPKYKNSISY----- 283
           E+ PW   + G   G    +   P DVVK+ +Q+D       +L   K  N +S      
Sbjct: 49  EVKPWVHFVAGGAGGMAGAIVTCPFDVVKTRLQSDVFQSTYANLSHNKSSNVVSSGIRHF 108

Query: 284 -----VAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATFLTF 319
                +   +Y  EG R+ FKG GP +V   P     F T+
Sbjct: 109 RETFGIISNLYKLEGFRSLFKGLGPNLVGVIPARSINFFTY 149

 Score = 32.7 bits (73), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 42/173 (24%), Positives = 70/173 (40%), Gaps = 28/173 (16%)

Query: 159 LASPIEQIRIRLQT-------------QTSN---GGDREFKGPWDCIKKL-KAQG--GLM 199
           +  P + ++ RLQ+             ++SN    G R F+  +  I  L K +G   L 
Sbjct: 69  VTCPFDVVKTRLQSDVFQSTYANLSHNKSSNVVSSGIRHFRETFGIISNLYKLEGFRSLF 128

Query: 200 RGLFPTMIRAGHGLGTYFLVY---EALVAREIGTGLTRNEIPPWKLCLFGAFSGTMLWLT 256
           +GL P ++         F  Y   + + +R    G    E  PW   +  A +G      
Sbjct: 129 KGLGPNLVGVIPARSINFFTYGTTKQIYSRAFNNG----EEAPWIHLISAATAGWATSTA 184

Query: 257 VYPLDVVKSIIQNDDL-RKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRS 308
             P+ ++K+ +Q D      +YKNS   + K I  KEG    +KG   + + S
Sbjct: 185 TNPIWLIKTRLQLDKAGHTRQYKNSWDCL-KHIIQKEGFFGLYKGLSASYLGS 236

>Sklu_2363.2 YPR011C, Contig c2363 11969-12940
          Length = 323

 Score = 58.9 bits (141), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 64/238 (26%), Positives = 102/238 (42%), Gaps = 34/238 (14%)

Query: 103 SVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTLPLSQYYVCGLTGGVVNSFLAS- 161
           +VQF V EA K+ F + + SK            R       + +   L GG   S LA+ 
Sbjct: 95  AVQFVVYEACKKHFFHVDGSKG-----------REQLQNWQRLFSGALCGGC--SVLATY 141

Query: 162 PIEQIRIRLQTQTSN----GGDREFK-----GPWDCI-KKLKAQGG---LMRGLFPTMIR 208
           P++ +R RL  QT+N       R        G WD + +  K +GG   L RG++PT + 
Sbjct: 142 PLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLG 201

Query: 209 AGHGLGTYFLVYEALVAREIGTGLTRNEIPPWKLCLFGAFSGTMLWLTVYPLDVVKSIIQ 268
               +   F VYE    +E     T N +  +     GA SG +     YP D+++   Q
Sbjct: 202 VVPYVALNFAVYEQF--KEFMPEGTDNTLANFYKLSIGALSGGVAQTVTYPFDLLRRRFQ 259

Query: 269 ----NDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATFLTFELV 322
                 +    +YK+ +  +  TI   EG R ++KG    + +  P    ++L +E+V
Sbjct: 260 VLAMGGNELGFRYKSVMDALI-TIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYEVV 316

 Score = 34.3 bits (77), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 34/77 (44%), Gaps = 1/77 (1%)

Query: 244 LFGAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGP 303
           L G  +G +    V P + VK ++Q  +     Y   I    + +Y +EG    F+G G 
Sbjct: 27  LAGGLAGAVSRTVVSPFERVKILLQVQN-STTAYNQGIVGAVRQVYREEGTPGLFRGNGL 85

Query: 304 TMVRSAPVNGATFLTFE 320
             +R  P +   F+ +E
Sbjct: 86  NCIRIFPYSAVQFVVYE 102

>Scas_379.2
          Length = 301

 Score = 58.5 bits (140), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 54/247 (21%), Positives = 95/247 (38%), Gaps = 34/247 (13%)

Query: 82  EGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTLP 141
           EG  A +KG  + +LG G   +V F   E  K++           +  +D+   +     
Sbjct: 73  EGSLALWKGVQSVILGAGPAHAVYFATYEYTKKYL----------IDEKDMQTHQPLKTA 122

Query: 142 LSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQGGLMRG 201
           LS     G    +    L +P + ++ R+Q  T+          W+  K++    G    
Sbjct: 123 LS-----GTVATIAADALMNPFDTLKQRMQLNTNTT-------VWNVTKQIYKNEGFSAF 170

Query: 202 LF--PTMIRAGHGLGTY-FLVYEALVAREIGTGLTRNEIPPWKLCLFGAFSGTMLWLTVY 258
            +  PT +        + F++YE+       T    N+  P   CL G  SG        
Sbjct: 171 YYSYPTTLAMNIPFAAFNFMIYESATKFFNPT----NDYNPLVHCLSGGLSGATCAAITT 226

Query: 259 PLDVVKSIIQ-----NDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNG 313
           PLD +K+++Q     +  L+  K  N+     K IY   G + F++G  P +  + P   
Sbjct: 227 PLDCIKTVLQVRGSESVSLQVMKEANTFQKATKAIYQVHGAKGFWRGLQPRVFANMPATA 286

Query: 314 ATFLTFE 320
             +  +E
Sbjct: 287 IAWTAYE 293

 Score = 47.8 bits (112), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 42/194 (21%), Positives = 78/194 (40%), Gaps = 9/194 (4%)

Query: 128 SSQDVDL-SRSNTLPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPW 186
           +++++D  +  ++ PLS   + G   G++   +  PI+ ++ R+Q+ TS           
Sbjct: 8   TAEEIDYEALPDSAPLSHQLLAGAFAGIMEHSVMFPIDALKTRIQS-TSAKSTSNMLSQM 66

Query: 187 DCIKKLKAQGGLMRGLFPTMIRAGHGLGTYFLVYEALVAREIGTGLTRNEIPPWKLCLFG 246
             I   +    L +G+   ++ AG     YF  YE      I     +    P K  L G
Sbjct: 67  AKISTAEGSLALWKGVQSVILGAGPAHAVYFATYEYTKKYLIDEKDMQTH-QPLKTALSG 125

Query: 247 AFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMV 306
             +       + P D +K  +Q +         ++  V K IY  EG  AF+  +  T+ 
Sbjct: 126 TVATIAADALMNPFDTLKQRMQLNT------NTTVWNVTKQIYKNEGFSAFYYSYPTTLA 179

Query: 307 RSAPVNGATFLTFE 320
            + P     F+ +E
Sbjct: 180 MNIPFAAFNFMIYE 193

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 48/104 (46%), Gaps = 3/104 (2%)

Query: 221 EALVAREIGTGLTRNEIPPWKLCLFGAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNS 280
           E   A EI      +  P     L GAF+G M    ++P+D +K+ IQ+   +     N 
Sbjct: 5   EISTAEEIDYEALPDSAPLSHQLLAGAFAGIMEHSVMFPIDALKTRIQSTSAKST--SNM 62

Query: 281 ISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATFLTFELVMR 324
           +S +AK I   EG  A +KG    ++ + P +   F T+E   +
Sbjct: 63  LSQMAK-ISTAEGSLALWKGVQSVILGAGPAHAVYFATYEYTKK 105

 Score = 35.8 bits (81), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 42/187 (22%), Positives = 71/187 (37%), Gaps = 26/187 (13%)

Query: 25  EKRELSSNRVLKDIFAGTIGGIAQVLVGQPFDXXXXXXXXXXXXXXXXXXXXXXXKNEGV 84
           +++++ +++ LK   +GT+  IA   +  PFD                       KNEG 
Sbjct: 109 DEKDMQTHQPLKTALSGTVATIAADALMNPFD-TLKQRMQLNTNTTVWNVTKQIYKNEGF 167

Query: 85  FAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTLPLSQ 144
            AFY    T L       +  F + E+  +FF       NP   + D +       PL  
Sbjct: 168 SAFYYSYPTTLAMNIPFAAFNFMIYESATKFF-------NP---TNDYN-------PLVH 210

Query: 145 YYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDRE-------FKGPWDCIKKLKAQGG 197
               GL+G    + + +P++ I+  LQ + S     +       F+     I ++    G
Sbjct: 211 CLSGGLSGATCAA-ITTPLDCIKTVLQVRGSESVSLQVMKEANTFQKATKAIYQVHGAKG 269

Query: 198 LMRGLFP 204
             RGL P
Sbjct: 270 FWRGLQP 276

>Sklu_2431.5 YBR192W, Contig c2431 8526-9638
          Length = 370

 Score = 58.9 bits (141), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 65/266 (24%), Positives = 117/266 (43%), Gaps = 42/266 (15%)

Query: 80  KNEGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNT 139
           +NEG  + +KG    L+GV    S+ F      K  +     SK  N   + V +     
Sbjct: 123 RNEGFRSLFKGLGPNLVGVIPARSINFFTYGTTKEIY-----SKTLNNGQEAVWI----- 172

Query: 140 LPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKL-KAQG-- 196
                + +   T G   S   +PI  ++ RLQ   + G  +++K  WDC+K + + +G  
Sbjct: 173 -----HLMAAATAGWATSTATNPIWLVKTRLQLDKA-GTTKKYKNSWDCLKNVVQKEGIL 226

Query: 197 GLMRGLFPTMIRAGHGLGTYFLVYEALVA-------------REIGTGLTRNEIPPWKLC 243
           GL +GL  + + +  G+  + L YE +                E+    T ++I  W  C
Sbjct: 227 GLYKGLSASYLGSVEGILQWVL-YEQMKHIIKQRSMEKFGNISEVEKS-TSDKIKEW--C 282

Query: 244 LFGAFSGTMLW---LTVYPLDVVKSIIQNDDLR--KPKYKNSISYVAKTIYAKEGIRAFF 298
                +G   +   +  YP +VV++ ++   L   K KY   +  + + I  +EG+ + +
Sbjct: 283 QRSGSAGLAKFVASIITYPHEVVRTRLRQAPLENGKLKYTGLVQSI-RVIIKEEGLASMY 341

Query: 299 KGFGPTMVRSAPVNGATFLTFELVMR 324
            G  P ++R+ P +   F T+ELV+R
Sbjct: 342 GGLTPHLLRTVPNSIIMFGTWELVIR 367

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 41/104 (39%), Gaps = 20/104 (19%)

Query: 236 EIPPWKLCLFGAFSGTMLWLTVYPLDVVKSIIQNDDLRK----------PKYKNSISY-- 283
           E+ PW   + G   G    +   P DVVK+ +Q+D  +           P   N I+   
Sbjct: 49  EVKPWVHFVAGGIGGMAGAVVTCPFDVVKTRLQSDVFQAAYKSHAKSIGPNQANVIAQGV 108

Query: 284 --------VAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATFLTF 319
                   +   +Y  EG R+ FKG GP +V   P     F T+
Sbjct: 109 RHFKETFGIISNVYRNEGFRSLFKGLGPNLVGVIPARSINFFTY 152

 Score = 28.9 bits (63), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 40/174 (22%), Positives = 63/174 (36%), Gaps = 27/174 (15%)

Query: 159 LASPIEQIRIRLQTQTSNG-------------------GDREFKGPWDCIKKLKAQGG-- 197
           +  P + ++ RLQ+                        G R FK  +  I  +    G  
Sbjct: 69  VTCPFDVVKTRLQSDVFQAAYKSHAKSIGPNQANVIAQGVRHFKETFGIISNVYRNEGFR 128

Query: 198 -LMRGLFPTMIRAGHGLGTYFLVYEALVAREI-GTGLTRNEIPPWKLCLFGAFSGTMLWL 255
            L +GL P ++         F  Y     +EI    L   +   W   +  A +G     
Sbjct: 129 SLFKGLGPNLVGVIPARSINFFTYG--TTKEIYSKTLNNGQEAVWIHLMAAATAGWATST 186

Query: 256 TVYPLDVVKSIIQNDDL-RKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRS 308
              P+ +VK+ +Q D      KYKNS   + K +  KEGI   +KG   + + S
Sbjct: 187 ATNPIWLVKTRLQLDKAGTTKKYKNSWDCL-KNVVQKEGILGLYKGLSASYLGS 239

>Sklu_2115.4 YDL119C, Contig c2115 2906-3805
          Length = 299

 Score = 57.8 bits (138), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 47/186 (25%), Positives = 81/186 (43%), Gaps = 19/186 (10%)

Query: 143 SQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQGGLMRGL 202
           S + + G  GG+ ++ +  P + ++ RLQ       D      W  +K++++   L RG 
Sbjct: 8   SSHLIGGFVGGLTSAIVLQPFDLLKTRLQ----QNKDTTL---WGTLKEIRSPKQLWRGA 60

Query: 203 FPTMIRAGHGLGTYFLVYEAL-VAREIGTGLTRN-------EIPPWKLCLFGAFSGTMLW 254
            P+ +R   G   Y         A   G   T N       ++  ++    GAF+  ++ 
Sbjct: 61  LPSSLRTSIGSALYLSTLNVFRTAMAKGKTQTLNPGSSFLPQLTMYENLASGAFTRGVVG 120

Query: 255 LTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGA 314
               P+ ++K   ++       YK S+    + IY+ EGIR FF G G T++R AP  G 
Sbjct: 121 FITMPITIIKVRYESTMY---SYK-SLGEATRHIYSTEGIRGFFNGCGATVMRDAPYAGL 176

Query: 315 TFLTFE 320
             L +E
Sbjct: 177 YVLLYE 182

>Sklu_2374.7 YNL083W, Contig c2374 13874-15415 reverse complement
          Length = 513

 Score = 58.5 bits (140), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 59/252 (23%), Positives = 109/252 (43%), Gaps = 29/252 (11%)

Query: 83  GVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTLPL 142
           G+ AFY G    ++ V    +++FG  E  K+   +     + +      +LS+ +T   
Sbjct: 268 GIRAFYVGNGLNVIKVFPESAMKFGSFELAKQLMAHLEGVHHTS------ELSKFST--- 318

Query: 143 SQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQGGL---- 198
              Y+ G  GGVV  F   PI+ ++ R+Q    +   +  +      +++   GGL    
Sbjct: 319 ---YIAGGMGGVVAQFSVYPIDTLKYRVQCAPLDTALKGNELLISTARQMYRDGGLKLFY 375

Query: 199 ------MRGLFPTMIRAGHGLGTYFLVYEALVARE---IGTGLTRNEIPPWKLCLFGAFS 249
                 + G+FP    A   LGT+  + +  +AR+    G  + +  I  + +   GAFS
Sbjct: 376 RGVTVGVMGIFP---YAALDLGTFSALKKWYIARQAKMTGVPVDQVTISNFIVLPMGAFS 432

Query: 250 GTMLWLTVYPLDVVKSIIQ-NDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRS 308
           GT+    VYP++++++ +Q       P        V      +EG +  FKG  P + + 
Sbjct: 433 GTVGATVVYPINLLRTRLQAQGTYAHPHTYTGFRDVLWKTVQREGYQGLFKGLVPNLAKV 492

Query: 309 APVNGATFLTFE 320
            P    ++L +E
Sbjct: 493 CPAVSISYLCYE 504

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 36/145 (24%), Positives = 66/145 (45%), Gaps = 10/145 (6%)

Query: 80  KNEGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNT 139
           ++ G+  FY+G    ++G+    ++  G   A+K+++    A K   +    V +S    
Sbjct: 367 RDGGLKLFYRGVTVGVMGIFPYAALDLGTFSALKKWYIARQA-KMTGVPVDQVTISNFIV 425

Query: 140 LPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCI-KKLKAQG-- 196
           LP+      G   G V + +  PI  +R RLQ Q +      + G  D + K ++ +G  
Sbjct: 426 LPM------GAFSGTVGATVVYPINLLRTRLQAQGTYAHPHTYTGFRDVLWKTVQREGYQ 479

Query: 197 GLMRGLFPTMIRAGHGLGTYFLVYE 221
           GL +GL P + +    +   +L YE
Sbjct: 480 GLFKGLVPNLAKVCPAVSISYLCYE 504

 Score = 35.0 bits (79), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 33/59 (55%)

Query: 264 KSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATFLTFELV 322
           K +++N +    K K+ +   A T+Y + GIRAF+ G G  +++  P +   F +FEL 
Sbjct: 239 KVLMKNPNADISKIKSPLIKAATTLYRQGGIRAFYVGNGLNVIKVFPESAMKFGSFELA 297

>Kwal_0.232
          Length = 274

 Score = 57.0 bits (136), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 62/243 (25%), Positives = 101/243 (41%), Gaps = 28/243 (11%)

Query: 81  NEGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTL 140
           N G    Y+G  + ++      S+ F   + MK    +Y+     N+ +    ++ + T 
Sbjct: 43  NGGYLGVYRGLGSAVVASAPSASLFFVTYDGMK----SYSRPIFNNLITSSDQVAETATH 98

Query: 141 PLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQGG--- 197
             S        G +    +  P E I+ R QT  S+   +  K      K L+ + G   
Sbjct: 99  MFSSS-----AGEIAACMVRVPAEVIKQRTQTHKSDSSLQTLK------KLLQNENGEGI 147

Query: 198 ---LMRGLFPTMIRAGHGLGTYFLVYEALVAREIGTGLTRNEIPPWKLCLFGAFSGTMLW 254
              L RG   T++R        F +YE L  +   +G  R ++ PW+    G  +G +  
Sbjct: 148 RRNLYRGWSTTVMREIPFTCIQFPLYEFLKKQWAISG-GREQVAPWQGAFCGCVAGGIAA 206

Query: 255 LTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGA 314
            T  PLDV+K+ +       P     + ++A+ IYA EG + FF G GP  V  +   GA
Sbjct: 207 ATTTPLDVLKTRLMLSHTSVP-----VLHLARQIYATEGWKVFFSGVGPRTVWIS-AGGA 260

Query: 315 TFL 317
            FL
Sbjct: 261 IFL 263

 Score = 30.0 bits (66), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 34/77 (44%), Gaps = 15/77 (19%)

Query: 244 LFGAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGP 303
           L GA +GT   L  +P+D +K+ +Q                A   +A  G    ++G G 
Sbjct: 11  LAGAAAGTSTDLFFFPIDTLKTRLQ---------------AAGGFFANGGYLGVYRGLGS 55

Query: 304 TMVRSAPVNGATFLTFE 320
            +V SAP     F+T++
Sbjct: 56  AVVASAPSASLFFVTYD 72

>Kwal_27.11419
          Length = 298

 Score = 57.0 bits (136), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 45/187 (24%), Positives = 84/187 (44%), Gaps = 22/187 (11%)

Query: 145 YYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQGGLMRGLFP 204
           +++ G  GG+ ++ +  P + ++ RLQ   S+          D ++ ++  G L +G  P
Sbjct: 10  HFIGGFVGGLTSAVILQPFDLLKTRLQQNKSSN-------LLDVVRSIETPGQLWKGTLP 62

Query: 205 TMIRAGHG----LGTYFLVYEALVAREIGTGLTRN-------EIPPWKLCLFGAFSGTML 253
           + +R   G    L T  +V  A+  + +     +N       ++  ++  + GA +   +
Sbjct: 63  SALRTSVGSALFLSTLNIVRSAIADKRVKGIAGKNGSSSFLPQLSMYENLISGAITRAAV 122

Query: 254 WLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNG 313
            +   P+ V+K   ++       YK S+   A  IY  EGIR  F G G T++R AP  G
Sbjct: 123 GVATMPITVLKVRFESTMY---NYK-SLGEAATHIYRSEGIRGLFSGCGATVMRDAPYAG 178

Query: 314 ATFLTFE 320
              L +E
Sbjct: 179 LYVLFYE 185

>CAGL0F04213g 419473..420393 highly similar to sp|P18239
           Saccharomyces cerevisiae YBL030c AAC2 ADP/ATP carrier
           protein, hypothetical start
          Length = 306

 Score = 57.0 bits (136), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 54/181 (29%), Positives = 81/181 (44%), Gaps = 11/181 (6%)

Query: 149 GLTGGVVNSFLASPIEQIRIRLQTQ---TSNGGDREFKGPWDCIKKLKAQ---GGLMRGL 202
           G+ GG+   F+ S ++  R RL      +  GG+R+F G  D  KK  A     GL RG 
Sbjct: 123 GIAGGLSLMFVYS-LDYARTRLAADAKSSKKGGERQFNGLVDVYKKTIASDGVAGLYRGF 181

Query: 203 FPTMIRAGHGLGTYFLVYEALVAREIGTGLTRNEIPPWKLCLFGAFSGTMLWLTVYPLDV 262
            P++I      G YF +Y++     +   L  + I  +   L G    T      YPLD 
Sbjct: 182 LPSVIGIVVYRGLYFGLYDSCKPLLLTGSLEGSFIASF---LLGWVVTTGASTASYPLDT 238

Query: 263 VKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATFLTFELV 322
           V+  +     +  KYK ++  + K I A EG+ + FKG G  ++R     G   L  +L 
Sbjct: 239 VRRRMMMTSGQAVKYKGAMDCLQK-IVAAEGVSSLFKGCGANILRGVAGAGVISLYDQLQ 297

Query: 323 M 323
           M
Sbjct: 298 M 298

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 46/183 (25%), Positives = 76/183 (41%), Gaps = 20/183 (10%)

Query: 141 PLSQYYVCGLTGGV---VNSFLASPIEQIRIRLQTQ----TSNGGDREFKGPWDCIKKLK 193
           P S + +  L GGV   V    ASPIE++++ +Q Q         D  +KG  DC ++  
Sbjct: 7   PQSNFAIDFLMGGVSAAVAKTAASPIERVKLLIQNQDEMIKQGSLDHRYKGIVDCFQRTA 66

Query: 194 AQGGLM---RGLFPTMIRAGHGLGTYFLVYEALVAREIGTGLTRNE-IPPWKL--CLFGA 247
            Q G++   RG    +IR        F   + + A     G  + E    W       G 
Sbjct: 67  RQEGIISFWRGNTANVIRYFPTQALNFAFKDQIKAM---FGFKKEEGYAKWFAGNLASGG 123

Query: 248 FSGTMLWLTVYPLDVVKSIIQNDDLRKPKYK----NSISYVAKTIYAKEGIRAFFKGFGP 303
            +G +  + VY LD  ++ +  D     K      N +  V K   A +G+   ++GF P
Sbjct: 124 IAGGLSLMFVYSLDYARTRLAADAKSSKKGGERQFNGLVDVYKKTIASDGVAGLYRGFLP 183

Query: 304 TMV 306
           +++
Sbjct: 184 SVI 186

 Score = 30.8 bits (68), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 31/138 (22%), Positives = 62/138 (44%), Gaps = 22/138 (15%)

Query: 81  NEGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTL 140
           ++GV   Y+G L  ++G+ +   + FG+ ++ K           P + +  ++ S   + 
Sbjct: 171 SDGVAGLYRGFLPSVIGIVVYRGLYFGLYDSCK-----------PLLLTGSLEGSFIASF 219

Query: 141 PLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQGG--- 197
            L        TG    S+   P++ +R R+    ++G   ++KG  DC++K+ A  G   
Sbjct: 220 LLGWVVT---TGASTASY---PLDTVRRRM--MMTSGQAVKYKGAMDCLQKIVAAEGVSS 271

Query: 198 LMRGLFPTMIRAGHGLGT 215
           L +G    ++R   G G 
Sbjct: 272 LFKGCGANILRGVAGAGV 289

 Score = 28.5 bits (62), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 37/79 (46%), Gaps = 7/79 (8%)

Query: 244 LFGAFSGTMLWLTVYPLDVVKSIIQN-DDLRK-----PKYKNSISYVAKTIYAKEGIRAF 297
           L G  S  +      P++ VK +IQN D++ K      +YK  +    +T   +EGI +F
Sbjct: 16  LMGGVSAAVAKTAASPIERVKLLIQNQDEMIKQGSLDHRYKGIVDCFQRTA-RQEGIISF 74

Query: 298 FKGFGPTMVRSAPVNGATF 316
           ++G    ++R  P     F
Sbjct: 75  WRGNTANVIRYFPTQALNF 93

>YKL120W (OAC1) [3145] chr11 (216990..217964) Mitochondrial
           oxaloacetate transporter, member of the mitochondrial
           carrier (MCF) family of membrane transporters [975 bp,
           324 aa]
          Length = 324

 Score = 56.2 bits (134), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 62/245 (25%), Positives = 101/245 (41%), Gaps = 37/245 (15%)

Query: 80  KNEGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKN----PNMSSQDVDLS 135
           KNEG+    KG     +        Q G+N +   F++   +S N    P+     V   
Sbjct: 76  KNEGIKGLQKGLNAAYI-------YQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSV 128

Query: 136 RSNTLPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTS---NGGDREFKGPWD---CI 189
             N          G   G++ + + SP+  ++ RLQ+ +     G    + G W+    I
Sbjct: 129 GVNVF-------SGAASGIIGAVIGSPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTI 181

Query: 190 KKLKAQGGLMRGLFPTMIRAGHGLGTYFLVYEALVAREIGTGLTRNEI----PPWKLCLF 245
            K +   GL RG+   ++R G G      +Y    A+ I   L +N++    P   L   
Sbjct: 182 FKTEGVKGLFRGIDAAILRTGAGSSVQLPIYNT--AKNI---LVKNDLMKDGPALHLTA- 235

Query: 246 GAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTM 305
              SG  + + + P DV+ + I N   +   YK  I  + KT+   EG+ A +KGF   +
Sbjct: 236 STISGLGVAVVMNPWDVILTRIYNQ--KGDLYKGPIDCLVKTVRI-EGVTALYKGFAAQV 292

Query: 306 VRSAP 310
            R AP
Sbjct: 293 FRIAP 297

 Score = 35.4 bits (80), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 47/198 (23%), Positives = 84/198 (42%), Gaps = 19/198 (9%)

Query: 128 SSQDVDLSRSNTLPLSQY--YVCGLTGGVVNSFLASPIEQIRIRLQTQ--TSNGGDREFK 183
           S QD  + ++    +S++  +V G     +   + +PIE I+IR+Q Q   S    + +K
Sbjct: 6   SKQDKQIEKTAAQKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYK 65

Query: 184 GPWD---CIKKLKAQGGLMRGLFPTMIRAGHGLGTYFLVYEALVAREIGTGLTRNEIPPW 240
            P      I K +   GL +GL    I      G+    YE +  R     L   +  P 
Sbjct: 66  NPIQGMAVIFKNEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPI--RSSLNQLFFPDQEPH 123

Query: 241 KL------CLFGAFSGTMLWLTVYPLDVVKSIIQNDD----LRKPKYKNSISYVAKTIYA 290
           K+         GA SG +  +   PL +VK+ +Q+      + +  +   +     TI+ 
Sbjct: 124 KVQSVGVNVFSGAASGIIGAVIGSPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFK 183

Query: 291 KEGIRAFFKGFGPTMVRS 308
            EG++  F+G    ++R+
Sbjct: 184 TEGVKGLFRGIDAAILRT 201

>CAGL0K11616g complement(1121834..1122796) highly similar to
           sp|P32332 Saccharomyces cerevisiae YKL120w, hypothetical
           start
          Length = 320

 Score = 56.2 bits (134), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 61/245 (24%), Positives = 101/245 (41%), Gaps = 37/245 (15%)

Query: 80  KNEGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKN----PNMSSQDVDLS 135
           +NEG+    KG +   +        Q  +N +   F++   A  N    P+  S  V   
Sbjct: 72  RNEGIRGLQKGLVAAYI-------YQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSV 124

Query: 136 RSNTLPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSN---GGDREFKGPWDCIKKL 192
             N          G   G++ + + SP+  ++ RLQ+ ++    G    + G W+ +K +
Sbjct: 125 GINVF-------AGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTI 177

Query: 193 ---KAQGGLMRGLFPTMIRAGHGLGTYFLVYEALVAREIGTGLTRNEI----PPWKLCLF 245
              +   GL RG+   ++R G G      +Y    A+     L RN+I    P   L   
Sbjct: 178 YMTEGVKGLFRGIDAAILRTGAGSSVQLPIYNT--AKNF---LLRNDIMEDGPSLHLTA- 231

Query: 246 GAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTM 305
              SG  + + + P DV+ + I N   +   YK  I  + KT+   EGI A +KGF   +
Sbjct: 232 STISGLGVAVVMNPWDVILTRIYNQ--KGDLYKGPIDCLVKTVKI-EGITALYKGFEAQV 288

Query: 306 VRSAP 310
            R  P
Sbjct: 289 FRIGP 293

 Score = 34.7 bits (78), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 46/204 (22%), Positives = 89/204 (43%), Gaps = 29/204 (14%)

Query: 127 MSSQDVDLSRSNTLPLSQY--YVCGLTGGVVNSFLASPIEQIRIRLQTQTS--NGGDREF 182
           M+  +  + +S    +S++  +  G     +   + +PIE ++IR+Q Q        R +
Sbjct: 1   MAKGEDKIQKSAAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIY 60

Query: 183 KGPWDCIKKL-KAQG--GLMRGLFPTMIRAGHGLGTYFLVYE---ALVAREIGTGLTRNE 236
             P+  +  + + +G  GL +GL    I      G+    YE   A++ +        ++
Sbjct: 61  TNPFQAMGVVFRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHK 120

Query: 237 IPPWKLCLF-GAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSI------SYVA---- 285
           +    + +F GA SG +  +   PL +VK+ +Q+       Y N+I       Y      
Sbjct: 121 VQSVGINVFAGAASGIIGAVMGSPLFLVKTRLQS-------YSNAIKIGEQTHYTGVWNG 173

Query: 286 -KTIYAKEGIRAFFKGFGPTMVRS 308
            KTIY  EG++  F+G    ++R+
Sbjct: 174 LKTIYMTEGVKGLFRGIDAAILRT 197

>Kwal_33.14050
          Length = 314

 Score = 55.8 bits (133), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 58/250 (23%), Positives = 98/250 (39%), Gaps = 36/250 (14%)

Query: 81  NEGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTL 140
            EG  A +KG  + +LG G   +V F   E  K +           +  QD    +    
Sbjct: 74  TEGSMALWKGVQSVILGAGPAHAVYFATYEMCKSYL----------IDPQDFQTHQ---- 119

Query: 141 PLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQGGLMR 200
           PL +    G+   V    L +P + I+ R+Q +T +  DR     W    ++    GL  
Sbjct: 120 PL-KTAASGIAATVAADLLMNPFDTIKQRMQLRTFSK-DRM----WSVASRIYRNEGLAA 173

Query: 201 GLF--PTMIRAGHGLGTY-FLVYEALVAREIGTGL--TRNEIPPWKLCLFGAFSGTMLWL 255
             +  PT I        + F +YE+       T      N   P   CL G  SG     
Sbjct: 174 FFYSYPTTIAMNIPFAAFNFAIYES------ATKFFNPENTYNPLIHCLCGGISGATCAA 227

Query: 256 TVYPLDVVKSIIQ---NDDLRKPKYK--NSISYVAKTIYAKEGIRAFFKGFGPTMVRSAP 310
              PLD +K+++Q   ++ +  P ++  ++ S  A  I    G   F++G  P ++ + P
Sbjct: 228 ITTPLDCIKTVLQVRGSESVVDPLFRQADTFSRAASAISKVYGWSGFWRGLKPRIISNMP 287

Query: 311 VNGATFLTFE 320
               ++  +E
Sbjct: 288 ATAISWTAYE 297

 Score = 47.4 bits (111), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 43/188 (22%), Positives = 75/188 (39%), Gaps = 13/188 (6%)

Query: 141 PLSQYYVCGLTGGVVNSFLASPIEQIRIRLQ--TQTSNGGDREFKGPWDCIKKL------ 192
           PL+     G   G++   +  PI+ I+ R+Q  + T    +   K P + ++++      
Sbjct: 15  PLTHQLAAGAFAGIMEHSIMFPIDAIKTRMQALSATIGSANAAAKLPSNIVQQIARISTT 74

Query: 193 KAQGGLMRGLFPTMIRAGHGLGTYFLVYEALVAREIGTGLTRNEIPPWKLCLFGAFSGTM 252
           +    L +G+   ++ AG     YF  YE   +  I     +    P K    G  +   
Sbjct: 75  EGSMALWKGVQSVILGAGPAHAVYFATYEMCKSYLIDPQDFQTH-QPLKTAASGIAATVA 133

Query: 253 LWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVN 312
             L + P D +K  +Q     K +  +    VA  IY  EG+ AFF  +  T+  + P  
Sbjct: 134 ADLLMNPFDTIKQRMQLRTFSKDRMWS----VASRIYRNEGLAAFFYSYPTTIAMNIPFA 189

Query: 313 GATFLTFE 320
              F  +E
Sbjct: 190 AFNFAIYE 197

 Score = 34.3 bits (77), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 41/86 (47%), Gaps = 12/86 (13%)

Query: 246 GAFSGTMLWLTVYPLDVVKSIIQ---------NDDLRKPKYKNSISYVAKTIYAKEGIRA 296
           GAF+G M    ++P+D +K+ +Q         N   + P   N +  +A+ I   EG  A
Sbjct: 23  GAFAGIMEHSIMFPIDAIKTRMQALSATIGSANAAAKLPS--NIVQQIAR-ISTTEGSMA 79

Query: 297 FFKGFGPTMVRSAPVNGATFLTFELV 322
            +KG    ++ + P +   F T+E+ 
Sbjct: 80  LWKGVQSVILGAGPAHAVYFATYEMC 105

>CAGL0M05225g 563163..564308 highly similar to sp|P38127
           Saccharomyces cerevisiae YBR192w RIM2 mitochondrial
           carrier protein, start by similarity
          Length = 381

 Score = 55.1 bits (131), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 48/181 (26%), Positives = 89/181 (49%), Gaps = 19/181 (10%)

Query: 161 SPIEQIRIRLQTQTSNGGDREFKGPWDCIKK-LKAQG--GLMRGLFPTMIRAGHGLGTYF 217
           +PI  ++ R+Q   + G  R +K  +DC+K  L+ +G  GL RGL  + + +  G+   +
Sbjct: 198 NPIWMVKTRVQLDKA-GKTRTYKNSYDCLKSILRNEGIYGLYRGLSASYLGSVEGI-LQW 255

Query: 218 LVYEALV------------AREIGTGLTRNEIPPWKLCLFGA-FSGTMLWLTVYPLDVVK 264
           L+YE L             A +  T  T ++I  W     GA  +  M  +  YP +VV+
Sbjct: 256 LLYEQLKHLIKKRSIEKFGAHDESTMTTTDKIKQWCQRSGGAGLAKFMASIVTYPHEVVR 315

Query: 265 SIIQNDDLRKPKYKNS-ISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATFLTFELVM 323
           + ++   L   K K + +    + I  +EG+ + + G  P ++R+ P +   F T+E+V+
Sbjct: 316 TRLRQSPLENGKVKYTGLVQSFRVIIKEEGLASMYSGLTPHLMRTVPNSIIMFGTWEVVI 375

Query: 324 R 324
           +
Sbjct: 376 K 376

 Score = 37.7 bits (86), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 27/109 (24%), Positives = 45/109 (41%), Gaps = 27/109 (24%)

Query: 237 IPPWKLCLFGAFSGTMLWLTVYPLDVVKSIIQND---------------DLRKPK----- 276
           + PW   L G   G    +   P D+VK+ +Q+D               +  +P+     
Sbjct: 54  VKPWVHFLAGGIGGMAGAVVTCPFDLVKTRLQSDIYQNMYKSQAEALMMNTTRPRIVNLT 113

Query: 277 ------YKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATFLTF 319
                 +K ++S +   +Y +EG R+ FKG GP +V   P     F T+
Sbjct: 114 LQAATHFKETVSIIG-NVYRQEGFRSLFKGLGPNLVGVIPARSINFFTY 161

>AEL253W [2253] [Homologous to ScYBR192W (RIM2) - SH]
           complement(164665..165762) [1098 bp, 365 aa]
          Length = 365

 Score = 54.7 bits (130), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 50/202 (24%), Positives = 95/202 (47%), Gaps = 27/202 (13%)

Query: 145 YYVCGLTGGVVNSFLASPIEQIRIRLQ-TQTSNGGDREFKGPWDCIKK-LKAQG--GLMR 200
           +++ G T G   S   +PI  ++ RLQ  + ++G  R +K  WDC+K  ++ +G  GL +
Sbjct: 166 HFLAGATAGWATSTATNPIWLVKTRLQLDKAADGRSRRYKNSWDCLKGVMRNEGILGLYK 225

Query: 201 GLFPTMIRAGHGLGTYFLVYEAL-------VAREIGTGLTRNEIPPWKLCLFGAFSGTM- 252
           GL  + + +   +  + L YE +          E G     N+    K+  +   SG+  
Sbjct: 226 GLSASYLGSVESILQWVL-YEQMKHIIRQRSIEEFGDISEENKTTYMKVKEWCQRSGSAG 284

Query: 253 ---LWLTV--YPLDVVKSIIQNDDLRKPKYKNSISYVA-----KTIYAKEGIRAFFKGFG 302
              L+ ++  YP +VV++ ++    + PK    + Y         I  +EG  + + G  
Sbjct: 285 AAKLFASILTYPHEVVRTRLR----QAPKENGKLKYTGLFQSFSLIIKEEGFASMYSGLT 340

Query: 303 PTMVRSAPVNGATFLTFELVMR 324
           P ++R+ P +   F T+ELV++
Sbjct: 341 PHLMRTVPNSIIMFGTWELVIK 362

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 35/77 (45%), Gaps = 16/77 (20%)

Query: 259 PLDVVKSIIQNDDLR-----KPKYKNSISY-----------VAKTIYAKEGIRAFFKGFG 302
           P DVVK+ +Q+D        +   + ++ Y           + + +Y +EG R+ FKG G
Sbjct: 69  PFDVVKTRLQSDVFHGAYKTQATARTNVVYQGLMHFRETVGIIQNVYTQEGFRSLFKGLG 128

Query: 303 PTMVRSAPVNGATFLTF 319
           P +V   P     F T+
Sbjct: 129 PNLVGVIPARSINFFTY 145

 Score = 35.8 bits (81), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 42/169 (24%), Positives = 69/169 (40%), Gaps = 25/169 (14%)

Query: 162 PIEQIRIRLQTQTSNG---------------GDREFKGPWDCIKKLKAQGG---LMRGLF 203
           P + ++ RLQ+   +G               G   F+     I+ +  Q G   L +GL 
Sbjct: 69  PFDVVKTRLQSDVFHGAYKTQATARTNVVYQGLMHFRETVGIIQNVYTQEGFRSLFKGLG 128

Query: 204 PTMIRAGHGLGTYFLVYEALVAREIGTGLTRN-EIPPWKLCLFGAFSGTMLWLTVYPLDV 262
           P ++         F  Y   V ++  + L  + +  PW   L GA +G        P+ +
Sbjct: 129 PNLVGVIPARSINFFTYG--VTKDTASRLLNDGQEAPWIHFLAGATAGWATSTATNPIWL 186

Query: 263 VKSIIQND---DLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRS 308
           VK+ +Q D   D R  +YKNS   + K +   EGI   +KG   + + S
Sbjct: 187 VKTRLQLDKAADGRSRRYKNSWDCL-KGVMRNEGILGLYKGLSASYLGS 234

 Score = 33.9 bits (76), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 30/137 (21%), Positives = 60/137 (43%), Gaps = 15/137 (10%)

Query: 80  KNEGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNT 139
           +NEG+   YKG     LG  +   +Q+ + E MK   +  +  +  ++S ++    ++  
Sbjct: 216 RNEGILGLYKGLSASYLG-SVESILQWVLYEQMKHIIRQRSIEEFGDISEEN----KTTY 270

Query: 140 LPLSQYYVCGLTGG-----VVNSFLASPIEQIRIRLQTQTSNGGDREFKG---PWDCIKK 191
           + + ++  C  +G      +  S L  P E +R RL+      G  ++ G    +  I K
Sbjct: 271 MKVKEW--CQRSGSAGAAKLFASILTYPHEVVRTRLRQAPKENGKLKYTGLFQSFSLIIK 328

Query: 192 LKAQGGLMRGLFPTMIR 208
            +    +  GL P ++R
Sbjct: 329 EEGFASMYSGLTPHLMR 345

>YBR291C (CTP1) [469] chr2 complement(783631..784530) Mitochondrial
           inner membrane citrate transport protein, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [900 bp, 299 aa]
          Length = 299

 Score = 54.3 bits (129), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 70/312 (22%), Positives = 121/312 (38%), Gaps = 52/312 (16%)

Query: 35  LKDIFAGTIGGIAQVLVGQPFDXXXXXXXXXXXXXXXX----XXXXXXXKNEGVFAFYKG 90
           L    AG++ G A+  +  PF+                           K +G+ + Y G
Sbjct: 13  LHSFLAGSLAGAAEACITYPFEFAKTRLQLIDKASKASRNPLVLIYKTAKTQGIGSIYVG 72

Query: 91  ALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTLPLSQYYVCGL 150
               ++G      ++F   + +K   ++                S +  L  ++  + GL
Sbjct: 73  CPAFIIGNTAKAGIRFLGFDTIKDMLRD----------------SETGELSGTRGVIAGL 116

Query: 151 TGGVVNSFLA-SPIEQIRIRL----QTQT---SNGGDREFKGPWDCIKKLKAQGGLMRGL 202
             G++ S  A +P E I+  L    Q+ T    N G R     +  + + K   GL RG+
Sbjct: 117 GAGLLESVAAVTPFEAIKTALIDDKQSATPKYHNNG-RGVVRNYSSLVRDKGFSGLYRGV 175

Query: 203 FPTMIRAGHGLGTYFLVYEALVA-----------REIGTGLTRNEIPPWKLCLFGAFSGT 251
            P  +R           Y  +             + + +GLT          L GAFSG 
Sbjct: 176 LPVSMRQAANQAVRLGCYNKIKTLIQDYTDSPKDKPLSSGLT---------FLVGAFSGI 226

Query: 252 MLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPV 311
           +   +  PLD VK+ +Q+ D    KY ++++  A TI+ +EG++ F+KG  P + R    
Sbjct: 227 VTVYSTMPLDTVKTRMQSLD--STKYSSTMNCFA-TIFKEEGLKTFWKGATPRLGRLVLS 283

Query: 312 NGATFLTFELVM 323
            G  F  +E V+
Sbjct: 284 GGIVFTIYEKVL 295

>Scas_589.10
          Length = 316

 Score = 54.3 bits (129), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 66/254 (25%), Positives = 102/254 (40%), Gaps = 44/254 (17%)

Query: 80  KNEGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNT 139
           K EG    YKG   PLL      +V+F  NE  ++        K         +++ + T
Sbjct: 75  KEEGFKNLYKGMSPPLLMEVPKRAVKFASNEQFQQIMMKKFKLK---------EVTSTVT 125

Query: 140 LPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKL-KAQG-- 196
           L      + G   G+  S +  P E ++IRLQ   S     +++ P  C + + + QG  
Sbjct: 126 L------LAGTFAGITESLIVVPFELVKIRLQDAQS-----DYRSPIRCTRTIIENQGLF 174

Query: 197 GLMRGLFPTMIRAGHGLGTYF-LVYEA--LVAREIGTGL---TRNEIPPWKLCLFGAFSG 250
           G+  G   T+ R      +YF L+++    + R   T      RN+       L GA +G
Sbjct: 175 GIYAGFESTIWRNTIWNASYFGLIFQVKKFIPRAKSTTKFQGIRNDF------LVGAIAG 228

Query: 251 TMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISY-----VAKTIYAKEGIRAFFKGFGPTM 305
            M      P DVVK+ +Q       K  + + Y         IY  EGI+  +KG  P +
Sbjct: 229 CMSCFLSVPFDVVKTRMQGSK----KTSSGMCYGWAWQSVFLIYRTEGIKGIYKGILPII 284

Query: 306 VRSAPVNGATFLTF 319
            R  P  G   + F
Sbjct: 285 CRYGPGGGLLLVVF 298

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 41/211 (19%), Positives = 79/211 (37%), Gaps = 21/211 (9%)

Query: 17  QQKVTTPNEKRELSSNRVLKDIFAGTIGGIAQVLVGQPFDXXXXXXXXXXXXXXX-XXXX 75
           QQ +    + +E++S   L    AGT  GI + L+  PF+                    
Sbjct: 108 QQIMMKKFKLKEVTSTVTL---LAGTFAGITESLIVVPFELVKIRLQDAQSDYRSPIRCT 164

Query: 76  XXXXKNEGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLS 135
               +N+G+F  Y G  + +    I  +  FG+   +K+F     ++        D    
Sbjct: 165 RTIIENQGLFGIYAGFESTIWRNTIWNASYFGLIFQVKKFIPRAKSTTKFQGIRND---- 220

Query: 136 RSNTLPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDC---IKKL 192
                     ++ G   G ++ FL+ P + ++ R+Q          +   W     I + 
Sbjct: 221 ----------FLVGAIAGCMSCFLSVPFDVVKTRMQGSKKTSSGMCYGWAWQSVFLIYRT 270

Query: 193 KAQGGLMRGLFPTMIRAGHGLGTYFLVYEAL 223
           +   G+ +G+ P + R G G G   +V+  +
Sbjct: 271 EGIKGIYKGILPIICRYGPGGGLLLVVFNGV 301

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 42/198 (21%), Positives = 76/198 (38%), Gaps = 23/198 (11%)

Query: 140 LPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGG----------DREFKGPWDCI 189
           LP    ++ G   G+  + +  P++ ++ R Q Q +               E      C+
Sbjct: 11  LPFIYQFISGAVAGMSETIMMYPLDVVKTRFQLQINKKALATSSVAVPKQPEHSSILSCL 70

Query: 190 KKLKAQGG---LMRGLFPTMIRAGHGLGTYFLVYEALVAREIGTGLTRNEIPPWKLCLFG 246
            K+  + G   L +G+ P ++         F   E    + +       E+      L G
Sbjct: 71  SKILKEEGFKNLYKGMSPPLLMEVPKRAVKFASNEQF-QQIMMKKFKLKEVTSTVTLLAG 129

Query: 247 AFSGTMLWLTVYPLDVVKSIIQN--DDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPT 304
            F+G    L V P ++VK  +Q+   D R P          +TI   +G+   + GF  T
Sbjct: 130 TFAGITESLIVVPFELVKIRLQDAQSDYRSP------IRCTRTIIENQGLFGIYAGFEST 183

Query: 305 MVRSAPVNGATF-LTFEL 321
           + R+   N + F L F++
Sbjct: 184 IWRNTIWNASYFGLIFQV 201

>Scas_721.129
          Length = 323

 Score = 54.3 bits (129), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 54/241 (22%), Positives = 99/241 (41%), Gaps = 29/241 (12%)

Query: 80  KNEGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQ----NYNASKNPNMSSQDVDLS 135
           +NEG+    KG +   +        Q G+N +   F++      N++  PN  S  +   
Sbjct: 75  RNEGIRGLQKGLVAAYI-------YQIGLNGSRLGFYEPIRNALNSTFYPNEESHKIQKV 127

Query: 136 RSNTLPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSN---GGDREFKGPWD---CI 189
             N          G + G++ + + SP+  ++ R+Q+ +     G    ++  W+    I
Sbjct: 128 SINV-------AAGASSGIIGAVIGSPLFLVKTRMQSYSDAIKIGEQTHYRNVWNGLSTI 180

Query: 190 KKLKAQGGLMRGLFPTMIRAGHGLGTYFLVYEALVAREIGTGLTRNEIPPWKLCLFGAFS 249
            + +   GL RG+   ++R G G      +Y       +   L ++   P         S
Sbjct: 181 ARTEGFKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLKNDLMKD--GPGLHLTASTIS 238

Query: 250 GTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSA 309
           G  + + + P DV+ + I N   +   YK  +    KT+   EGI A +KGF   ++R A
Sbjct: 239 GLGVAVVMNPWDVILTRIYNQ--KGNLYKGPVDCFVKTVRT-EGISALYKGFQAQILRIA 295

Query: 310 P 310
           P
Sbjct: 296 P 296

>YPR011C (YPR011C) [5447] chr16 complement(583057..584037) Protein
           with similarity to human Grave's disease carrier protein
           and to bovine homolog of Grave's disease protein, member
           of the mitochondrial carrier family (MCF) of membrane
           transporters [981 bp, 326 aa]
          Length = 326

 Score = 53.9 bits (128), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 62/240 (25%), Positives = 101/240 (42%), Gaps = 35/240 (14%)

Query: 103 SVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTLPLSQYYVCGLTGGVVNSFLASP 162
           +VQF V EA K+   + N +              +NT  L    +CG    VV ++   P
Sbjct: 95  AVQFVVYEACKKKLFHVNGNNGQEQ--------LTNTQRLFSGALCG-GCSVVATY---P 142

Query: 163 IEQIRIRLQTQTSNGGDREFK---------GPWDCIKK-LKAQGGL---MRGLFPTMIRA 209
           ++ I+ RL  QT+N                G W  + +  + +GGL    RG++PT +  
Sbjct: 143 LDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETYRLEGGLRGLYRGVWPTSLGV 202

Query: 210 GHGLGTYFLVYEALVAREIGTGLTRNEIPPWKLCLF----GAFSGTMLWLTVYPLDVVKS 265
              +   F VYE L  RE G   + +  P WK  L+    GA SG +     YP D+++ 
Sbjct: 203 VPYVALNFAVYEQL--REFGVN-SSDAQPSWKSNLYKLTIGAISGGVAQTITYPFDLLRR 259

Query: 266 IIQNDDLRKPKY---KNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATFLTFELV 322
             Q   +   +      S+     TI   EG+  ++KG    + +  P    ++L +E+V
Sbjct: 260 RFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPSTAVSWLVYEVV 319

 Score = 34.7 bits (78), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 34/77 (44%), Gaps = 1/77 (1%)

Query: 244 LFGAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGP 303
           L G  +G +    V P + VK ++Q        Y   I    + +Y +EG +  F+G G 
Sbjct: 27  LAGGVAGAVSRTVVSPFERVKILLQVQS-STTSYNRGIFSSIRQVYHEEGTKGLFRGNGL 85

Query: 304 TMVRSAPVNGATFLTFE 320
             +R  P +   F+ +E
Sbjct: 86  NCIRIFPYSAVQFVVYE 102

>Sklu_1149.2 YBR291C, Contig c1149 2019-2909 reverse complement
          Length = 296

 Score = 53.5 bits (127), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 49/187 (26%), Positives = 86/187 (45%), Gaps = 14/187 (7%)

Query: 147 VCGLTGGVVNSFLA-SPIEQIRIRL----QTQT---SNGGDREFKGPWDCIKKLKAQGGL 198
           + GL  G++ S +A +P E I+  L    Q+ T    N G    +     ++K +   GL
Sbjct: 110 IAGLGAGLLESVVAVTPFEAIKTALIDDKQSATPKYHNNGKGMLRNYTALVRK-QGLSGL 168

Query: 199 MRGLFPTMIRAGHGLGTYFLVYEAL--VAREIGTGLTRNEIPPWKLCLFGAFSGTMLWLT 256
            RG+ P  +R           Y  +  + ++         +      + GAFSG +   T
Sbjct: 169 YRGVLPVSMRQAANQAVRLGCYNKIKVMVQDYTNAPKDKPLSSGLTFVVGAFSGIVTVYT 228

Query: 257 VYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATF 316
             P+D VK+ +Q+ D ++  Y ++I+    TI+ +EG++AF+KG  P + R     G  F
Sbjct: 229 TMPIDTVKTRMQSLDSKR--YSSTINCFT-TIFKEEGLKAFWKGATPRLGRLFLSGGIVF 285

Query: 317 LTFELVM 323
             +E V+
Sbjct: 286 TVYEKVL 292

 Score = 37.4 bits (85), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 34/149 (22%), Positives = 62/149 (41%), Gaps = 21/149 (14%)

Query: 80  KNEGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNY-NASKNPNMSSQDVDLSRSN 138
           + +G+   Y+G L   +      +V+ G    +K   Q+Y NA K+  +SS         
Sbjct: 161 RKQGLSGLYRGVLPVSMRQAANQAVRLGCYNKIKVMVQDYTNAPKDKPLSS--------- 211

Query: 139 TLPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQGGL 198
                  +V G   G+V  +   PI+ ++ R+Q+  S    + +    +C   +  + GL
Sbjct: 212 ----GLTFVVGAFSGIVTVYTTMPIDTVKTRMQSLDS----KRYSSTINCFTTIFKEEGL 263

Query: 199 M---RGLFPTMIRAGHGLGTYFLVYEALV 224
               +G  P + R     G  F VYE ++
Sbjct: 264 KAFWKGATPRLGRLFLSGGIVFTVYEKVL 292

 Score = 30.0 bits (66), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 40/186 (21%), Positives = 80/186 (43%), Gaps = 16/186 (8%)

Query: 134 LSRSNTLPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCI---K 190
           +S+S  +  S+ ++ G   G V + +  P E  + RLQ    +   +  + P   I    
Sbjct: 1   MSQSKQVDPSKSFIAGCLAGAVEASVTYPFEFAKTRLQLL--DKASKASRNPLVLIYNTA 58

Query: 191 KLKAQGGLMRGLFPTMIRAGHGLGTYFLVYEAL--VAREIGTGLTRNEIPPWKLCLFGAF 248
           K +  G +  G    ++      G  FL ++ +  + R+  TG    E+   +  + G  
Sbjct: 59  KTQGIGSVYVGCPAFIVGNTAKAGVRFLGFDTIKNLLRDPKTG----ELSGPRGVIAGLG 114

Query: 249 SGTM-LWLTVYPLDVVKS-IIQNDDLRKPKYKNSISYVAKTIYA---KEGIRAFFKGFGP 303
           +G +   + V P + +K+ +I +     PKY N+   + +   A   K+G+   ++G  P
Sbjct: 115 AGLLESVVAVTPFEAIKTALIDDKQSATPKYHNNGKGMLRNYTALVRKQGLSGLYRGVLP 174

Query: 304 TMVRSA 309
             +R A
Sbjct: 175 VSMRQA 180

>KLLA0B12826g 1121106..1122065 similar to sp|P32332 Saccharomyces
           cerevisiae YKL120w PMT, start by similarity
          Length = 319

 Score = 53.1 bits (126), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 62/248 (25%), Positives = 104/248 (41%), Gaps = 43/248 (17%)

Query: 80  KNEGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKN----PNMSSQDVDLS 135
           KNEG+    KG  +  L        Q  +N +   F++      N    PN+ S  V   
Sbjct: 74  KNEGIAGLQKGLASAYL-------YQIALNGSRLGFYEPIRGILNNVFYPNVESHKVQHI 126

Query: 136 RSNTLPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSN---GGDREFKGPWDCIKKL 192
             N          G T GVV +F+ SP+  ++ R+Q+ ++    G    +   ++ +  +
Sbjct: 127 GINV-------AAGATSGVVGAFIGSPLFLVKTRMQSYSNAIHIGQQTHYTSAFNGLATI 179

Query: 193 -KAQG--GLMRGLFPTMIRAGHGLGTYFLVYEA----LVAREI---GTGLTRNEIPPWKL 242
            +++G  GL RG+   M+R G G      +Y      L+  ++   GTGL          
Sbjct: 180 FRSEGIKGLFRGVDAAMLRTGIGSAVQLPIYNICKNFLLKHDLMNDGTGLH--------- 230

Query: 243 CLFGAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFG 302
            L    +G  + + + P DVV + + N   +   Y   I    KT+   EG+ A +KGFG
Sbjct: 231 LLSSTIAGFGVGVAMNPWDVVLTRVYNQ--KGNLYSGPIDCFIKTV-RNEGLSALYKGFG 287

Query: 303 PTMVRSAP 310
             ++R  P
Sbjct: 288 AQILRIGP 295

>CAGL0H03839g 359987..360835 highly similar to sp|P38921
           Saccharomyces cerevisiae YNL003c PET8, start by
           similarity
          Length = 282

 Score = 53.1 bits (126), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 57/212 (26%), Positives = 90/212 (42%), Gaps = 25/212 (11%)

Query: 115 FFQNYNASKNPNMSSQDVDLSRSNTLPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQT 174
           FF  Y+  K          L  SN   +  +      G +    +  P E ++ R QT  
Sbjct: 66  FFITYDTCKAETRGFFRGLLPSSNVADVVTHMFSSSMGEIAACMVRVPAEVVKQRSQTHA 125

Query: 175 SNGGDREFKGPWDCIKK-LKAQGG------LMRGLFPTMIRAGHGLGTYFLVYEALVARE 227
           S+         W+ +++ LK + G      L RG   T++R        F +YE +  ++
Sbjct: 126 SHS-------SWETLREILKNENGEGVRRNLYRGWSTTIMREIPFTCIQFPLYEYM--KK 176

Query: 228 IGTGLTRNE-IPPWKLCLFGAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAK 286
           +   L  ++ + PWK  + G+ +G +   T  PLD +K+      L   K    +  +  
Sbjct: 177 VWAELDESDRVEPWKGAVCGSIAGGIAAATTTPLDFLKT-----RLMLCKKSIPLGTLVS 231

Query: 287 TIYAKEGIRAFFKGFGP-TMVRSAPVNGATFL 317
           TIY +EG + FF G GP TM  SA   GA FL
Sbjct: 232 TIYKEEGFKVFFSGVGPRTMWISA--GGAIFL 261

 Score = 29.6 bits (65), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 33/77 (42%), Gaps = 15/77 (19%)

Query: 244 LFGAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGP 303
           L GA +GT   L  +P+D +K+ +Q                    +   G R  ++G G 
Sbjct: 10  LSGAAAGTSTDLVFFPIDTLKTRLQAKG---------------GFFRNGGYRGVYRGLGS 54

Query: 304 TMVRSAPVNGATFLTFE 320
            +V SAP     F+T++
Sbjct: 55  AVVASAPGASLFFITYD 71

>AER184W [2686] [Homologous to ScYBL030C (PET9) - SH; ScYBR085W
           (AAC3) - SH] complement(978781..979698) [918 bp, 305 aa]
          Length = 305

 Score = 53.1 bits (126), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 52/179 (29%), Positives = 79/179 (44%), Gaps = 11/179 (6%)

Query: 149 GLTGGVVNSFLASPIEQIRIRLQTQTSN---GGDREFKGPWDCIKKLKAQ---GGLMRGL 202
           G  GG+   F+ S ++  R RL   + +   GG+R+F G  D  KK  A     GL RG 
Sbjct: 122 GAAGGLSLLFVYS-LDYARTRLAADSKSAKKGGERQFNGLVDVYKKTLASDGIAGLYRGF 180

Query: 203 FPTMIRAGHGLGTYFLVYEALVAREIGTGLTRNEIPPWKLCLFGAFSGTMLWLTVYPLDV 262
            P+++      G YF +Y++L    +   L  + I  +   L G    T      YPLD 
Sbjct: 181 LPSVVGIVVYRGLYFGMYDSLKPLLLTGNLESSFIASF---LLGWAVTTGASTASYPLDT 237

Query: 263 VKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATFLTFEL 321
           V+  +     +  KY  +     K I A EG+++ FKG G  ++R     G   L  +L
Sbjct: 238 VRRRMMMTSGQAVKYDGAFDAFRK-IVAAEGVKSLFKGCGANILRGVAGAGVISLYDQL 295

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 49/187 (26%), Positives = 77/187 (41%), Gaps = 31/187 (16%)

Query: 143 SQYYVCGLTGGV---VNSFLASPIEQIRIRLQTQTS----NGGDREFKGPWDCIKKLKAQ 195
           S + +  + GGV   V+   A+PIE++++ +Q Q         DR + G  DC K+  A 
Sbjct: 7   SNFLINFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMLKQGSLDRRYNGIVDCFKRTAAS 66

Query: 196 GGLM---RGLFPTMIRAGHGLGTYF------LVYEALVAREIGTGLTRNEIPPW---KLC 243
            G++   RG    +IR       YF        ++  +    G     +    W    L 
Sbjct: 67  EGVISFWRGNTANVIR-------YFPTQALNFAFKDKIKAMFGFRKEVDGYAKWFAGNLA 119

Query: 244 LFGAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYK----NSISYVAKTIYAKEGIRAFFK 299
             GA  G  L L VY LD  ++ +  D     K      N +  V K   A +GI   ++
Sbjct: 120 SGGAAGGLSL-LFVYSLDYARTRLAADSKSAKKGGERQFNGLVDVYKKTLASDGIAGLYR 178

Query: 300 GFGPTMV 306
           GF P++V
Sbjct: 179 GFLPSVV 185

>YBR085W (AAC3) [275] chr2 (415940..416863) ADP/ATP transporter
           protein, member of the mitochondrial carrier family
           (MCF) of membrane transporters [924 bp, 307 aa]
          Length = 307

 Score = 53.1 bits (126), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 51/181 (28%), Positives = 80/181 (44%), Gaps = 10/181 (5%)

Query: 149 GLTGGVVNSFLASPIEQIRIRLQTQ---TSNGGDREFKGPWDCIKK-LKAQG--GLMRGL 202
           G   G ++      ++  R RL      +  GG R+F G  D  KK LK+ G  GL RG 
Sbjct: 123 GGAAGALSLLFVYSLDFARTRLAADAKSSKKGGARQFNGLTDVYKKTLKSDGIAGLYRGF 182

Query: 203 FPTMIRAGHGLGTYFLVYEALVAREIGTGLTRNEIPPWKLCLFGAFSGTMLWLTVYPLDV 262
            P+++      G YF ++++L    +   L  + +  +   L G    T      YPLD 
Sbjct: 183 MPSVVGIVVYRGLYFGMFDSLKPLVLTGSLDGSFLASF---LLGWVVTTGASTCSYPLDT 239

Query: 263 VKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATFLTFELV 322
           V+  +     +  KY  +I  + K I A EG+ + FKG G  ++RS    G   +  +L 
Sbjct: 240 VRRRMMMTSGQAVKYNGAIDCL-KKIVASEGVGSLFKGCGANILRSVAGAGVISMYDQLQ 298

Query: 323 M 323
           M
Sbjct: 299 M 299

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 51/189 (26%), Positives = 80/189 (42%), Gaps = 22/189 (11%)

Query: 150 LTGGV---VNSFLASPIEQIRIRLQTQ----TSNGGDREFKGPWDCIKKLKAQGGLM--- 199
           L GGV   +    ASPIE+++I +Q Q         D+++ G  DC K+   Q GL+   
Sbjct: 17  LMGGVSAAIAKTAASPIERVKILIQNQDEMIKQGTLDKKYSGIVDCFKRTAKQEGLISFW 76

Query: 200 RGLFPTMIRAGHGLGTYFLVYEALVAREIGTGLTRNE-IPPW---KLCLFGAFSGTMLWL 255
           RG    +IR        F   + +   ++  G  + E    W    L   GA +G +  L
Sbjct: 77  RGNTANVIRYFPTQALNFAFKDKI---KLMFGFKKEEGYGKWFAGNLASGGA-AGALSLL 132

Query: 256 TVYPLDVVKSIIQNDDLRKPKYK----NSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPV 311
            VY LD  ++ +  D     K      N ++ V K     +GI   ++GF P++V     
Sbjct: 133 FVYSLDFARTRLAADAKSSKKGGARQFNGLTDVYKKTLKSDGIAGLYRGFMPSVVGIVVY 192

Query: 312 NGATFLTFE 320
            G  F  F+
Sbjct: 193 RGLYFGMFD 201

>YKR052C (MRS4) [3303] chr11 complement(532192..533106) Member of
           the mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses defects in
           splicing of mitochondrial introns [915 bp, 304 aa]
          Length = 304

 Score = 52.8 bits (125), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 55/247 (22%), Positives = 96/247 (38%), Gaps = 34/247 (13%)

Query: 82  EGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTLP 141
           EG  A +KG  + +LG G   +V FG           Y   K   +S +D+   +     
Sbjct: 75  EGSMALWKGVQSVILGAGPAHAVYFGT----------YEFCKARLISPEDMQTHQPMKTA 124

Query: 142 LSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQGGLMRG 201
           LS     G    +    L +P + ++ RLQ  T+          W+  K++    G    
Sbjct: 125 LS-----GTIATIAADALMNPFDTVKQRLQLDTN-------LRVWNVTKQIYQNEGFAAF 172

Query: 202 L--FPTMIRAGHGLGTY-FLVYEALVAREIGTGLTRNEIPPWKLCLFGAFSGTMLWLTVY 258
              +PT +        + F++YE+  A +      +N   P   CL G  SG        
Sbjct: 173 YYSYPTTLAMNIPFAAFNFMIYES--ASKFFN--PQNSYNPLIHCLCGGISGATCAALTT 228

Query: 259 PLDVVKSIIQ-----NDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNG 313
           PLD +K+++Q        +   K  N+    ++ I    G + F++G  P +V + P   
Sbjct: 229 PLDCIKTVLQVRGSETVSIEIMKDANTFGRASRAILEVHGWKGFWRGLKPRIVANIPATA 288

Query: 314 ATFLTFE 320
            ++  +E
Sbjct: 289 ISWTAYE 295

 Score = 51.2 bits (121), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 49/184 (26%), Positives = 73/184 (39%), Gaps = 14/184 (7%)

Query: 141 PLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQGGLM- 199
           PL    + G   G++   L  PI+ ++ R+Q    N       G    I K+    G M 
Sbjct: 22  PLHSQLLAGAFAGIMEHSLMFPIDALKTRVQAAGLNKAAS--TGMISQISKISTMEGSMA 79

Query: 200 --RGLFPTMIRAGHGLGTYFLVYEALVAREIGTGLTRNEIPPWKLCLFGAFSGTMLWLTV 257
             +G+   ++ AG     YF  YE   AR I     +    P K  L G  +       +
Sbjct: 80  LWKGVQSVILGAGPAHAVYFGTYEFCKARLISPEDMQTH-QPMKTALSGTIATIAADALM 138

Query: 258 YPLDVVKSIIQND-DLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATF 316
            P D VK  +Q D +LR       +  V K IY  EG  AF+  +  T+  + P     F
Sbjct: 139 NPFDTVKQRLQLDTNLR-------VWNVTKQIYQNEGFAAFYYSYPTTLAMNIPFAAFNF 191

Query: 317 LTFE 320
           + +E
Sbjct: 192 MIYE 195

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 47/102 (46%), Gaps = 1/102 (0%)

Query: 221 EALVAREIGTGLTRNEIPPWKLCLFGAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNS 280
           E  +A EI      +  P     L GAF+G M    ++P+D +K+ +Q   L K      
Sbjct: 5   ELSIAEEIDYEALPSHAPLHSQLLAGAFAGIMEHSLMFPIDALKTRVQAAGLNKAASTGM 64

Query: 281 ISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATFLTFELV 322
           IS ++K I   EG  A +KG    ++ + P +   F T+E  
Sbjct: 65  ISQISK-ISTMEGSMALWKGVQSVILGAGPAHAVYFGTYEFC 105

 Score = 34.3 bits (77), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 44/202 (21%), Positives = 71/202 (35%), Gaps = 26/202 (12%)

Query: 27  RELSSNRVLKDIFAGTIGGIAQVLVGQPFDXXXXXXXXXXXXXXXXXXXXXXXKNEGVFA 86
            ++ +++ +K   +GTI  IA   +  PFD                       +NEG  A
Sbjct: 113 EDMQTHQPMKTALSGTIATIAADALMNPFD-TVKQRLQLDTNLRVWNVTKQIYQNEGFAA 171

Query: 87  FYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTLPLSQYY 146
           FY    T L       +  F + E+  +FF   N S NP +                 + 
Sbjct: 172 FYYSYPTTLAMNIPFAAFNFMIYESASKFFNPQN-SYNPLI-----------------HC 213

Query: 147 VCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDRE-------FKGPWDCIKKLKAQGGLM 199
           +CG   G   + L +P++ I+  LQ + S     E       F      I ++    G  
Sbjct: 214 LCGGISGATCAALTTPLDCIKTVLQVRGSETVSIEIMKDANTFGRASRAILEVHGWKGFW 273

Query: 200 RGLFPTMIRAGHGLGTYFLVYE 221
           RGL P ++         +  YE
Sbjct: 274 RGLKPRIVANIPATAISWTAYE 295

>CAGL0L05742g complement(630844..631761) similar to sp|P10566
           Saccharomyces cerevisiae YJL133w MRS3 or sp|P23500
           Saccharomyces cerevisiae YKR052c MRS4, start by
           similarity
          Length = 305

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 46/191 (24%), Positives = 82/191 (42%), Gaps = 14/191 (7%)

Query: 141 PLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQ---TSNGGDREFKGPWDCIKKLKAQGG 197
           PL+   + G   G+    +  P++ ++ RLQ     ++ GG          +  + AQ G
Sbjct: 17  PLAHQLMAGAFAGIAEHSVIFPLDALKTRLQAMHAISTTGGQPIPSTMLRQLSSISAQEG 76

Query: 198 ---LMRGLFPTMIRAGHGLGTYFLVYEALVAREIGTGLTRNEIPPWKLCLFGAFSGTMLW 254
              L +G+   ++ AG     YF  YE + +  I    + ++   +K    GA +     
Sbjct: 77  SMVLWKGVQSVLLGAGPAHAVYFATYEMVKSFLIDEATSTSKYHFFKTAFSGATATIAAD 136

Query: 255 LTVYPLDVVKSIIQ-NDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNG 313
             + P DV+K  IQ N ++       S+   AK IY+KEG +AF+  +  T+  + P   
Sbjct: 137 ALMNPFDVIKQRIQLNTNI-------SVWDTAKRIYSKEGFQAFYSSYPTTLAINIPFAA 189

Query: 314 ATFLTFELVMR 324
             F  ++   R
Sbjct: 190 FNFGIYDTATR 200

 Score = 50.4 bits (119), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 51/250 (20%), Positives = 97/250 (38%), Gaps = 33/250 (13%)

Query: 81  NEGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTL 140
            EG    +KG  + LLG G   +V F   E +K F  +              + + ++  
Sbjct: 74  QEGSMVLWKGVQSVLLGAGPAHAVYFATYEMVKSFLID--------------EATSTSKY 119

Query: 141 PLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQGGL-- 198
              +    G T  +    L +P + I+ R+Q  T+          WD  K++ ++ G   
Sbjct: 120 HFFKTAFSGATATIAADALMNPFDVIKQRIQLNTN-------ISVWDTAKRIYSKEGFQA 172

Query: 199 MRGLFPTMIRAGHGLGTY-FLVYEALVAREIGTGLTRNEIPPWKLCLFGAFSGTMLWLTV 257
               +PT +        + F +Y+        +G+      P+  CL G  SG       
Sbjct: 173 FYSSYPTTLAINIPFAAFNFGIYDTATRYFNPSGVYN----PFIHCLCGGISGAACAGLT 228

Query: 258 YPLDVVKSIIQ---NDDLRKPKYKNSISY--VAKTIYAKEGIRAFFKGFGPTMVRSAPVN 312
            PLD +K+ +Q   ++ +    +K + ++    + IY   G R F+ G  P ++ + P  
Sbjct: 229 TPLDCIKTALQVRGSEKVSMEVFKQADTFKKATRAIYQVYGWRGFWSGVKPRILANMPAT 288

Query: 313 GATFLTFELV 322
             ++  +E  
Sbjct: 289 AISWTAYEFA 298

>Scas_718.24
          Length = 337

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 53/181 (29%), Positives = 82/181 (45%), Gaps = 11/181 (6%)

Query: 149 GLTGGVVNSFLASPIEQIRIRLQTQTSN---GGDREFKGPWDCIKK-LKAQG--GLMRGL 202
           G  GG+   F+ S ++  R RL   + +   GG R+F G  D  KK LK+ G  GL RG 
Sbjct: 154 GAAGGLSLLFVYS-LDFARTRLAADSKSSKKGGSRQFNGLIDVYKKTLKSDGVAGLYRGF 212

Query: 203 FPTMIRAGHGLGTYFLVYEALVAREIGTGLTRNEIPPWKLCLFGAFSGTMLWLTVYPLDV 262
            P+++      G YF +Y+++    +   L  + +  +   L G    T      YPLD 
Sbjct: 213 LPSVVGIIVYRGLYFGLYDSIKPVLLTGSLEGSFLASF---LLGWVVTTGASTCSYPLDT 269

Query: 263 VKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATFLTFELV 322
           V+  +     +  KYK +     K I A EG+ + FKG G  ++R     G   +  +L 
Sbjct: 270 VRRKMMMTSGQAVKYKGAFD-CFKKIVAAEGVASLFKGCGANILRGVAGAGVISMYDQLQ 328

Query: 323 M 323
           M
Sbjct: 329 M 329

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 59/219 (26%), Positives = 92/219 (42%), Gaps = 37/219 (16%)

Query: 116 FQNY-NASKNPNMSSQDVDLSRSNTL-----PLSQYYVCGLTGGV---VNSFLASPIEQI 166
           F N+ N S +   + QD  + +SNT+     P S + +  L GGV   V    ASPIE++
Sbjct: 8   FANFENESLHYVSNGQDHKI-QSNTIMSTEKPQSNFAIDFLMGGVSAAVAKTAASPIERV 66

Query: 167 RIRLQTQTS----NGGDREFKGPWDCIKKLKAQGGLM---RGLFPTMIRAGHGLGTYFLV 219
           ++ +Q Q         D ++KG  DC ++   Q G++   RG    +IR        F  
Sbjct: 67  KLLIQNQNEMLKQGTLDTKYKGIVDCFRRTAQQEGIISFWRGNTANVIRYFPTQALNFAF 126

Query: 220 YEAL-----VAREIGTGLTRNEIPPW---KLCLFGAFSGTMLWLTVYPLDVVKSIIQNDD 271
            + +       +E G G        W    L   GA  G  L L VY LD  ++ +  D 
Sbjct: 127 KDKIKLMFGFKKEDGYG-------KWFAGNLASGGAAGGLSL-LFVYSLDFARTRLAADS 178

Query: 272 LRKPKYK----NSISYVAKTIYAKEGIRAFFKGFGPTMV 306
               K      N +  V K     +G+   ++GF P++V
Sbjct: 179 KSSKKGGSRQFNGLIDVYKKTLKSDGVAGLYRGFLPSVV 217

 Score = 33.1 bits (74), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 31/138 (22%), Positives = 63/138 (45%), Gaps = 22/138 (15%)

Query: 80  KNEGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNT 139
           K++GV   Y+G L  ++G+ +   + FG+ +++K           P + +  ++ S   +
Sbjct: 201 KSDGVAGLYRGFLPSVVGIIVYRGLYFGLYDSIK-----------PVLLTGSLEGSFLAS 249

Query: 140 LPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQGG-- 197
             L      G       S  + P++ +R ++    ++G   ++KG +DC KK+ A  G  
Sbjct: 250 FLLGWVVTTG------ASTCSYPLDTVRRKM--MMTSGQAVKYKGAFDCFKKIVAAEGVA 301

Query: 198 -LMRGLFPTMIRAGHGLG 214
            L +G    ++R   G G
Sbjct: 302 SLFKGCGANILRGVAGAG 319

>Kwal_26.7967
          Length = 297

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 49/187 (26%), Positives = 82/187 (43%), Gaps = 14/187 (7%)

Query: 147 VCGLTGGVVNSFLA-SPIEQIRIRL-------QTQTSNGGDREFKGPWDCIKKLKAQGGL 198
           V GL  G++ S +A +P E I+  L         +  N G R     +  +   K   GL
Sbjct: 110 VAGLGAGLLESVVAVTPFEAIKTALIDDKQSASPKYHNNG-RGMLRNYSSLVYDKGFSGL 168

Query: 199 MRGLFPTMIRAGHGLGTYFLVYEAL--VAREIGTGLTRNEIPPWKLCLFGAFSGTMLWLT 256
            RG+ P  +R           Y  +  + ++         +      + GAFSG +   T
Sbjct: 169 YRGVLPVSMRQAANQAVRLGCYNKIKTMIQDYTNSAKDKPLSSGMTFVVGAFSGIVTVYT 228

Query: 257 VYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATF 316
             P+D VK+ +Q+ D    KY ++I+  A T++ +EG++ F+KG  P + R     G  F
Sbjct: 229 TMPIDTVKTRMQSLD--SSKYSSTINCFA-TVFREEGLKTFWKGATPRLGRLILSGGIVF 285

Query: 317 LTFELVM 323
             +E V+
Sbjct: 286 TIYEKVL 292

 Score = 36.2 bits (82), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 32/148 (21%), Positives = 63/148 (42%), Gaps = 21/148 (14%)

Query: 81  NEGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNY-NASKNPNMSSQDVDLSRSNT 139
           ++G    Y+G L   +      +V+ G    +K   Q+Y N++K+  +SS          
Sbjct: 162 DKGFSGLYRGVLPVSMRQAANQAVRLGCYNKIKTMIQDYTNSAKDKPLSS---------- 211

Query: 140 LPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQGGLM 199
                 +V G   G+V  +   PI+ ++ R+Q+  S+    ++    +C   +  + GL 
Sbjct: 212 ---GMTFVVGAFSGIVTVYTTMPIDTVKTRMQSLDSS----KYSSTINCFATVFREEGLK 264

Query: 200 ---RGLFPTMIRAGHGLGTYFLVYEALV 224
              +G  P + R     G  F +YE ++
Sbjct: 265 TFWKGATPRLGRLILSGGIVFTIYEKVL 292

>Scas_489.4
          Length = 297

 Score = 51.6 bits (122), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 53/198 (26%), Positives = 86/198 (43%), Gaps = 36/198 (18%)

Query: 147 VCGLTGGVVNSFLA-SPIEQIRIRL-------QTQTSNGGDREFKGPWDCIKKLKAQG-- 196
           V GL  G++ S +A +P E I+  L       + +  N G    +     ++    QG  
Sbjct: 111 VAGLGAGLLESVVAVTPFEAIKTALIDDKQALKPKYQNNGRGMLRNYGSLVRD---QGIM 167

Query: 197 GLMRGLFPTMIRAGHGLGTYFLVYEALVA-----------REIGTGLTRNEIPPWKLCLF 245
           GL RG+ P  +R           Y  +             R + +GLT          + 
Sbjct: 168 GLYRGVLPVSMRQAANQAVRLGCYNKIKTMVQDYTNAPKDRPLSSGLT---------FIV 218

Query: 246 GAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTM 305
           GAFSG +   T  P+D VK+ +Q+ D    KY ++++  AK I+ +EG++ F+KG  P +
Sbjct: 219 GAFSGVVTVYTTMPIDTVKTRMQSLD--ATKYTSTVNCFAK-IFKEEGLKTFWKGATPRL 275

Query: 306 VRSAPVNGATFLTFELVM 323
            R     G  F  +E V+
Sbjct: 276 GRLILSGGIVFTIYENVL 293

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/146 (22%), Positives = 62/146 (42%), Gaps = 21/146 (14%)

Query: 80  KNEGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNY-NASKNPNMSSQDVDLSRSN 138
           +++G+   Y+G L   +      +V+ G    +K   Q+Y NA K+  +SS         
Sbjct: 162 RDQGIMGLYRGVLPVSMRQAANQAVRLGCYNKIKTMVQDYTNAPKDRPLSS--------- 212

Query: 139 TLPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQGGL 198
                  ++ G   GVV  +   PI+ ++ R+Q+  +     ++    +C  K+  + GL
Sbjct: 213 ----GLTFIVGAFSGVVTVYTTMPIDTVKTRMQSLDAT----KYTSTVNCFAKIFKEEGL 264

Query: 199 M---RGLFPTMIRAGHGLGTYFLVYE 221
               +G  P + R     G  F +YE
Sbjct: 265 KTFWKGATPRLGRLILSGGIVFTIYE 290

>AGR383W [4694] [Homologous to ScYDL119C - SH]
           complement(1436769..1437650) [882 bp, 293 aa]
          Length = 293

 Score = 51.6 bits (122), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 46/182 (25%), Positives = 75/182 (41%), Gaps = 17/182 (9%)

Query: 145 YYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQGGLMRGLFP 204
           + V G  GG+ +     P++ ++ RLQ Q      R        +++++    L RG  P
Sbjct: 11  HLVSGFFGGLASVCALQPLDLLKTRLQ-QAQASSLR------SVLREVRTTRELWRGTLP 63

Query: 205 TMIRAGHGLGTYF--LVYEALVAREIGTGLTRNEIPP----WKLCLFGAFSGTMLWLTVY 258
           + +R   G   Y   L Y            TR+ + P    ++  L GA S   + L   
Sbjct: 64  SALRTSIGSALYLSLLNYSRSALARGSEARTRSSLLPRLQSYQNLLTGALSRAAVGLVTM 123

Query: 259 PLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATFLT 318
           P+ V+K   ++         N ++   + I+  EG R FFKG   T +R AP  G   L 
Sbjct: 124 PITVIKVRYESTLY----AYNGLAEATRHIWRSEGARGFFKGAAATTLRDAPYAGLYVLL 179

Query: 319 FE 320
           +E
Sbjct: 180 YE 181

>Kwal_26.7653
          Length = 325

 Score = 51.6 bits (122), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 61/248 (24%), Positives = 103/248 (41%), Gaps = 43/248 (17%)

Query: 80  KNEGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKN----PNMSSQDVDLS 135
           KNEG+    KG     +        Q G+N +   F++   +  N    P M    V   
Sbjct: 78  KNEGIRGLQKGLSCAYI-------YQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNV 130

Query: 136 RSNTLPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSN---GGDREFKGPWDCIKKL 192
             N        V G T G++ + + SP+  I+ R+Q+ ++    G    +   W+ +  +
Sbjct: 131 AVNV-------VSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSI 183

Query: 193 -KAQG--GLMRGLFPTMIRAGHGLGTYFLVYEA----LVAREI---GTGLTRNEIPPWKL 242
            +A+G  GL RG+   ++R G G      +Y      L+  ++   GTGL          
Sbjct: 184 YRAEGFKGLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLH--------- 234

Query: 243 CLFGAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFG 302
            +    SG  + + + P DV+ + + N   +   YK  +    KT+   EGI A +KGF 
Sbjct: 235 LVASTVSGFGVGVVMNPWDVILTRVYNQ--KGNLYKGPLDCFVKTVRI-EGIGALYKGFE 291

Query: 303 PTMVRSAP 310
             + R AP
Sbjct: 292 AQIFRIAP 299

 Score = 34.7 bits (78), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 41/178 (23%), Positives = 77/178 (43%), Gaps = 17/178 (9%)

Query: 146 YVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGD--REFKGPWDCIKKL-KAQG--GLMR 200
           ++ G     +   + +PIE ++ R+Q Q     D  R +K P   +K + K +G  GL +
Sbjct: 28  FIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQK 87

Query: 201 GLFPTMIRAGHGLGTYFLVYEALVAREIGTGLTRNEIPPWKL------CLFGAFSGTMLW 254
           GL    I      G+    YE +  R +        + P K+       + GA SG +  
Sbjct: 88  GLSCAYIYQIGLNGSRLGFYEPI--RSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGA 145

Query: 255 LTVYPLDVVKSIIQN----DDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRS 308
           +   PL ++K+ +Q+      + +  +  SI     +IY  EG +  ++G    ++R+
Sbjct: 146 IMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRT 203

>YBL030C (PET9) [164] chr2 complement(163006..163962) ADP/ATP
           carrier protein of the mitochondrial carrier family
           (MCF) of membrane transporters [957 bp, 318 aa]
          Length = 318

 Score = 51.6 bits (122), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 50/181 (27%), Positives = 79/181 (43%), Gaps = 10/181 (5%)

Query: 149 GLTGGVVNSFLASPIEQIRIRLQTQTSN---GGDREFKGPWDCIKK-LKAQG--GLMRGL 202
           G   G ++      ++  R RL   + +   GG R+F G  D  KK LK+ G  GL RG 
Sbjct: 134 GGAAGALSLLFVYSLDYARTRLAADSKSSKKGGARQFNGLIDVYKKTLKSDGVAGLYRGF 193

Query: 203 FPTMIRAGHGLGTYFLVYEALVAREIGTGLTRNEIPPWKLCLFGAFSGTMLWLTVYPLDV 262
            P+++      G YF +Y++L    +   L  + +  +   L G    T      YPLD 
Sbjct: 194 LPSVVGIVVYRGLYFGMYDSLKPLLLTGSLEGSFLASF---LLGWVVTTGASTCSYPLDT 250

Query: 263 VKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATFLTFELV 322
           V+  +     +  KY  +   + K I A EG+ + FKG G  ++R     G   +  +L 
Sbjct: 251 VRRRMMMTSGQAVKYDGAFDCLRK-IVAAEGVGSLFKGCGANILRGVAGAGVISMYDQLQ 309

Query: 323 M 323
           M
Sbjct: 310 M 310

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 51/196 (26%), Positives = 81/196 (41%), Gaps = 22/196 (11%)

Query: 143 SQYYVCGLTGGV---VNSFLASPIEQIRIRLQTQ----TSNGGDREFKGPWDCIKKLKAQ 195
           S + +  L GGV   V    ASPIE++++ +Q Q         DR++ G  DC K+   Q
Sbjct: 21  SNFLIDFLMGGVSAAVAKTAASPIERVKLLIQNQDEMLKQGTLDRKYAGILDCFKRTATQ 80

Query: 196 GGLM---RGLFPTMIRAGHGLGTYFLVYEALVAREIGTGLTRNE-IPPW---KLCLFGAF 248
            G++   RG    +IR        F   + + A     G  + E    W    L   GA 
Sbjct: 81  EGVISFWRGNTANVIRYFPTQALNFAFKDKIKAM---FGFKKEEGYAKWFAGNLASGGA- 136

Query: 249 SGTMLWLTVYPLDVVKSIIQNDDLRKPKYK----NSISYVAKTIYAKEGIRAFFKGFGPT 304
           +G +  L VY LD  ++ +  D     K      N +  V K     +G+   ++GF P+
Sbjct: 137 AGALSLLFVYSLDYARTRLAADSKSSKKGGARQFNGLIDVYKKTLKSDGVAGLYRGFLPS 196

Query: 305 MVRSAPVNGATFLTFE 320
           +V      G  F  ++
Sbjct: 197 VVGIVVYRGLYFGMYD 212

 Score = 33.5 bits (75), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 30/139 (21%), Positives = 63/139 (45%), Gaps = 22/139 (15%)

Query: 80  KNEGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNT 139
           K++GV   Y+G L  ++G+ +   + FG+ +++K           P + +  ++ S   +
Sbjct: 182 KSDGVAGLYRGFLPSVVGIVVYRGLYFGMYDSLK-----------PLLLTGSLEGSFLAS 230

Query: 140 LPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQ---G 196
             L      G       S  + P++ +R R+    ++G   ++ G +DC++K+ A    G
Sbjct: 231 FLLGWVVTTG------ASTCSYPLDTVRRRM--MMTSGQAVKYDGAFDCLRKIVAAEGVG 282

Query: 197 GLMRGLFPTMIRAGHGLGT 215
            L +G    ++R   G G 
Sbjct: 283 SLFKGCGANILRGVAGAGV 301

>Scas_667.4
          Length = 308

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 61/255 (23%), Positives = 102/255 (40%), Gaps = 34/255 (13%)

Query: 80  KNEGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFF-----QNYNASKNPNMSSQDVDL 134
           K EG+ AF++G    ++      ++ F   + +K  F     + Y      N++S     
Sbjct: 69  KTEGIIAFWRGNTANVIRYFPTQALNFAFKDKIKAMFGFKKEEGYGKWFAGNLASG---- 124

Query: 135 SRSNTLPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQT---QTSNGGDREFKGPWDCIKK 191
                         G  GG+   F+ S ++  R RL      +  GG R++KG  D  K+
Sbjct: 125 --------------GAAGGLSLLFVYS-LDYARTRLAADAKSSKKGGSRQYKGLIDVYKQ 169

Query: 192 LKA---QGGLMRGLFPTMIRAGHGLGTYFLVYEALVAREIGTGLTRNEIPPWKLCLFGAF 248
             A     GL RG  P+++      G YF +Y++L    +   L  + +  +   L G  
Sbjct: 170 TLATDGMAGLYRGFLPSVVGIIVYRGLYFGLYDSLKPAVLTGSLEGSFLASF---LLGWI 226

Query: 249 SGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRS 308
             T      YPLD V+  +     +  KY  +     K + A EG+ + FKG G  ++R 
Sbjct: 227 VTTGASTASYPLDTVRRRMMMTSGQAVKYDGAFDCFRKVV-AAEGVSSLFKGCGANILRG 285

Query: 309 APVNGATFLTFELVM 323
               G   +  +L M
Sbjct: 286 VAGAGVISMYDQLQM 300

 Score = 30.4 bits (67), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 36/79 (45%), Gaps = 7/79 (8%)

Query: 244 LFGAFSGTMLWLTVYPLDVVKSIIQN-DDLRK-----PKYKNSISYVAKTIYAKEGIRAF 297
           L G  S  +      P++ VK +IQN D++ K      KYK  I    +T    EGI AF
Sbjct: 18  LMGGVSAAVAKTAASPIERVKLLIQNQDEMIKQGSLDSKYKGIIECFQRTA-KTEGIIAF 76

Query: 298 FKGFGPTMVRSAPVNGATF 316
           ++G    ++R  P     F
Sbjct: 77  WRGNTANVIRYFPTQALNF 95

>AGL047C [4264] [Homologous to ScYPR011C - NSH] (616853..617803)
           [951 bp, 316 aa]
          Length = 316

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 44/180 (24%), Positives = 83/180 (46%), Gaps = 24/180 (13%)

Query: 162 PIEQIRIRLQTQTSNGGD---------REFKGPWDCIKKL-KAQGGL---MRGLFPTMIR 208
           P++ +R RL  QT+N            R   G  + ++++ + +GGL    RG++PT + 
Sbjct: 135 PLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLG 194

Query: 209 AGHGLGTYFLVYE---ALVAREIGTGLTRNEIPPWKLCLFGAFSGTMLWLTVYPLDVVKS 265
               +   F +YE   AL+  +   G     +   KL + GA SG +    VYP D+++ 
Sbjct: 195 VVPFVALNFALYERLKALIPHDYDAG----SVAAAKLAI-GAVSGGIAQTVVYPFDLLRR 249

Query: 266 IIQNDDLRKPKYKNSISYVAKTIYA---KEGIRAFFKGFGPTMVRSAPVNGATFLTFELV 322
             Q   + + +     + VA  ++    +EG+R ++KG    +V+  P     +  +EL+
Sbjct: 250 RFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYELI 309

 Score = 50.1 bits (118), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 52/194 (26%), Positives = 86/194 (44%), Gaps = 25/194 (12%)

Query: 146 YVCGLTGGVVNSFLASPIEQIRIRLQTQTS----NGGDREFKGPWDCIKKLKAQGGLMRG 201
           +V G  GG V+  + SP+E+++I LQ Q+S    NGG          + K +   GL RG
Sbjct: 20  FVAGGVGGAVSRTVVSPVERVKILLQVQSSTTAYNGG---LVHAVKQVYKEEGVKGLFRG 76

Query: 202 LFPTMIRAGHGLGTYFLVYEALVAREIGTGLTRNE-IPPWKLCLFGAFSGTMLWLTVYPL 260
                +R        + VYE    R    G + +E +  W+  + GA  G    L  YPL
Sbjct: 77  NGINCLRIFPYSAVQYAVYEFCKTRVFHVGQSGHEQLRSWERLVGGALGGGASVLVTYPL 136

Query: 261 DVVKSII-------------QNDDLRKPKYKNSISYVAKTIYAKE-GIRAFFKGFGPTMV 306
           D+V++ +             +  D+R+P     I  + + I+ +E G+R +++G  PT +
Sbjct: 137 DLVRTRLSIQTANLAKLHRSKAHDIRRPP---GIVELLRRIFREEGGLRGWYRGVYPTSL 193

Query: 307 RSAPVNGATFLTFE 320
              P     F  +E
Sbjct: 194 GVVPFVALNFALYE 207

>Scas_558.2
          Length = 289

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 63/256 (24%), Positives = 107/256 (41%), Gaps = 47/256 (18%)

Query: 80  KNEGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQ-------NYNASKNPNMSSQDV 132
           +N G    Y+G  + ++      S+ F   ++MK   +       N + +++P+     V
Sbjct: 42  QNGGYHGIYRGLGSAVVASAPSASLFFVTYDSMKVRVRPHVERVINSSGTRSPHSVDTIV 101

Query: 133 DLSRSNTLPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKL 192
            +  S+             G +    +  P E I+ R Q  ++N   + F+     I K 
Sbjct: 102 HMIASSM------------GELAACLVRVPAEVIKQRTQVHSTNSSWQTFR----TILKN 145

Query: 193 KAQGGLMRGLF----PTMIRAGHGLGTYFLVYE------ALVAREIGTGLTRNEIPPWKL 242
           + Q G++R L+     T++R        F +YE      AL   E+G       + PWK 
Sbjct: 146 ENQEGIIRNLYRGWSTTIMREIPFTCIQFPLYEFMKKEWALYDNEVG------HLKPWKG 199

Query: 243 CLFGAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFG 302
            + G+ +G +   T  PLD +K+ +  +    P     I  + + IY +EG + FF G  
Sbjct: 200 AICGSIAGGIAAATTTPLDFLKTRLMLNKDSIP-----IKSLIRNIYKEEGFKIFFSGIY 254

Query: 303 P-TMVRSAPVNGATFL 317
           P TM  SA   GA FL
Sbjct: 255 PRTMWISA--GGAIFL 268

>Sklu_2442.8 YNL003C, Contig c2442 12309-13136
          Length = 275

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 55/176 (31%), Positives = 81/176 (46%), Gaps = 27/176 (15%)

Query: 152 GGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQGG------LMRGLFPT 205
           G V    +  P E I+ R QT  +N   + F       K L+ + G      L RG   T
Sbjct: 105 GEVSACLVRVPAEVIKQRTQTHKTNSSWQTF------TKILQNENGEGVLRNLYRGWNTT 158

Query: 206 MIRAGHGLGTYFLVYEAL---VAREIGTGLTRNEIPPWKLCLFGAFSGTMLWLTVYPLDV 262
           ++R        F +YE L    A+  G    ++ + PW+  + G+ +G +   T  PLDV
Sbjct: 159 IMREIPFTCIQFPLYEFLKKTWAKRNG----QDHVAPWQGSVCGSVAGAIAAATTTPLDV 214

Query: 263 VKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGP-TMVRSAPVNGATFL 317
           +K+ +       P     ++ +AK IYA+EG + FF G GP TM  SA   GA FL
Sbjct: 215 LKTRLMLSHKSIP-----VAQLAKNIYAEEGFKVFFSGVGPRTMWISA--GGAIFL 263

 Score = 28.5 bits (62), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 17/75 (22%), Positives = 33/75 (44%), Gaps = 15/75 (20%)

Query: 246 GAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTM 305
           GA +GT   L  +P+D +K+ +Q                    +A  G +  ++G G  +
Sbjct: 13  GAAAGTSTDLAFFPIDTLKTRLQAKG---------------GFFANGGYKGVYRGLGSAV 57

Query: 306 VRSAPVNGATFLTFE 320
           + SAP     F++++
Sbjct: 58  IASAPSASLFFVSYD 72

>KLLA0D04290g 366536..367102 similar to sgd|S0006215 Saccharomyces
           cerevisiae YPR011c, hypothetical start
          Length = 188

 Score = 50.1 bits (118), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 49/187 (26%), Positives = 79/187 (42%), Gaps = 14/187 (7%)

Query: 132 VDLSRSNTLPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGG-DREFKGPWDCIK 190
           +DL +      S  ++ G   G V+  + SP E+++I LQ Q+S    +         + 
Sbjct: 1   MDLKQLAKQESSIAFIAGGVAGAVSRTVVSPFERVKILLQVQSSTSAYNHGIINAVGQVY 60

Query: 191 KLKAQGGLMRGLFPTMIRAGHGLGTYFLVYEALVAR--EIGTGLTRNEIPPWKLCLFGAF 248
           K +   GL RG     +R        F+VYE        +   + + ++  W+    GA 
Sbjct: 61  KEEGVAGLFRGNGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGAL 120

Query: 249 SGTMLWLTVYPLDVVKS--IIQNDD---LRKPKYKNSI------SYVAKTIYAKEGIRAF 297
            G M  L  YPLD+V++   IQ  +   L K K K+          + KT   + GIR  
Sbjct: 121 CGGMSVLATYPLDLVRTRLSIQTANLAKLSKSKAKDIAKPPGVWELLVKTFKEEGGIRGL 180

Query: 298 FKGFGPT 304
           ++G  PT
Sbjct: 181 YRGIYPT 187

 Score = 35.0 bits (79), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 33/75 (44%), Gaps = 1/75 (1%)

Query: 246 GAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTM 305
           G  +G +    V P + VK ++Q        Y + I      +Y +EG+   F+G G   
Sbjct: 18  GGVAGAVSRTVVSPFERVKILLQVQS-STSAYNHGIINAVGQVYKEEGVAGLFRGNGLNC 76

Query: 306 VRSAPVNGATFLTFE 320
           VR  P +   F+ +E
Sbjct: 77  VRIFPYSAVQFVVYE 91

>Kwal_27.11626
          Length = 299

 Score = 51.2 bits (121), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 67/151 (44%), Gaps = 13/151 (8%)

Query: 162 PIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQG-GLMRGLFPTMIRAGHGLGTYFLVY 220
           P++ ++I+ QT   +   R F      IK LK +G GL RG   T  R  +  G++ L  
Sbjct: 137 PLDVLKIKRQTNPESFKGRGF------IKILKDEGFGLYRGWGWTAAR--NAPGSFALFG 188

Query: 221 EALVAREIGTGLTRNEIPPWKLCLFGAFSGTMLWLTV-YPLDVVKSIIQNDDLRKPKYKN 279
               A+E   GL       W      +  G    L V  PLDV+K+ IQN     P+   
Sbjct: 189 GNAFAKEYILGLKDYSSATWSQNFVSSIVGASASLIVSAPLDVIKTRIQNRHFDNPE--- 245

Query: 280 SISYVAKTIYAKEGIRAFFKGFGPTMVRSAP 310
           S   + +     EGI AFFKG  P ++ + P
Sbjct: 246 SGFRIVQNTLKNEGITAFFKGLTPKLLTTGP 276

 Score = 30.0 bits (66), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 21/88 (23%), Positives = 41/88 (46%), Gaps = 13/88 (14%)

Query: 143 SQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIK----KLKAQG-- 196
           SQ +V  + G   +  +++P++ I+ R+Q       +R F  P    +     LK +G  
Sbjct: 209 SQNFVSSIVGASASLIVSAPLDVIKTRIQ-------NRHFDNPESGFRIVQNTLKNEGIT 261

Query: 197 GLMRGLFPTMIRAGHGLGTYFLVYEALV 224
              +GL P ++  G  L   F + ++L+
Sbjct: 262 AFFKGLTPKLLTTGPKLVFSFALAQSLI 289

>CAGL0J01661g 154646..155629 highly similar to tr|Q12251
           Saccharomyces cerevisiae YPR011c, start by similarity
          Length = 327

 Score = 51.2 bits (121), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 48/180 (26%), Positives = 80/180 (44%), Gaps = 23/180 (12%)

Query: 162 PIEQIRIRLQTQTSNGGDREFK---------GPWDCIKKLKAQ-GGLM---RGLFPTMIR 208
           P++ +R RL  QT+N                G W  + K  A+ GG+M   RG++PT + 
Sbjct: 143 PLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSLG 202

Query: 209 AGHGLGTYFLVYEALV----AREIGTGLTRNEIPPWKLCLFGAFSGTMLWLTVYPLDVVK 264
               +   F VYE L     + E G    R+ +  +KL + GA SG +     YP D+++
Sbjct: 203 IVPYVALNFAVYEQLKEFMPSDENGNSSMRDSL--YKLSM-GAISGGVAQTITYPFDLLR 259

Query: 265 SIIQNDDLRKPK---YKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATFLTFEL 321
              Q   +   +   + NS+     TI   EG + ++KG    + +  P    ++L +EL
Sbjct: 260 RRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSWLVYEL 319

 Score = 50.8 bits (120), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 51/192 (26%), Positives = 83/192 (43%), Gaps = 20/192 (10%)

Query: 146 YVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQ---GGLMRGL 202
           ++ G   G ++  + SP E+++I LQ Q+S       KG +D I ++  +    GL RG 
Sbjct: 27  FLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYN--KGLFDAIGQVYKEENIKGLFRGN 84

Query: 203 FPTMIRAGHGLGTYFLVYEALVAR--EIGTGLTRNEIPPWKLCLFGAFSGTMLWLTVYPL 260
               IR        F+V+E        + T     ++  W+    GA  G    +  YPL
Sbjct: 85  GLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSVVATYPL 144

Query: 261 DVVKS--IIQNDDLRKPKYKNSISYVAK---------TIYAKE-GIRAFFKGFGPTMVRS 308
           D+V++   +Q  +L K   K+  S +AK           YA+E GI   ++G  PT +  
Sbjct: 145 DLVRTRLSVQTANLSKLS-KSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSLGI 203

Query: 309 APVNGATFLTFE 320
            P     F  +E
Sbjct: 204 VPYVALNFAVYE 215

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 36/144 (25%), Positives = 59/144 (40%), Gaps = 18/144 (12%)

Query: 83  GVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTLPL 142
           G+   Y+G     LG+   V++ F V E +K F     + +N N S +D          L
Sbjct: 188 GIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMP---SDENGNSSMRD---------SL 235

Query: 143 SQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFK--GPWDC---IKKLKAQGG 197
            +  +  ++GGV  + +  P + +R R Q     G +  F     WD    I K +   G
Sbjct: 236 YKLSMGAISGGVAQT-ITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKG 294

Query: 198 LMRGLFPTMIRAGHGLGTYFLVYE 221
             +GL   + +        +LVYE
Sbjct: 295 YYKGLTANLFKVVPSTAVSWLVYE 318

>Kwal_14.2210
          Length = 315

 Score = 50.8 bits (120), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 52/192 (27%), Positives = 83/192 (43%), Gaps = 23/192 (11%)

Query: 149 GLTGGVVNSFLAS-PIEQIRIRLQTQTSNGGDREFK---------GPWDCIKKLKAQGG- 197
            L GG   S LA+ P++ +R RL  QT+N                G W+ ++K   Q G 
Sbjct: 122 ALCGGC--SVLATYPLDLVRTRLSIQTANLARLHKAKAASAAKPPGVWELLRKTYTQEGG 179

Query: 198 ---LMRGLFPTMIRAGHGLGTYFLVYEALVARE-IGTGLTRNEIPPWKLCLFGAFSGTML 253
              L RG++PT I     +   F VYE L  RE I           +KL + GA SG + 
Sbjct: 180 IFGLYRGVWPTSIGVVPYVALNFAVYEQL--REYIPASFDPASASLYKLSI-GAISGGVA 236

Query: 254 WLTVYPLDVVKSIIQNDDLRKPK---YKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAP 310
               YP D+++   Q   + + +   +  S+     TI   EG + ++KG    + +  P
Sbjct: 237 QTITYPFDLLRRRFQVLAMGQSELGFHYKSVPDALITIGRTEGFKGYYKGLTANLFKVVP 296

Query: 311 VNGATFLTFELV 322
               +++ +E V
Sbjct: 297 STAVSWVVYETV 308

 Score = 44.3 bits (103), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 47/189 (24%), Positives = 78/189 (41%), Gaps = 17/189 (8%)

Query: 146 YVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQGG---LMRGL 202
           +  G   G V+  + SP E+++I LQ Q+S        G +  +K++  + G   L+RG 
Sbjct: 21  FCAGGIAGAVSRTVVSPFERVKILLQVQSSTHAYNH--GLFRAVKQVYLEEGVPGLLRGN 78

Query: 203 FPTMIRAGHGLGTYFLVYEALVAREIGTGLTRNEIPPWKLCLFGAFSGTMLWLTVYPLDV 262
               IR        FLVYE    ++         +  W   + GA  G    L  YPLD+
Sbjct: 79  GLNCIRIFPYSAVQFLVYE-FCKKQWFQQNPDTVVLNWHRLVSGALCGGCSVLATYPLDL 137

Query: 263 VKS--IIQNDDLRKPKYKNS--------ISYVAKTIYAKE-GIRAFFKGFGPTMVRSAPV 311
           V++   IQ  +L +     +        +  + +  Y +E GI   ++G  PT +   P 
Sbjct: 138 VRTRLSIQTANLARLHKAKAASAAKPPGVWELLRKTYTQEGGIFGLYRGVWPTSIGVVPY 197

Query: 312 NGATFLTFE 320
               F  +E
Sbjct: 198 VALNFAVYE 206

>KLLA0E12353g complement(1092303..1093220)
           gi|1351895|sp|P49382|ADT_KLULA Kluyveromyces lactis ADP,
           ATP carrier protein (ADP/ATP translocase) (Adenine
           nucleotide translocator) (ANT), start by similarity
          Length = 305

 Score = 50.8 bits (120), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 45/158 (28%), Positives = 69/158 (43%), Gaps = 10/158 (6%)

Query: 162 PIEQIRIRLQTQTSN---GGDREFKGPWDCIKKLKAQ---GGLMRGLFPTMIRAGHGLGT 215
            ++  R RL   + +   GG+R+F G  D  KK  A     GL RG  P+++      G 
Sbjct: 134 SLDYARTRLAADSKSAKKGGERQFNGLVDVYKKTLASDGVAGLYRGFLPSVVGIVVYRGL 193

Query: 216 YFLVYEALVAREIGTGLTRNEIPPWKLCLFGAFSGTMLWLTVYPLDVVKSIIQNDDLRKP 275
           YF +Y++L    +   L  + +  +   L G    T      YPLD V+  +     +  
Sbjct: 194 YFGLYDSLKPLLLTGSLENSFLASF---LLGWAVTTGASTASYPLDTVRRRMMMTSGQAV 250

Query: 276 KYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNG 313
           KY  +     K I A EGI++ FKG G  ++R     G
Sbjct: 251 KYDGAFDAFRK-IVAAEGIKSLFKGCGANILRGVAGAG 287

 Score = 32.0 bits (71), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 45/188 (23%), Positives = 74/188 (39%), Gaps = 34/188 (18%)

Query: 143 SQYYVCGLTGGV---VNSFLASPIEQIRIRLQTQTS----NGGDREFKGPWDCIKKLKAQ 195
           S + +  L GGV   V+   A+PIE++++ +Q Q         DR + G  +C K+  A 
Sbjct: 8   SNFAIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKQGSLDRRYTGIVECFKRTAAD 67

Query: 196 GGLM---RGLFPTMIRAGHGLGTYFLVYEALVAREIGTGLTRNE-IPPWKLCLFGAFSGT 251
            G+    RG    +IR        F   + + A     G  + E    W       F+G 
Sbjct: 68  EGVASFWRGNTANVIRYFPTQALNFAFKDKIKAM---FGFKKEEGYAKW-------FAGN 117

Query: 252 MLWLT---------VYPLDVVKSIIQNDDLRKPK----YKNSISYVAKTIYAKEGIRAFF 298
           +             VY LD  ++ +  D     K      N +  V K   A +G+   +
Sbjct: 118 LASGGLAGGLSLLFVYSLDYARTRLAADSKSAKKGGERQFNGLVDVYKKTLASDGVAGLY 177

Query: 299 KGFGPTMV 306
           +GF P++V
Sbjct: 178 RGFLPSVV 185

 Score = 29.3 bits (64), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 34/153 (22%), Positives = 61/153 (39%), Gaps = 54/153 (35%)

Query: 81  NEGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTL 140
           ++GV   Y+G L  ++G+ +   + FG+ +++K                           
Sbjct: 170 SDGVAGLYRGFLPSVVGIVVYRGLYFGLYDSLK--------------------------- 202

Query: 141 PLSQYYVCGLTGGVVNSFLAS----------------PIEQIRIRLQTQTSNGGDREFKG 184
           PL       LTG + NSFLAS                P++ +R R+    ++G   ++ G
Sbjct: 203 PLL------LTGSLENSFLASFLLGWAVTTGASTASYPLDTVRRRM--MMTSGQAVKYDG 254

Query: 185 PWDCIKKLKAQGG---LMRGLFPTMIRAGHGLG 214
            +D  +K+ A  G   L +G    ++R   G G
Sbjct: 255 AFDAFRKIVAAEGIKSLFKGCGANILRGVAGAG 287

>Kwal_27.12481
          Length = 304

 Score = 50.4 bits (119), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 52/181 (28%), Positives = 78/181 (43%), Gaps = 11/181 (6%)

Query: 149 GLTGGVVNSFLASPIEQIRIRLQTQTS---NGGDREFKGPWDCIKKLKAQ---GGLMRGL 202
           G  GG+   F+ S ++  R RL   +     GG+R+F G  D  KK  A     GL RG 
Sbjct: 122 GAAGGLSLMFVYS-LDYARTRLAADSKGAKKGGERQFNGLVDVYKKTLASDGIAGLYRGF 180

Query: 203 FPTMIRAGHGLGTYFLVYEALVAREIGTGLTRNEIPPWKLCLFGAFSGTMLWLTVYPLDV 262
            P+++      G YF  Y++L    +   L  + +  +   L G    T      YPLD 
Sbjct: 181 LPSVVGIVVYRGLYFGGYDSLKPLLLTGSLEGSFLASF---LLGWAVTTGASTASYPLDT 237

Query: 263 VKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATFLTFELV 322
           V+  +     +  KY  +     K I A EGI++ FKG G  ++R     G   +  +L 
Sbjct: 238 VRRRMMMTSGQAVKYNGAFDAFRK-IVAAEGIKSLFKGCGANILRGVAGAGVISMYDQLQ 296

Query: 323 M 323
           M
Sbjct: 297 M 297

>Sklu_2117.2 YDL198C, Contig c2117 3737-4633
          Length = 298

 Score = 50.4 bits (119), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 45/151 (29%), Positives = 66/151 (43%), Gaps = 13/151 (8%)

Query: 162 PIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQG-GLMRGLFPTMIRAGHGLGTYFLVY 220
           P++ ++I+ QT       R F      +K LK +G GL RG   T  R  +  G++ L  
Sbjct: 137 PLDVLKIKRQTNPEAFKGRGF------VKILKDEGLGLYRGWGWTAAR--NAPGSFALFG 188

Query: 221 EALVAREIGTGLTRNEIPPWKLCLFGAFSGTMLWLTV-YPLDVVKSIIQNDDLRKPKYKN 279
               A+E   GL       W      +  G    L +  PLDV+K+ IQN +   P+   
Sbjct: 189 GNAFAKEYILGLKDYSQATWSQNFVSSIVGASASLIISAPLDVIKTRIQNKNFENPESGF 248

Query: 280 SISYVAKTIYAKEGIRAFFKGFGPTMVRSAP 310
           +I    K     EG  AFFKG  P ++ + P
Sbjct: 249 TI---VKNTLKNEGFSAFFKGLTPKLLTTGP 276

 Score = 28.9 bits (63), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 21/88 (23%), Positives = 43/88 (48%), Gaps = 13/88 (14%)

Query: 143 SQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGP---WDCIKK-LKAQG-- 196
           SQ +V  + G   +  +++P++ I+ R+Q       ++ F+ P   +  +K  LK +G  
Sbjct: 209 SQNFVSSIVGASASLIISAPLDVIKTRIQ-------NKNFENPESGFTIVKNTLKNEGFS 261

Query: 197 GLMRGLFPTMIRAGHGLGTYFLVYEALV 224
              +GL P ++  G  L   F + + L+
Sbjct: 262 AFFKGLTPKLLTTGPKLVFSFALAQTLI 289

>YBR192W (RIM2) [375] chr2 (607609..608742) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, required for respiration [1134 bp, 377 aa]
          Length = 377

 Score = 50.4 bits (119), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 47/184 (25%), Positives = 88/184 (47%), Gaps = 23/184 (12%)

Query: 161 SPIEQIRIRLQTQTSNGGD-REFKGPWDCIKK-LKAQG--GLMRGLFPTMIRAGHGLGTY 216
           +PI  I+ R+Q   +     R++K  WDC+K  ++ +G  GL +GL  + + +  G+   
Sbjct: 194 NPIWLIKTRVQLDKAGKTSVRQYKNSWDCLKSVIRNEGFTGLYKGLSASYLGSVEGI-LQ 252

Query: 217 FLVYEALV----AREI--------GTGLTRNEIPPWKLCLFGAFSGTMLW---LTVYPLD 261
           +L+YE +      R I        GT  T  ++  W  C     +G   +   +  YP +
Sbjct: 253 WLLYEQMKRLIKERSIEKFGYQAEGTKSTSEKVKEW--CQRSGSAGLAKFVASIATYPHE 310

Query: 262 VVKSIIQNDDLRKPKYKNS-ISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATFLTFE 320
           VV++ ++       K K + +    K I  +EG+ + + G  P ++R+ P +   F T+E
Sbjct: 311 VVRTRLRQTPKENGKRKYTGLVQSFKVIIKEEGLFSMYSGLTPHLMRTVPNSIIMFGTWE 370

Query: 321 LVMR 324
           +V+R
Sbjct: 371 IVIR 374

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 45/109 (41%), Gaps = 27/109 (24%)

Query: 237 IPPWKLCLFGAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKN-------------SISY 283
           + PW   + G   G    +   P D+VK+ +Q+D   K  YK+             SI+Y
Sbjct: 50  VKPWVHFVAGGIGGMAGAVVTCPFDLVKTRLQSDIFLKA-YKSQAVNISKGSTRPKSINY 108

Query: 284 VAKT-------------IYAKEGIRAFFKGFGPTMVRSAPVNGATFLTF 319
           V +              +Y +EG R+ FKG GP +V   P     F T+
Sbjct: 109 VIQAGTHFKETLGIIGNVYKQEGFRSLFKGLGPNLVGVIPARSINFFTY 157

>KLLA0D15015g 1267803..1268756 similar to sp|P53257 Saccharomyces
           cerevisiae YGR096w, start by similarity
          Length = 317

 Score = 50.1 bits (118), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 47/200 (23%), Positives = 86/200 (43%), Gaps = 24/200 (12%)

Query: 133 DLSRSNTLPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKL 192
            L +  T+      + G   GV      +P++ ++IR Q Q     + ++KG    ++ +
Sbjct: 9   HLRKGETVSWYNSVIAGSVSGVFARMATAPMDTVKIRYQLQPVQ--EDKYKGIASTVRTI 66

Query: 193 KAQGGLMRGLFPTMIRAGHGLGTYFLVYEALVAREIGTGLTRNEIPPWKLCLF------- 245
             + GL R L+   I A       ++VY A+   + G+    N +   K   F       
Sbjct: 67  MKEEGL-RALWKGNIPAT----AMYVVYGAV---QFGSYSWFNNVWSAKFPRFSQQGQTL 118

Query: 246 --GAFSGTMLWLTVYPLDVVKS-IIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFG 302
             GA +G    +  YPLD++++ +I N    +  ++ S++   + ++  EG+R FF G  
Sbjct: 119 TVGALAGMTSSVVSYPLDLLRTRLIAN----RTSHRTSVAEECRQMWLNEGVRGFFTGIS 174

Query: 303 PTMVRSAPVNGATFLTFELV 322
             M          FLT+E V
Sbjct: 175 TAMTTVTLSTAIMFLTYETV 194

 Score = 47.8 bits (112), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 56/261 (21%), Positives = 100/261 (38%), Gaps = 41/261 (15%)

Query: 80  KNEGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNT 139
           K EG+ A +KG +       +  +VQFG       +F N  ++K P  S Q   L+    
Sbjct: 68  KEEGLRALWKGNIPATAMYVVYGAVQFGSYS----WFNNVWSAKFPRFSQQGQTLT---- 119

Query: 140 LPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQG--G 197
                    G   G+ +S ++ P++ +R RL    +N          +C +    +G  G
Sbjct: 120 --------VGALAGMTSSVVSYPLDLLRTRL---IANRTSHRTSVAEECRQMWLNEGVRG 168

Query: 198 LMRGLFPTMIRAGHGLGTYFLVYEA--LVAREIGTGLTRNEIPPWKLCLFGAFSGTMLWL 255
              G+   M          FL YE   +V            +      + G  S TM   
Sbjct: 169 FFTGISTAMTTVTLSTAIMFLTYETVNIVCENHEKEFWSRPVSASSGIIAGFVSKTM--- 225

Query: 256 TVYPLDVVKSIIQNDDLRKP-------------KYKNSISYVAKTIYAKEGIRAFFKGFG 302
            V+P+D ++  +Q  + ++              +YK+S + + K I  +EG+ A ++G  
Sbjct: 226 -VFPIDTLRRRMQVMNSKRTVHFTKFPAVYHEYRYKSSTAIIYK-ILRQEGVSALYRGLT 283

Query: 303 PTMVRSAPVNGATFLTFELVM 323
             + +S P    +   +E  M
Sbjct: 284 MGLCKSVPTTAISLFVYERTM 304

>Scas_562.12
          Length = 300

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 46/152 (30%), Positives = 66/152 (43%), Gaps = 14/152 (9%)

Query: 162 PIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQG--GLMRGLFPTMIRAGHGLGTYFLV 219
           P++ ++I+ QT       R F      +K LK +G   L RG   T  R  +  G++ L 
Sbjct: 138 PLDVLKIKRQTNPEAFKGRGF------VKILKDEGIFNLYRGWGWTAAR--NAPGSFALF 189

Query: 220 YEALVAREIGTGLTRNEIPPWKLCLFGAFSGTMLWLTV-YPLDVVKSIIQNDDLRKPKYK 278
                A+E   GL       W      +  G    L V  PLDV+K+ IQN     P+  
Sbjct: 190 GGNAFAKEYILGLEDYSQASWSQNFISSIVGASCSLIVSAPLDVIKTRIQNRSFDNPETG 249

Query: 279 NSISYVAKTIYAKEGIRAFFKGFGPTMVRSAP 310
            +I    K  +  EGI AFFKG  P ++ + P
Sbjct: 250 LTI---VKNTFKNEGITAFFKGLTPKLLTTGP 278

>AAL014C [173] [Homologous to ScYNL003C (PET8) - SH]
           (317388..318203) [816 bp, 271 aa]
          Length = 271

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 46/160 (28%), Positives = 77/160 (48%), Gaps = 15/160 (9%)

Query: 162 PIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQG---GLMRGLFPTMIRAGHGLGTYFL 218
           P E I+ R QT  +N   +  +     ++    +G   GL RG + T++R        F 
Sbjct: 113 PAEVIKQRTQTHHTNSSLQTLR---LILRDPTGEGVVRGLYRGWWTTIMREIPFTCIQFP 169

Query: 219 VYEALVAREIGTGLTRNEIPPWKLCLFGAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYK 278
           +YE L  ++         +  W+  + G+ +G +      PLDV+K+ +   + R P   
Sbjct: 170 LYEYL-KKKWAAYAEIERVSAWQGAVCGSLAGGIAAAATTPLDVLKTRMMLHERRVP--- 225

Query: 279 NSISYVAKTIYAKEGIRAFFKGFGP-TMVRSAPVNGATFL 317
             + ++A+T++ +EG R FF+G GP TM  SA   GA FL
Sbjct: 226 --MLHLARTLFREEGARVFFRGIGPRTMWISA--GGAIFL 261

>YMR166C (YMR166C) [4121] chr13 complement(593366..594472) Member of
           the mitochondrial carrier (MCF) protein family of
           membrane transporters [1107 bp, 368 aa]
          Length = 368

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 68/293 (23%), Positives = 108/293 (36%), Gaps = 87/293 (29%)

Query: 82  EGVF-AFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTL 140
           EGV    Y G +  +LG     ++ FG  E  KR              +   D   ++T+
Sbjct: 104 EGVRRGLYGGYMAAMLGSFPSAAIFFGTYEYTKR--------------TMIEDWQINDTI 149

Query: 141 PLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQGGL-- 198
               +   G  G  ++SF+  P E ++ RLQ Q        F  P+        Q G   
Sbjct: 150 ---THLSAGFLGDFISSFVYVPSEVLKTRLQLQG------RFNNPF-------FQSGYNY 193

Query: 199 --MRGLFPTMIRAGHGLGTYFLVYEALVAREI---------------------------G 229
             +R    T+I+   G  + F  Y+A +AR++                           G
Sbjct: 194 SNLRNAIKTVIKE-EGFRSLFFGYKATLARDLPFSALQFAFYEKFRQLAFKIEQKDGRDG 252

Query: 230 TGLTRNEIPPWKLCLFGAFSGTMLWLTVYPLDVVKSIIQND------------------D 271
                NEI      L GA +G +  +   P+DVVK+ +Q                    +
Sbjct: 253 ELSIPNEI------LTGACAGGLAGIITTPMDVVKTRVQTQQPPSQSNKSYSVTHPHVTN 306

Query: 272 LRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATFLTFELVMR 324
            R     NSIS   +T+Y  EG+  FF G GP  V ++  +    L +++ +R
Sbjct: 307 GRPAALSNSISLSLRTVYQSEGVLGFFSGVGPRFVWTSVQSSIMLLLYQMTLR 359

>Kwal_23.4354
          Length = 343

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 47/221 (21%), Positives = 90/221 (40%), Gaps = 45/221 (20%)

Query: 142 LSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQ--------------TSNGGDR------- 180
           L +  +  + G ++ S + +P++ +RIRLQ Q              TS    +       
Sbjct: 11  LKERLLSAVVGSLLTSLILTPMDVVRIRLQQQKMLPDCGCETDAGLTSRASSKGVFWQDI 70

Query: 181 ------------EFKGPWDC---IKKLKAQGGLMRGLFPTMIRAGHGLGTYFLVYEALVA 225
                        +   WD    I K++    L RGL  T++ A      YF+ YE+L  
Sbjct: 71  CFEDVRCKTSPVRYNSTWDAFGKIAKIEGVQSLWRGLSITLLMAAPANMVYFIGYESLRD 130

Query: 226 REIGTGLTRNEIPPWKLCLFGAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSI---S 282
           +       +++ P     + GA +  +   TV PL++ ++ +Q+     PK   ++    
Sbjct: 131 K----SRLQDKYPTLNPLMCGALARVLAATTVAPLELFRTRLQSIPRSSPKSTTAMMIKD 186

Query: 283 YVAKTIY--AKEGIRAFFKGFGPTMVRSAPVNGATFLTFEL 321
            + ++ Y  +K G +A F+G   T+ R  P +   +  +E 
Sbjct: 187 LIKESRYEISKVGYKALFRGLEITLWRDVPFSSIYWGCYEF 227

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 48/196 (24%), Positives = 82/196 (41%), Gaps = 19/196 (9%)

Query: 147 VCGLTGGVVNSFLASPIEQIRIRLQT-QTSNGGDREFKGPWDCIKKLKAQ------GGLM 199
           +CG    V+ +   +P+E  R RLQ+   S+          D IK+ + +        L 
Sbjct: 145 MCGALARVLAATTVAPLELFRTRLQSIPRSSPKSTTAMMIKDLIKESRYEISKVGYKALF 204

Query: 200 RGLFPTMIRAGHGLGTYFLVYE---ALVAREIGTGLTRNEIPPWKLCLF----GAFSGTM 252
           RGL  T+ R       Y+  YE   + V+ +    +  +    W   +     G+F G +
Sbjct: 205 RGLEITLWRDVPFSSIYWGCYEFYKSNVSIDSEKSIVNSSNSNWNHFVNSFVGGSFGGAV 264

Query: 253 LWLTVYPLDVVKSIIQ----NDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRS 308
             +  +P DV K+ +Q    N  L K   KN   Y+ + +   EG+ A + G  P +++ 
Sbjct: 265 AAVLTHPFDVGKTRMQITYLNSTLEKKPSKNMFKYLNQ-MRKSEGLAALYTGLVPRVIKI 323

Query: 309 APVNGATFLTFELVMR 324
           AP       T+E+  R
Sbjct: 324 APSCAIMISTYEVCKR 339

>KLLA0E18810g 1663220..1664353 some similarities with sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, mitochondrial (MCF), hypothetical start
          Length = 377

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 57/196 (29%), Positives = 89/196 (45%), Gaps = 32/196 (16%)

Query: 147 VCGLTGGVVNSFLA-SPIEQIRIRL----QTQTSNGGDREFKGPWDCIKKLKAQG--GLM 199
           V GL  G++ S +A +P E I+  L    Q       +       +  K L  QG  GL 
Sbjct: 191 VAGLGAGLLESVVAVTPFEAIKTALIDDKQAAVPKYQNNGKGMVSNYAKLLSDQGFSGLY 250

Query: 200 RGLFPTMIRAGHG----LGTYFLVYEALVA--------REIGTGLTRNEIPPWKLCLFGA 247
           RG+ P  +R        LG Y  + + LV         + + +GLT          + GA
Sbjct: 251 RGVLPVSMRQAANQAVRLGCYNKI-KTLVQDYTNVPKDKPLSSGLTF---------IVGA 300

Query: 248 FSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVR 307
           FSG +   T  P+D VK+ +Q+  L   +Y ++I+  A TI+ +EG++ F+KG  P + R
Sbjct: 301 FSGIVTVYTTMPIDTVKTRMQS--LNAGQYSSTINCFA-TIFKEEGLKTFWKGATPRLGR 357

Query: 308 SAPVNGATFLTFELVM 323
                G  F  +E V+
Sbjct: 358 LILSGGIVFTIYEKVL 373

>CAGL0G03135g 290834..291757 similar to sp|P53257 Saccharomyces
           cerevisiae YGR096w, hypothetical start
          Length = 307

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 51/200 (25%), Positives = 83/200 (41%), Gaps = 28/200 (14%)

Query: 130 QDVDLSRSNTLPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCI 189
           +D ++S +N+L      V G   G+      +P++ ++I+LQ    N      K     I
Sbjct: 9   KDEEVSTTNSL------VAGSLSGLFARTCIAPLDTVKIKLQVTPHN------KNANVLI 56

Query: 190 KKLKAQG--GLMRGLFP----TMIRAGHGLGTYFLVYEALVAREIGTGLTRNEIPPWKLC 243
             LK +G  G  +G  P     +I  G   G+Y  +   L       GL  N  P    C
Sbjct: 57  NILKREGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRG-----GLDLNISPQLYSC 111

Query: 244 LFGAFSGTMLWLTVYPLDVVKS-IIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFG 302
           L G+ +G    L  YP DV+++    N   +  K ++ I      I++ EG+  FF G G
Sbjct: 112 LVGSLAGMTSSLASYPFDVLRTRFAANSQGQLIKLRDEI----MAIWSHEGLMGFFSGCG 167

Query: 303 PTMVRSAPVNGATFLTFELV 322
            +M+         F  +E +
Sbjct: 168 SSMINIGLNTAIMFGVYESI 187

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 60/262 (22%), Positives = 101/262 (38%), Gaps = 36/262 (13%)

Query: 80  KNEGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNT 139
           K EG+  F+KG +   +   I    QFG    +  F +             D+++S    
Sbjct: 60  KREGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRG----------GLDLNIS---- 105

Query: 140 LPLSQYYVC--GLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQGG 197
               Q Y C  G   G+ +S  + P + +R R     S G   + +     I   +   G
Sbjct: 106 ---PQLYSCLVGSLAGMTSSLASYPFDVLRTRFAAN-SQGQLIKLRDEIMAIWSHEGLMG 161

Query: 198 LMRGLFPTMIRAGHGLGTYFLVYEALVAREIGTGLTRNEIPPWKLC--LFGAFSGTMLWL 255
              G   +MI  G      F VYE++           +   P+ L   L G  SG    L
Sbjct: 162 FFSGCGSSMINIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKL 221

Query: 256 TVYPLDVVKSIIQ-----NDDLRKPKYKNSI--SY-------VAKTIYAKEGIRAFFKGF 301
             +PLD V+  IQ     N++    ++   I  SY       V  ++  +EG  + ++G 
Sbjct: 222 ATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGV 281

Query: 302 GPTMVRSAPVNGATFLTFELVM 323
             ++++S P    +  ++EL M
Sbjct: 282 TMSLIKSVPSTAISLWSYELFM 303

 Score = 37.0 bits (84), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 32/153 (20%), Positives = 58/153 (37%), Gaps = 17/153 (11%)

Query: 35  LKDIFAGTIGGIAQVLVGQPFDXXXXXXXXXXXXXXXXXXXXXXX--KNEGVFAFYKGAL 92
           L     G++ G+   L   PFD                          +EG+  F+ G  
Sbjct: 108 LYSCLVGSLAGMTSSLASYPFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCG 167

Query: 93  TPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTLPLSQYYVCGLTG 152
           + ++ +G+  ++ FGV E++K F +     +   +S +    +  N L        G   
Sbjct: 168 SSMINIGLNTAIMFGVYESIKIFTE-----ERSKLSDRRDPFTLLNEL-------AGPIS 215

Query: 153 GVVNSFLASPIEQIRIRLQTQTS---NGGDREF 182
           G  +     P++ +R R+Q + S      DREF
Sbjct: 216 GFTSKLATFPLDTVRRRIQIRNSPNEERHDREF 248

>CAGL0G01166g complement(111298..112185) highly similar to tr|Q06143
           Saccharomyces cerevisiae YLR348c DIC1, hypothetical
           start
          Length = 295

 Score = 48.5 bits (114), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 64/254 (25%), Positives = 101/254 (39%), Gaps = 38/254 (14%)

Query: 80  KNEGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNT 139
           KNEG+   Y G    LL      + +FG+ +A+K      +  K  NM            
Sbjct: 53  KNEGIVGLYAGLSASLLRQCTYTTARFGMYDALKEHVIPRD--KLTNMWYL--------- 101

Query: 140 LPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGD--REFKGPWDCIKKL-KAQG 196
             L    V G  GG+  +F     + I IR+Q  ++   D  R +K   D + K+ KA+G
Sbjct: 102 --LGASMVSGALGGLAGNF----ADLINIRMQNDSALPLDKRRNYKNAIDGMVKIYKAEG 155

Query: 197 G---LMRGLFPTMIRAGHGLGTYFLVYEALVAREIGTGLTRNEIPPWK------LCLFGA 247
                + G  P M+R      +  + Y+      +    T+  + P K        L   
Sbjct: 156 AKSLFLTGWKPNMVRGVLMTASQVVTYDMFKNFLV----TKYNMDPKKNSTHLTSSLLAG 211

Query: 248 FSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISY-VAKTIYAKEGIRAFFKGFGPTMV 306
           F  T +     P DV+K+I+ N   +KP + +  S+ +      KEG    F+G+ P+  
Sbjct: 212 FVATTV---CSPADVIKTIVMNAH-KKPGHNHDSSFKILMEAINKEGPSFMFRGWVPSFT 267

Query: 307 RSAPVNGATFLTFE 320
           R AP     F   E
Sbjct: 268 RLAPFTMLIFFAME 281

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 62/137 (45%), Gaps = 11/137 (8%)

Query: 192 LKAQG--GLMRGLFPTMIRAGHGLGTYFLVYEALVAREIGTGLTRNEIPPWKLCLFGAFS 249
           LK +G  GL  GL  +++R        F +Y+AL    I      N    W L      S
Sbjct: 52  LKNEGIVGLYAGLSASLLRQCTYTTARFGMYDALKEHVIPRDKLTNM---WYLLGASMVS 108

Query: 250 GTMLWLTVYPLDVVKSIIQNDDL----RKPKYKNSISYVAKTIYAKEGIRAFF-KGFGPT 304
           G +  L     D++   +QND      ++  YKN+I  + K IY  EG ++ F  G+ P 
Sbjct: 109 GALGGLAGNFADLINIRMQNDSALPLDKRRNYKNAIDGMVK-IYKAEGAKSLFLTGWKPN 167

Query: 305 MVRSAPVNGATFLTFEL 321
           MVR   +  +  +T+++
Sbjct: 168 MVRGVLMTASQVVTYDM 184

 Score = 33.5 bits (75), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 20/82 (24%), Positives = 37/82 (45%), Gaps = 7/82 (8%)

Query: 239 PWKLCLFGAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFF 298
           PW    +G  +G    +  +PLD+ K  +Q   + KP    +I  + ++I   EGI   +
Sbjct: 9   PW---WYGGAAGIFAVMNTHPLDLTKVRLQAAPIPKP----TIVQMLRSILKNEGIVGLY 61

Query: 299 KGFGPTMVRSAPVNGATFLTFE 320
            G   +++R      A F  ++
Sbjct: 62  AGLSASLLRQCTYTTARFGMYD 83

>Scas_613.24
          Length = 177

 Score = 47.4 bits (111), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 42/173 (24%), Positives = 73/173 (42%), Gaps = 23/173 (13%)

Query: 143 SQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGP--WDCIKKLKAQGGLMR 200
           S + V G  GG+ ++    P++ ++ R+Q         + KG   W  IK +K      R
Sbjct: 9   SVHLVSGFIGGLSSAVTLQPLDLLKTRIQ---------QHKGATLWSAIKDIKDPIQFWR 59

Query: 201 GLFPTMIRAGHGLGTYFLVYEALVAREIGTGLTRN--------EIPPWKLCLFGAFSGTM 252
           G  P+ +R   G   Y      +  + +               ++  ++  L GA +  +
Sbjct: 60  GTLPSALRTSIGSALYLSCLNIMRTQLVHGKKGSAASKSSSLPQLTMYENLLTGAMARGL 119

Query: 253 LWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTM 305
           +     P+ ++K   ++       YK S++   K IY  EGI  FFKGFGPT+
Sbjct: 120 VGYITMPITILKVRYESTYY---SYK-SMNEAIKDIYKMEGISGFFKGFGPTV 168

>KLLA0E23705g complement(2099965..2101071) highly similar to
           sp|P38127 Saccharomyces cerevisiae YBR192w RIM2
           mitochondrial carrier protein (MCF), start by similarity
          Length = 368

 Score = 48.5 bits (114), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 48/199 (24%), Positives = 90/199 (45%), Gaps = 24/199 (12%)

Query: 145 YYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKL-KAQG--GLMRG 201
           + +   T G   S + +PI  ++ RLQ      G + +K   DCIK + K +G  GL +G
Sbjct: 172 HLLAAATAGWATSTVTNPIWLVKTRLQLD--KAGTKTYKNSLDCIKSVVKNEGVLGLYKG 229

Query: 202 LFPTMIRAGHGLGTYFLVYEALV----AREI--------GTGLTRNEIPPWKLCLFGAFS 249
           L  + + +  G+  + L YE +      R I            T +++  W  C     +
Sbjct: 230 LSASYLGSVEGILQWIL-YEQMKRIIKERSIEKFGHIHEDAKSTSDKVKEW--CQRSGSA 286

Query: 250 GTMLW---LTVYPLDVVKSIIQNDDLRKPKYKNS-ISYVAKTIYAKEGIRAFFKGFGPTM 305
           G   +   +  YP +VV++ ++       K K + +    + I  +EG+ + + G  P +
Sbjct: 287 GLAKFVASIVTYPHEVVRTRLRQAPTENGKLKYTGLVQSFRVIIKEEGLVSMYSGLTPHL 346

Query: 306 VRSAPVNGATFLTFELVMR 324
           +R+ P +   F T+ELV++
Sbjct: 347 LRTVPNSIIMFGTWELVIK 365

 Score = 41.6 bits (96), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 41/83 (49%), Gaps = 23/83 (27%)

Query: 259 PLDVVKSIIQNDDLRKPKYKN---------SISYVAKT-------------IYAKEGIRA 296
           P DVVK+ +Q+D  R  +YK+         ++ +V+++             +Y +EG R+
Sbjct: 70  PFDVVKTRLQSDVFR-TQYKSAAMQNNGSSTLHFVSRSLLHFKETFGIIGNVYRQEGFRS 128

Query: 297 FFKGFGPTMVRSAPVNGATFLTF 319
            FKG GP +V   P     FLT+
Sbjct: 129 LFKGLGPNLVGVIPARSINFLTY 151

 Score = 35.8 bits (81), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 40/176 (22%), Positives = 69/176 (39%), Gaps = 31/176 (17%)

Query: 159 LASPIEQIRIRLQTQT-----------SNGGDR---------EFKGPWDCIKKLKAQGG- 197
           +  P + ++ RLQ+             +NG             FK  +  I  +  Q G 
Sbjct: 67  VTCPFDVVKTRLQSDVFRTQYKSAAMQNNGSSTLHFVSRSLLHFKETFGIIGNVYRQEGF 126

Query: 198 --LMRGLFPTMIRAGHGLGTYFLVY---EALVAREIGTGLTRNEIPPWKLCLFGAFSGTM 252
             L +GL P ++         FL Y   + + +R +  G    +  PW   L  A +G  
Sbjct: 127 RSLFKGLGPNLVGVIPARSINFLTYGTTKDIYSRTLNNG----QEAPWIHLLAAATAGWA 182

Query: 253 LWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRS 308
                 P+ +VK+ +Q D      YKNS+  + K++   EG+   +KG   + + S
Sbjct: 183 TSTVTNPIWLVKTRLQLDKAGTKTYKNSLDCI-KSVVKNEGVLGLYKGLSASYLGS 237

>Scas_669.6
          Length = 373

 Score = 48.5 bits (114), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 63/272 (23%), Positives = 97/272 (35%), Gaps = 53/272 (19%)

Query: 87  FYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTLPLSQYY 146
            Y G    +LG     ++ FG  E  KR                  DL  ++T+    + 
Sbjct: 108 LYGGYFAAMLGSFPSAAIFFGTYEWCKR--------------KMIGDLGFNDTV---SHL 150

Query: 147 VCGLTGGVVNSFLASPIEQIRIRLQTQ--------TSNGGDREFKGPWDCIKKLKAQGGL 198
             GL G  V+SF+  P E ++ RLQ Q         S    R  +     I   +    L
Sbjct: 151 SAGLLGDFVSSFVYVPSEVLKTRLQLQGRVNNPFFQSGYNYRSLRTAIRIIVNTEGVKAL 210

Query: 199 MRGLFPTMIRAGHGLGTYFLVYEALVAREIGTGLTRNEIPPWKLCL-----FGAFSGTML 253
             G   T+ R        F  YE    R+    L + +I    L +      GA +G + 
Sbjct: 211 FFGYKATLARDLPFSALQFGFYEKF--RQTAFKLEKKDITKHNLSIPNEIFTGAIAGGLA 268

Query: 254 WLTVYPLDVVKSIIQ---------------------NDDLRKPKYKNSISYVAKTIYAKE 292
            +   P+DV+K+ +Q                     N   R     NSI    K +Y  E
Sbjct: 269 GIITTPMDVIKTRLQTQQADINPNSATTVGAISAKTNKKSRPIVLSNSIFRSLKLVYQSE 328

Query: 293 GIRAFFKGFGPTMVRSAPVNGATFLTFELVMR 324
           G+  FF G GP  V ++  +    L +++ +R
Sbjct: 329 GVIGFFSGVGPRFVWTSVQSSIMLLLYQMTLR 360

 Score = 33.9 bits (76), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 37/70 (52%), Gaps = 3/70 (4%)

Query: 256 TVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGI-RAFFKGFGPTMVRSAPVNGA 314
           +++ LD VK+  Q   +  PKYKN  +   +TI+ +EGI R  + G+   M+ S P    
Sbjct: 68  SMHSLDTVKTRQQGAPM-TPKYKNMTT-AYRTIFLEEGIARGLYGGYFAAMLGSFPSAAI 125

Query: 315 TFLTFELVMR 324
            F T+E   R
Sbjct: 126 FFGTYEWCKR 135

>YDL198C (GGC1) [676] chr4 complement(103650..104552) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses loss of Abf2p
           [903 bp, 300 aa]
          Length = 300

 Score = 48.1 bits (113), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 45/152 (29%), Positives = 67/152 (44%), Gaps = 14/152 (9%)

Query: 162 PIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQG--GLMRGLFPTMIRAGHGLGTYFLV 219
           P++ ++I+ QT   +   R F      IK L+ +G   L RG   T  R  +  G++ L 
Sbjct: 138 PLDVLKIKRQTNPESFKGRGF------IKILRDEGLFNLYRGWGWTAAR--NAPGSFALF 189

Query: 220 YEALVAREIGTGLTRNEIPPWKLCLFGAFSGTMLWLTV-YPLDVVKSIIQNDDLRKPKYK 278
                A+E   GL       W      +  G    L V  PLDV+K+ IQN +   P+  
Sbjct: 190 GGNAFAKEYILGLKDYSQATWSQNFISSIVGACSSLIVSAPLDVIKTRIQNRNFDNPE-- 247

Query: 279 NSISYVAKTIYAKEGIRAFFKGFGPTMVRSAP 310
            S   + K     EG+ AFFKG  P ++ + P
Sbjct: 248 -SGLRIVKNTLKNEGVTAFFKGLTPKLLTTGP 278

 Score = 31.2 bits (69), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 21/90 (23%), Positives = 43/90 (47%), Gaps = 13/90 (14%)

Query: 143 SQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIK----KLKAQG-- 196
           SQ ++  + G   +  +++P++ I+ R+Q       +R F  P   ++     LK +G  
Sbjct: 211 SQNFISSIVGACSSLIVSAPLDVIKTRIQ-------NRNFDNPESGLRIVKNTLKNEGVT 263

Query: 197 GLMRGLFPTMIRAGHGLGTYFLVYEALVAR 226
              +GL P ++  G  L   F + ++L+ R
Sbjct: 264 AFFKGLTPKLLTTGPKLVFSFALAQSLIPR 293

>YNL003C (PET8) [4582] chr14 complement(624974..625828) Protein of
           the mitochondrial carrier (MCF) family of membrane
           transporters, has similarity to Mrs4p and Mrs3p [855 bp,
           284 aa]
          Length = 284

 Score = 47.8 bits (112), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 47/167 (28%), Positives = 72/167 (43%), Gaps = 9/167 (5%)

Query: 152 GGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQGGLMRGLFPTMIRAGH 211
           G +    +  P E ++ R Q  ++N   +  +       K   +  L RG   T++R   
Sbjct: 104 GEICACLVRVPAEVVKQRTQVHSTNSSWQTLQSILRNDNKEGLRKNLYRGWSTTIMREIP 163

Query: 212 GLGTYFLVYEALVAREIGTGLTRNEIPPWKLCLFGAFSGTMLWLTVYPLDVVKSIIQNDD 271
                F +YE L  +       ++++ PWK  + G+ +G +   T  PLD +K+      
Sbjct: 164 FTCIQFPLYEYL-KKTWAKANGQSQVEPWKGAICGSIAGGIAAATTTPLDFLKT-----R 217

Query: 272 LRKPKYKNSISYVAKTIYAKEGIRAFFKGFGP-TMVRSAPVNGATFL 317
           L   K   S+  V   IY +EG   FF G GP TM  SA   GA FL
Sbjct: 218 LMLNKTTASLGSVIIRIYREEGPAVFFSGVGPRTMWISA--GGAIFL 262

 Score = 30.4 bits (67), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 19/77 (24%), Positives = 34/77 (44%), Gaps = 15/77 (19%)

Query: 244 LFGAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGP 303
           L GA +GT   L  +P+D +K+ +Q                    +A  G +  ++G G 
Sbjct: 9   LSGAAAGTSTDLVFFPIDTIKTRLQAKG---------------GFFANGGYKGIYRGLGS 53

Query: 304 TMVRSAPVNGATFLTFE 320
            +V SAP     F++++
Sbjct: 54  AVVASAPGASLFFISYD 70

>KLLA0F13464g 1246646..1247548 highly similar to sp|P38988
           Saccharomyces cerevisiae YDL198c YHM1 member of the
           mitochondrial carrier family (MCF), start by similarity
          Length = 300

 Score = 47.8 bits (112), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 45/151 (29%), Positives = 67/151 (44%), Gaps = 13/151 (8%)

Query: 162 PIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQG-GLMRGLFPTMIRAGHGLGTYFLVY 220
           P++ ++I+ QT   +   R F      +K +K +G GL RG   T  R  +  G++ L  
Sbjct: 138 PLDVLKIKRQTNPESFKGRGF------LKIIKDEGFGLYRGWGWTAAR--NAPGSFALFG 189

Query: 221 EALVAREIGTGLTRNEIPPWKLCLFGAFSGTMLWLTV-YPLDVVKSIIQNDDLRKPKYKN 279
               A+E   GL       W      +  G    L V  PLDV+K+ IQN +   P+   
Sbjct: 190 GNAFAKEYILGLKDYGQATWSQNFVSSIVGASASLIVSAPLDVIKTRIQNRNFDNPE--- 246

Query: 280 SISYVAKTIYAKEGIRAFFKGFGPTMVRSAP 310
           S   + K     EG  AFFKG  P ++ + P
Sbjct: 247 SGFKIIKNTLKNEGFTAFFKGLTPKLLTTGP 277

 Score = 30.8 bits (68), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 42/85 (49%), Gaps = 7/85 (8%)

Query: 143 SQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKK-LKAQG--GLM 199
           SQ +V  + G   +  +++P++ I+ R+Q +  +  +  FK     IK  LK +G     
Sbjct: 210 SQNFVSSIVGASASLIVSAPLDVIKTRIQNRNFDNPESGFK----IIKNTLKNEGFTAFF 265

Query: 200 RGLFPTMIRAGHGLGTYFLVYEALV 224
           +GL P ++  G  L   F + + L+
Sbjct: 266 KGLTPKLLTTGPKLVFSFALAQTLI 290

>Scas_328.1
          Length = 227

 Score = 47.0 bits (110), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 43/149 (28%), Positives = 66/149 (44%), Gaps = 7/149 (4%)

Query: 176 NGGDREFKGPWDCIKK-LKAQG--GLMRGLFPTMIRAGHGLGTYFLVYEALVAREIGTGL 232
           +G  R+F G  D  KK L   G  GL RG  P+++      G YF +Y++L    +    
Sbjct: 73  SGAPRKFNGILDVYKKTLFTDGVLGLYRGFLPSVVGIMVYRGLYFGLYDSLKPVLLTGSF 132

Query: 233 TRNEIPPWKLCLFGAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKE 292
               +P + L      S +    T YPLD V+  +     +  KYK +I    + I ++E
Sbjct: 133 ENAFLPSFLLGWAVTISAST---TSYPLDTVRRRMMMTSGQAVKYKGAID-CFQQIVSQE 188

Query: 293 GIRAFFKGFGPTMVRSAPVNGATFLTFEL 321
           G+ + FKG G  + R     G   L  +L
Sbjct: 189 GVYSLFKGCGANIFRGVAAAGVISLYDQL 217

 Score = 29.6 bits (65), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 24/118 (20%), Positives = 53/118 (44%), Gaps = 19/118 (16%)

Query: 81  NEGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTL 140
            +GV   Y+G L  ++G+ +   + FG+ +++K                  V L+ S   
Sbjct: 92  TDGVLGLYRGFLPSVVGIMVYRGLYFGLYDSLK-----------------PVLLTGSFEN 134

Query: 141 PLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQGGL 198
                ++ G    +  S  + P++ +R R+    ++G   ++KG  DC +++ +Q G+
Sbjct: 135 AFLPSFLLGWAVTISASTTSYPLDTVRRRM--MMTSGQAVKYKGAIDCFQQIVSQEGV 190

>Kwal_47.19228
          Length = 281

 Score = 47.0 bits (110), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 38/144 (26%), Positives = 65/144 (45%), Gaps = 6/144 (4%)

Query: 179 DREFKGPWDCIKKLKAQGGLMRGLFPTMIRAGHGLGTYFLVYEALVAREIGTGLTRNEIP 238
            R+F      I + +   G ++G  PT+IR        F  Y +L  + I      NE  
Sbjct: 128 SRQFLTTVQEIYRSRGIRGFLQGTMPTIIRQTSNSAVRFTTYTSL-KQMISPNKPLNEYY 186

Query: 239 PWKLCLFGAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFF 298
            + L   G  S   +     P+DV+K+ +Q+       YKNS++  A  I+ +EG   F+
Sbjct: 187 AFAL---GFISSCAVVAVTQPIDVIKTRMQSK-YTWSNYKNSLN-CAYRIFVEEGFTKFW 241

Query: 299 KGFGPTMVRSAPVNGATFLTFELV 322
           KG+ P +++     G +F  ++ V
Sbjct: 242 KGWAPRLMKVGLSGGVSFGVYQYV 265

 Score = 29.6 bits (65), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 39/104 (37%), Gaps = 6/104 (5%)

Query: 26  KRELSSNRVLKDIFA---GTIGGIAQVLVGQPFDXXXXXXXXXXXXXXXXXXXXXXXK-- 80
           K+ +S N+ L + +A   G I   A V V QP D                       +  
Sbjct: 173 KQMISPNKPLNEYYAFALGFISSCAVVAVTQPIDVIKTRMQSKYTWSNYKNSLNCAYRIF 232

Query: 81  -NEGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASK 123
             EG   F+KG    L+ VG+   V FGV + +    +  N  +
Sbjct: 233 VEEGFTKFWKGWAPRLMKVGLSGGVSFGVYQYVDNLMKAVNGQQ 276

>CAGL0L02079g 243467..244360 highly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, hypothetical start
          Length = 297

 Score = 47.0 bits (110), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 50/187 (26%), Positives = 85/187 (45%), Gaps = 14/187 (7%)

Query: 147 VCGLTGGVVNSFLA-SPIEQIRIRL-------QTQTSNGGDREFKGPWDCIKKLKAQGGL 198
           + GL  G++ S +A +P E I+  L       + +  N G R     +  + K +   GL
Sbjct: 111 LAGLGAGLLESVVAVTPFEAIKTVLIDDKQSVRPKYQNNG-RSMARNYISLVKDEGFRGL 169

Query: 199 MRGLFPTMIRAGHGLGTYFLVYEAL-VAREIGTGLTRNEIPPWKLC-LFGAFSGTMLWLT 256
             G+ P  +R           Y  + V  +  TG  +++     L  + GAFSG +    
Sbjct: 170 YGGVLPVSMRQAANQAVRLGCYNKIKVLVQDYTGAPKDKPLTSGLTFIVGAFSGVVTVYA 229

Query: 257 VYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATF 316
             P+D VK+ +Q+  L   KY ++++    TIY +EG++ F+KG  P + R     G  F
Sbjct: 230 TMPIDTVKTRMQS--LTASKYSSTLNCFT-TIYKEEGLKTFWKGATPRLGRLILSGGIVF 286

Query: 317 LTFELVM 323
             +E V+
Sbjct: 287 TIYENVL 293

 Score = 34.3 bits (77), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 43/189 (22%), Positives = 80/189 (42%), Gaps = 20/189 (10%)

Query: 129 SQDVDLSRSNTLPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDC 188
           S+ VD ++S        +V G   G V + +  P E  + RL  Q  +   +  + P   
Sbjct: 5   SKKVDPTKS--------FVAGALAGAVEASITYPFEFAKTRL--QLIDKSSKASRNPLVL 54

Query: 189 I---KKLKAQGGLMRGLFPTMIRAGHGLGTYFLVYEALVAREIGTGLTRNEIPPWKLCLF 245
           I    K +  G +  G    ++       T FL Y+ +  R +       E+   +  L 
Sbjct: 55  IYNTAKTQGVGAIYVGCPAFIVGNTAKAATRFLGYDTI--RNLLKDKKTGELSGPRGVLA 112

Query: 246 GAFSGTM-LWLTVYPLDVVKSIIQNDDLR-KPKYKNSISYVAK---TIYAKEGIRAFFKG 300
           G  +G +   + V P + +K+++ +D    +PKY+N+   +A+   ++   EG R  + G
Sbjct: 113 GLGAGLLESVVAVTPFEAIKTVLIDDKQSVRPKYQNNGRSMARNYISLVKDEGFRGLYGG 172

Query: 301 FGPTMVRSA 309
             P  +R A
Sbjct: 173 VLPVSMRQA 181

>Sklu_2430.10 YKL120W, Contig c2430 18856-19830
          Length = 324

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 57/240 (23%), Positives = 100/240 (41%), Gaps = 27/240 (11%)

Query: 80  KNEGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNT 139
           KNEGV    +G ++  +        Q G+N +   F++      N     +       N 
Sbjct: 77  KNEGVKGLQRGLVSAYV-------YQIGLNGSRLGFYEPIRTVLNKTFFPESDPHKLQN- 128

Query: 140 LPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSN---GGDREFKGPWDCIKKL-KAQ 195
             ++     G T G++ + + SP+  ++ R+Q+ ++    G    +    + +  + K +
Sbjct: 129 --VAVNVTAGATSGIIGAIVGSPLFLVKTRMQSYSNAIKIGEQTHYTSMSNGLATIFKKE 186

Query: 196 G--GLMRGLFPTMIRAGHGLGTYFLVYEALVAREIGTGLTRNEIPPWKLCLF---GAFSG 250
           G  GL RG+   ++R G G      +Y           L +N+I      L       +G
Sbjct: 187 GVLGLFRGVDAAILRTGAGSSVQLPIYNT-----TKNFLLQNDIMKEGTALHLLSSTVTG 241

Query: 251 TMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAP 310
             + + + P DVV + + N   +   YK  I  + KTI   EGI A +KGFG  + R AP
Sbjct: 242 LGVGIVMNPWDVVLTRVYNQ--KGNTYKGPIDCMFKTIKI-EGIGALYKGFGAQLFRIAP 298

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 48/206 (23%), Positives = 91/206 (44%), Gaps = 23/206 (11%)

Query: 121 ASKNPNMSSQDVDLSRSNTLPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQ--TSNGG 178
           +S+N  +++++ + S +  +     ++ G     +   + +P E ++ R+Q Q   S   
Sbjct: 2   SSENKPVATKEHEKSAAQKVSKVGSFIAGGLAACIAVTVTNPFELVKTRMQLQGEMSATN 61

Query: 179 DREFKGPWDCIKKL-KAQG--GLMRGLFPTMIRAGHGLGTYFLVYEALVAREIGTGLTRN 235
            R ++ P+  +  + K +G  GL RGL    +      G+    YE      I T L + 
Sbjct: 62  QRIYRNPFQALGVIFKNEGVKGLQRGLVSAYVYQIGLNGSRLGFYE-----PIRTVLNKT 116

Query: 236 EIP---PWKL------CLFGAFSGTMLWLTVYPLDVVKSIIQNDD----LRKPKYKNSIS 282
             P   P KL         GA SG +  +   PL +VK+ +Q+      + +  +  S+S
Sbjct: 117 FFPESDPHKLQNVAVNVTAGATSGIIGAIVGSPLFLVKTRMQSYSNAIKIGEQTHYTSMS 176

Query: 283 YVAKTIYAKEGIRAFFKGFGPTMVRS 308
               TI+ KEG+   F+G    ++R+
Sbjct: 177 NGLATIFKKEGVLGLFRGVDAAILRT 202

>CAGL0J09790g complement(957759..958661) highly similar to sp|P38988
           Saccharomyces cerevisiae YDL198c YHM1, start by
           similarity
          Length = 300

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 45/152 (29%), Positives = 65/152 (42%), Gaps = 14/152 (9%)

Query: 162 PIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQG--GLMRGLFPTMIRAGHGLGTYFLV 219
           P++ ++I+ QT       R F      +K LK +G   L RG   T  R  +  G++ L 
Sbjct: 138 PLDVLKIKRQTNPEAFKGRGF------LKILKDEGIFNLYRGWGWTAAR--NAPGSFALF 189

Query: 220 YEALVAREIGTGLTRNEIPPWKLCLFGAFSGTMLWLTV-YPLDVVKSIIQNDDLRKPKYK 278
                A+E   GL       W      +  G    L V  PLDV+K+ IQN +   P+  
Sbjct: 190 GGNAFAKEYILGLQDYSQATWSQNFISSIVGASASLIVSAPLDVIKTRIQNRNFDNPE-- 247

Query: 279 NSISYVAKTIYAKEGIRAFFKGFGPTMVRSAP 310
            S   + K     EG  AFFKG  P ++ + P
Sbjct: 248 -SGFKIVKNTLKNEGFTAFFKGLTPKLLTTGP 278

 Score = 30.0 bits (66), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 21/88 (23%), Positives = 41/88 (46%), Gaps = 13/88 (14%)

Query: 143 SQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIK----KLKAQG-- 196
           SQ ++  + G   +  +++P++ I+ R+Q       +R F  P    K     LK +G  
Sbjct: 211 SQNFISSIVGASASLIVSAPLDVIKTRIQ-------NRNFDNPESGFKIVKNTLKNEGFT 263

Query: 197 GLMRGLFPTMIRAGHGLGTYFLVYEALV 224
              +GL P ++  G  L   F + ++L+
Sbjct: 264 AFFKGLTPKLLTTGPKLVFSFALAQSLI 291

>YHR002W (LEU5) [2287] chr8 (108806..109879) Protein with similarity
           to Grave's disease protein, member of the mitochondrial
           carrier (MCF) family of membrane transporters [1074 bp,
           357 aa]
          Length = 357

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 59/284 (20%), Positives = 107/284 (37%), Gaps = 66/284 (23%)

Query: 81  NEGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTL 140
           N+GV  F++G    LL +    +V+F   E ++          N  + S++ + S    L
Sbjct: 88  NDGVRGFFQGHSATLLRIFPYAAVKFVAYEQIR----------NTLIPSKEFE-SHWRRL 136

Query: 141 PLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGG-------DREFKGP-------- 185
                 V G   G+ + F+  P++ +R+RL  +T +          + +K P        
Sbjct: 137 ------VSGSLAGLCSVFITYPLDLVRVRLAYETEHKRVKLGRIIKKIYKEPASATLIKN 190

Query: 186 -----WDCIKKLKAQGGLMRGLFPTMI----RAGHGLGTYFLVYEALVA----------- 225
                W C           RG  PT++     AG     + L+++ L +           
Sbjct: 191 DYIPNWFC-----HWCNFYRGYVPTVLGMIPYAGVSFFAHDLLHDVLKSPFFAPYSVLEL 245

Query: 226 -----REIGTGLTRNEIPPWKLCLFGAFSGTMLWLTVYPLDVVKSIIQNDDLR-KPKYKN 279
                 E      R  +  W   + G  +G       YP ++++  +Q   L  K  Y +
Sbjct: 246 SEDDELERVQKKQRRPLRTWAELISGGLAGMASQTAAYPFEIIRRRLQVSALSPKTMYDH 305

Query: 280 ---SISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATFLTFE 320
              SIS +A  I+ + G+R FF G     ++  P+   +F  +E
Sbjct: 306 KFQSISEIAHIIFKERGVRGFFVGLSIGYIKVTPMVACSFFVYE 349

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 40/82 (48%), Gaps = 3/82 (3%)

Query: 244 LFGAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSI---SYVAKTIYAKEGIRAFFKG 300
           L G  SG+     + PLD +K + Q  +    KY  S+      AK I+  +G+R FF+G
Sbjct: 38  LAGGISGSCAKTLIAPLDRIKILFQTSNPHYTKYTGSLIGLVEAAKHIWINDGVRGFFQG 97

Query: 301 FGPTMVRSAPVNGATFLTFELV 322
              T++R  P     F+ +E +
Sbjct: 98  HSATLLRIFPYAAVKFVAYEQI 119

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 50/209 (23%), Positives = 85/209 (40%), Gaps = 52/209 (24%)

Query: 149 GLTGGVVNSF---LASPIEQIRIRLQTQTSNGGDREFKGPW----DCIKKLKAQGGLMRG 201
           GL GG+  S    L +P+++I+I  QT  SN    ++ G      +  K +    G+ RG
Sbjct: 37  GLAGGISGSCAKTLIAPLDRIKILFQT--SNPHYTKYTGSLIGLVEAAKHIWINDGV-RG 93

Query: 202 LF----PTMIRAGHGLGTYFLVYEALVAREIGTGLTRNEIPP-------WKLCLFGAFSG 250
            F     T++R        F+ YE +          RN + P       W+  + G+ +G
Sbjct: 94  FFQGHSATLLRIFPYAAVKFVAYEQI----------RNTLIPSKEFESHWRRLVSGSLAG 143

Query: 251 TMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRA-------------- 296
                  YPLD+V+  +  +   K   +  +  + K IY KE   A              
Sbjct: 144 LCSVFITYPLDLVRVRLAYETEHK---RVKLGRIIKKIY-KEPASATLIKNDYIPNWFCH 199

Query: 297 ---FFKGFGPTMVRSAPVNGATFLTFELV 322
              F++G+ PT++   P  G +F   +L+
Sbjct: 200 WCNFYRGYVPTVLGMIPYAGVSFFAHDLL 228

>Scas_717.20
          Length = 356

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 40/82 (48%), Gaps = 3/82 (3%)

Query: 244 LFGAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSI---SYVAKTIYAKEGIRAFFKG 300
           L G  SG+     + PLD +K + Q  +    KY  S+      AK I+  +GIR FF+G
Sbjct: 37  LAGGISGSCAKTLIAPLDRIKILFQTSNPHYTKYAGSLVGLKEAAKHIWLNDGIRGFFQG 96

Query: 301 FGPTMVRSAPVNGATFLTFELV 322
              T++R  P     F+ +E +
Sbjct: 97  HSVTLMRIFPYAAVKFVAYEQI 118

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 60/281 (21%), Positives = 109/281 (38%), Gaps = 60/281 (21%)

Query: 81  NEGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTL 140
           N+G+  F++G    L+ +    +V+F   E ++          N  + S++ + S    L
Sbjct: 87  NDGIRGFFQGHSVTLMRIFPYAAVKFVAYEQIR----------NTLIPSKEYE-SHWRRL 135

Query: 141 PLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGG-------DREFKGPWDCIKKLK 193
                 + G   G+ + F   P++ IR+RL   T +            +K P      L+
Sbjct: 136 ------MSGSLAGLCSVFTTYPLDLIRVRLAYVTEHKRISLLGLVKTIYKEP--ASTTLE 187

Query: 194 AQG----------GLMRGLFPTMI----RAGHGLGTYFLVYEAL----VAREIGTGLTRN 235
           A+G             RG  PT++     AG     + L+++ L    +A      L+ +
Sbjct: 188 AKGYIPNWFAHWCNFYRGYTPTVLGMIPYAGVSFFAHDLLHDVLKHPILAPYSVLALSES 247

Query: 236 E------------IPPWKLCLFGAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKN---- 279
           E            +  W   L G  +G       YP ++++  +Q   L   +  +    
Sbjct: 248 EQEERHFKHQRLPLRTWAELLSGGLAGMASQTAAYPFEIIRRRLQVSTLSVSQMYDHRFQ 307

Query: 280 SISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATFLTFE 320
           SIS +AK IY + G R FF G     ++  P+   +F  +E
Sbjct: 308 SISEIAKIIYKERGWRGFFVGLSIGYIKVTPMVACSFFVYE 348

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 49/203 (24%), Positives = 86/203 (42%), Gaps = 40/203 (19%)

Query: 149 GLTGGVVNSF---LASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQGGL---MRGL 202
           GL GG+  S    L +P+++I+I  QT  SN    ++ G    +K+      L   +RG 
Sbjct: 36  GLAGGISGSCAKTLIAPLDRIKILFQT--SNPHYTKYAGSLVGLKEAAKHIWLNDGIRGF 93

Query: 203 FPTMIRAGHGLGTYFLVYEALVAREIGTGLTRNEIPP-------WKLCLFGAFSGTMLWL 255
           F      GH + T   ++     + +     RN + P       W+  + G+ +G     
Sbjct: 94  F-----QGHSV-TLMRIFPYAAVKFVAYEQIRNTLIPSKEYESHWRRLMSGSLAGLCSVF 147

Query: 256 TVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIY---AKEGIRA-------------FFK 299
           T YPLD+++  +      K   + S+  + KTIY   A   + A             F++
Sbjct: 148 TTYPLDLIRVRLAYVTEHK---RISLLGLVKTIYKEPASTTLEAKGYIPNWFAHWCNFYR 204

Query: 300 GFGPTMVRSAPVNGATFLTFELV 322
           G+ PT++   P  G +F   +L+
Sbjct: 205 GYTPTVLGMIPYAGVSFFAHDLL 227

>CAGL0K02915g 259026..260054 highly similar to sp|P38702
           Saccharomyces cerevisiae YHR002w LEU5, hypothetical
           start
          Length = 342

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 56/267 (20%), Positives = 103/267 (38%), Gaps = 52/267 (19%)

Query: 105 QFGVNEAMKRFFQNYNASK---NPNMSSQDVDLS--RSNTLPLSQY------YVCGLTGG 153
              +N+ ++ FFQ ++ +     P  + + V     RS  +P  +Y         G   G
Sbjct: 69  HIWINDGIRGFFQGHSVTLLRIFPYAAVKFVAYEQIRSILIPSREYESHWRRLASGSLAG 128

Query: 154 VVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQGGL--------------- 198
           + + F+  P++  R+RL   T +   +  +     I    A  GL               
Sbjct: 129 LCSVFITYPLDLTRVRLAYVTEHKRVK-LRDIVKTIYHEPASEGLTSHLLVPKWFAHWCN 187

Query: 199 -MRGLFPTMI----RAGHGLGTYFLVYEALVA--------------REIGTGLTRNEIP- 238
             RG  PT++     AG     + L+++ + +               E+     R + P 
Sbjct: 188 FYRGYVPTVLGMIPYAGVSFFAHDLIHDIMKSSLMAPYAVKQLSSQEELERKKLRQKTPL 247

Query: 239 -PWKLCLFGAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKN----SISYVAKTIYAKEG 293
             W   + G  SG +     YPL++++  +Q   L   K  +    SIS +A+ IY ++G
Sbjct: 248 RTWAELVAGGLSGILSQTAAYPLEIIRRRLQVSTLSPRKMYDHKFQSISSIARIIYQEKG 307

Query: 294 IRAFFKGFGPTMVRSAPVNGATFLTFE 320
            R FF G     ++  P+   +F  +E
Sbjct: 308 WRGFFVGLSIGYIKVTPMVACSFFVYE 334

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 40/82 (48%), Gaps = 3/82 (3%)

Query: 244 LFGAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSI---SYVAKTIYAKEGIRAFFKG 300
           L G  SG+     + PLD +K + Q  +    KY  S+      AK I+  +GIR FF+G
Sbjct: 23  LAGGVSGSCAKTLIAPLDRIKILFQTSNPHYSKYAGSLVGLYEAAKHIWINDGIRGFFQG 82

Query: 301 FGPTMVRSAPVNGATFLTFELV 322
              T++R  P     F+ +E +
Sbjct: 83  HSVTLLRIFPYAAVKFVAYEQI 104

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 50/202 (24%), Positives = 89/202 (44%), Gaps = 38/202 (18%)

Query: 149 GLTGGVVNSF---LASPIEQIRIRLQTQTSNGGDREFKGP----WDCIKKLKAQGGLMRG 201
           GL GGV  S    L +P+++I+I  QT  SN    ++ G     ++  K +    G+ RG
Sbjct: 22  GLAGGVSGSCAKTLIAPLDRIKILFQT--SNPHYSKYAGSLVGLYEAAKHIWINDGI-RG 78

Query: 202 LFP----TMIRAGHGLGTYFLVYEALVAREIGTGLTRNEIPPWKLCLFGAFSGTMLWLTV 257
            F     T++R        F+ YE + +  I +   R     W+    G+ +G       
Sbjct: 79  FFQGHSVTLLRIFPYAAVKFVAYEQIRSILIPS---REYESHWRRLASGSLAGLCSVFIT 135

Query: 258 YPLDVVK-SIIQNDDLRKPKYKNSISYVAKTIY---AKEGIRA-------------FFKG 300
           YPLD+ +  +    + ++ K ++    + KTIY   A EG+ +             F++G
Sbjct: 136 YPLDLTRVRLAYVTEHKRVKLRD----IVKTIYHEPASEGLTSHLLVPKWFAHWCNFYRG 191

Query: 301 FGPTMVRSAPVNGATFLTFELV 322
           + PT++   P  G +F   +L+
Sbjct: 192 YVPTVLGMIPYAGVSFFAHDLI 213

>Sklu_2432.5 YLR348C, Contig c2432 10310-11176 reverse complement
          Length = 288

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 64/291 (21%), Positives = 110/291 (37%), Gaps = 37/291 (12%)

Query: 41  GTIGGIAQVLVGQPFDXXXXXXXXXXXXX-XXXXXXXXXXKNEGVFAFYKGALTPLLGVG 99
           G  GGI   +   P D                        +NEGV   Y G    +L   
Sbjct: 15  GGFGGIVACVATHPLDLAKVRLQTAPAPKPTLVRMASQILRNEGVPGLYSGLTAAILRQC 74

Query: 100 ICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTLPLSQYYVCGLTGGVVNSFL 159
              + +FGV + +K   + Y   +  N        S    LP      C +  G V   +
Sbjct: 75  TYTTARFGVYDFVK---ERYIPKEYLN--------SMLYLLP------CSMFSGAVGGLI 117

Query: 160 ASPIEQIRIRLQTQTSNGGD--REFKGPWDCIKKLKAQGG---LMRGLFPTMIRAGHGLG 214
            +P + + IR+Q  +S   +  R +K   D + K+ +  G   L  G  P ++R      
Sbjct: 118 GNPADVVNIRMQNDSSLPAELRRNYKNAADGLYKICSGEGVAKLFTGWQPNLVRGILMTS 177

Query: 215 TYFLVYEALVAREI---GTGLTRNEIPPWKLCLFGA--FSGTMLWLTVYPLDVVKSIIQN 269
           +  + Y+  +A+       GL ++     K   F +   +G +      P DV+K+ + N
Sbjct: 178 SQVVTYD--IAKNYLVQNVGLDKDN----KSTHFASSLLAGLVATTVCSPADVIKTRVMN 231

Query: 270 DDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATFLTFE 320
               K  + +++  +   +  +EG    F+G+ P+ VR  P     FLT E
Sbjct: 232 A--HKHSHDSAVRILLDAV-KQEGPSFMFRGWLPSFVRLGPNTILIFLTVE 279

 Score = 44.3 bits (103), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 47/182 (25%), Positives = 79/182 (43%), Gaps = 26/182 (14%)

Query: 152 GGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQ-------GGLMRGLFP 204
           GG+V      P++  ++RLQT  +         P   + ++ +Q        GL  GL  
Sbjct: 18  GGIVACVATHPLDLAKVRLQTAPA---------PKPTLVRMASQILRNEGVPGLYSGLTA 68

Query: 205 TMIRAGHGLGTYFLVYEALVAREIGTGLTRNEIPPWKLCLFGAFSGTMLWLTVYPLDVVK 264
            ++R        F VY+ +  R I      + +    L     FSG +  L   P DVV 
Sbjct: 69  AILRQCTYTTARFGVYDFVKERYIPKEYLNSML---YLLPCSMFSGAVGGLIGNPADVVN 125

Query: 265 SIIQND-----DLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATFLTF 319
             +QND     +LR+  YKN+   + K I + EG+   F G+ P +VR   +  +  +T+
Sbjct: 126 IRMQNDSSLPAELRR-NYKNAADGLYK-ICSGEGVAKLFTGWQPNLVRGILMTSSQVVTY 183

Query: 320 EL 321
           ++
Sbjct: 184 DI 185

 Score = 35.4 bits (80), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 21/84 (25%), Positives = 36/84 (42%), Gaps = 7/84 (8%)

Query: 239 PWKLCLFGAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFF 298
           PW    +G F G +  +  +PLD+ K  +Q     KP    ++  +A  I   EG+   +
Sbjct: 11  PW---WYGGFGGIVACVATHPLDLAKVRLQTAPAPKP----TLVRMASQILRNEGVPGLY 63

Query: 299 KGFGPTMVRSAPVNGATFLTFELV 322
            G    ++R      A F  ++ V
Sbjct: 64  SGLTAAILRQCTYTTARFGVYDFV 87

>Scas_716.29
          Length = 316

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 52/201 (25%), Positives = 89/201 (44%), Gaps = 25/201 (12%)

Query: 133 DLSRSNTLPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKL 192
            L +   + +SQ  V G   G++   + +P++ ++IRLQ + S  G    + P   +K +
Sbjct: 13  HLRKGEDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTG----QAPSGLLKMM 68

Query: 193 KA----QGGL---MRGLFP-TMIRAGHGLGTY--FLVYEALVAREIGTGLTRNEIPPWKL 242
           K     +GGL    +G  P TM+   +G   +  +  Y  L       G T +     + 
Sbjct: 69  KGMILNEGGLRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLF------GETSDMNGQLQS 122

Query: 243 CLFGAFSGTMLWLTVYPLDVVKS-IIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGF 301
            + GA +G       YP DV+++  I N D+      +S+S+  K I+  EGI  FF+G 
Sbjct: 123 LVVGALAGMTSSFVSYPTDVLRTRFIANQDVA----LSSLSHGCKEIWNMEGIPGFFRGC 178

Query: 302 GPTMVRSAPVNGATFLTFELV 322
             +M          F T+E +
Sbjct: 179 TASMFTITLSASILFGTYESI 199

 Score = 33.9 bits (76), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 44/201 (21%), Positives = 76/201 (37%), Gaps = 27/201 (13%)

Query: 144 QYYVCGLTGGVVNSFLASPIEQIRIRL---QTQTSNGGDREFKGPWDCIKKLKAQGGLMR 200
           Q  V G   G+ +SF++ P + +R R    Q    +      K  W+    ++   G  R
Sbjct: 121 QSLVVGALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGCKEIWN----MEGIPGFFR 176

Query: 201 GLFPTMIRAGHGLGTYFLVYEALVAREIGTGLTRNEIPPWKLCLFGA--FSGTMLWLTVY 258
           G   +M          F  YE++   +I       E        + A   SG    +  Y
Sbjct: 177 GCTASMFTITLSASILFGTYESI---KIYCDEYSKESDYTNYLRYSASSISGVTSKMVTY 233

Query: 259 PLDVVKSIIQ--NDDLRKPKYKNSI------SYVAKT-------IYAKEGIRAFFKGFGP 303
           PLD ++  IQ  N    +   +N I      SY   +       I  +EG+ + ++G   
Sbjct: 234 PLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSM 293

Query: 304 TMVRSAPVNGATFLTFELVMR 324
           ++ ++ P    +   +E VMR
Sbjct: 294 SLCKTVPSTVVSLWAYETVMR 314

 Score = 33.9 bits (76), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 24/94 (25%), Positives = 44/94 (46%), Gaps = 15/94 (15%)

Query: 82  EGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTLP 141
           EG+  F++G    +  + +  S+ FG  E++K +   Y         S++ D   +N L 
Sbjct: 169 EGIPGFFRGCTASMFTITLSASILFGTYESIKIYCDEY---------SKESDY--TNYLR 217

Query: 142 LSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTS 175
            S   + G+T  +V      P++ IR R+Q + S
Sbjct: 218 YSASSISGVTSKMV----TYPLDTIRRRIQVRNS 247

>AGL065C [4246] [Homologous to ScYHR002W (LEU5) - SH]
           (585963..586970) [1008 bp, 335 aa]
          Length = 335

 Score = 44.3 bits (103), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 51/196 (26%), Positives = 83/196 (42%), Gaps = 29/196 (14%)

Query: 149 GLTGGVVNSF---LASPIEQIRIRLQTQTSNGGDREFKGPWDCI----KKLKAQGGLMRG 201
           GL GG+  S    L +P+++I+I  QT  SN    +F G    +    K + A  G  RG
Sbjct: 23  GLAGGIAGSCAKTLVAPLDRIKILFQT--SNPQFAQFAGSMGGLVRASKYIMAHDG-PRG 79

Query: 202 LF----PTMIRAGHGLGTYFLVYEALVAREIGTGLTRNEIPPWKLCLFGAFSGTMLWLTV 257
            F     T++R        F+ YE +  R +     R+E   W+  L G+ +G       
Sbjct: 80  FFQGHSATLLRIFPYAAIKFIAYEQI--RSVVIPTWRHE-SHWRRLLSGSLAGLCSVFVT 136

Query: 258 YPLDVVK----SIIQNDDLRKPK-----YKNSISYVAKTIYAKEGIRA---FFKGFGPTM 305
           YPLD+V+     + +  D +  K     Y    S   +  Y  +       F++G+ PT+
Sbjct: 137 YPLDLVRVRLAYVTERHDAKVRKIMACIYNERPSEALRKWYIPQWFAHWSNFYRGYTPTV 196

Query: 306 VRSAPVNGATFLTFEL 321
           +   P  G +F   +L
Sbjct: 197 IGMIPYAGVSFFAHDL 212

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 42/206 (20%), Positives = 76/206 (36%), Gaps = 33/206 (16%)

Query: 147 VCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQGGL-------- 198
           + G   G+ + F+  P++ +R+RL   T    D + +    CI   +    L        
Sbjct: 123 LSGSLAGLCSVFVTYPLDLVRVRLAYVTERH-DAKVRKIMACIYNERPSEALRKWYIPQW 181

Query: 199 -------MRGLFPTMIRAGHGLGTYFLVYEAL-------------VAREIGTGLTRNEIP 238
                   RG  PT+I      G  F  ++               V    G+      +P
Sbjct: 182 FAHWSNFYRGYTPTVIGMIPYAGVSFFAHDLCQDIFRHPMLEPYSVLSPGGSSAYDRTVP 241

Query: 239 --PWKLCLFGAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKN--SISYVAKTIYAKEGI 294
              W   + G  +G       YP ++++  +Q   +  P  ++   I+ +AK IY + G 
Sbjct: 242 LKTWAQLVAGGLAGMASQTAAYPFEIIRRRLQVSAITDPTRRHFVGINEIAKIIYTEGGW 301

Query: 295 RAFFKGFGPTMVRSAPVNGATFLTFE 320
           R FF G     ++  P+   +F  +E
Sbjct: 302 RGFFVGLSIGYIKVTPMVACSFFIYE 327

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 40/82 (48%), Gaps = 3/82 (3%)

Query: 244 LFGAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSIS---YVAKTIYAKEGIRAFFKG 300
           L G  +G+     V PLD +K + Q  + +  ++  S+      +K I A +G R FF+G
Sbjct: 24  LAGGIAGSCAKTLVAPLDRIKILFQTSNPQFAQFAGSMGGLVRASKYIMAHDGPRGFFQG 83

Query: 301 FGPTMVRSAPVNGATFLTFELV 322
              T++R  P     F+ +E +
Sbjct: 84  HSATLLRIFPYAAIKFIAYEQI 105

 Score = 31.6 bits (70), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 37/147 (25%), Positives = 62/147 (42%), Gaps = 19/147 (12%)

Query: 87  FYKGALTPLLGVGICVSVQFGVNEAMKRFFQN-----YNASKNPNMSSQDVDLSRSNTLP 141
           FY+G    ++G+     V F  ++  +  F++     Y+       S+ D       T+P
Sbjct: 188 FYRGYTPTVIGMIPYAGVSFFAHDLCQDIFRHPMLEPYSVLSPGGSSAYD------RTVP 241

Query: 142 LSQY--YVCGLTGGVVNSFLASPIEQIRIRLQ-TQTSNGGDREFKGPWDCIKKLKAQGGL 198
           L  +   V G   G+ +   A P E IR RLQ +  ++   R F G  +  K +  +GG 
Sbjct: 242 LKTWAQLVAGGLAGMASQTAAYPFEIIRRRLQVSAITDPTRRHFVGINEIAKIIYTEGG- 300

Query: 199 MRGLFPTM----IRAGHGLGTYFLVYE 221
            RG F  +    I+    +   F +YE
Sbjct: 301 WRGFFVGLSIGYIKVTPMVACSFFIYE 327

>Sklu_2435.2 YPR128C, Contig c2435 2489-3523 reverse complement
          Length = 344

 Score = 43.9 bits (102), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 51/247 (20%), Positives = 100/247 (40%), Gaps = 19/247 (7%)

Query: 82  EGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNT-L 140
           + ++  YK      L  G+  SV  G  +    FF  Y+  +      + ++  R NT  
Sbjct: 80  DAIYKIYKQEGIRGLYQGLTTSVMAGFFQTFSYFFW-YSFVRKCYFRVKLIN--RKNTKF 136

Query: 141 PLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREF-KGPWDCIKKLKAQGGLM 199
              +  + G+     +    +PI  I  R QT+    GD +F     +  K+ ++  G  
Sbjct: 137 TTIEELLLGIVAAATSQIFTNPISLISARQQTRQGIDGDNDFLTVAKEIYKEQRSIKGFW 196

Query: 200 RGLFPTMIRAGHGLGTYFLVYEALVAREIGTGL---------TRNEIPPWKLCLFGAFSG 250
           +GL  +++   +   TY   YE L      T           + +++ P++    G  S 
Sbjct: 197 KGLKVSLMLTINPSITY-TSYEKLKDALFTTDTMNLKKELVDSSSQLSPYQNFTLGVLSK 255

Query: 251 TMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAP 310
            +  +   PL + K+ +Q +      ++  + Y    +Y  EG+R+++KG  P + +   
Sbjct: 256 MISAIITMPLIISKAWLQRNGSNFSSFQQVLYY----LYKNEGLRSWWKGLSPQLAKGVL 311

Query: 311 VNGATFL 317
           V G  F+
Sbjct: 312 VQGLLFM 318

>YMR056C (AAC1) [4016] chr13 complement(387314..388243) ADP/ATP
           carrier protein of the mitochondrial carrier family
           (MCF) of membrane transporters [930 bp, 309 aa]
          Length = 309

 Score = 43.9 bits (102), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 51/187 (27%), Positives = 82/187 (43%), Gaps = 21/187 (11%)

Query: 149 GLTGGVVNSFLASPIEQIRIRLQTQ---TSNGGDREFKGPWDCIKK-LKAQG--GLMRGL 202
           G  GG+   F+ S ++  R RL      + +   R+F G  D  KK LK  G  GL RG 
Sbjct: 126 GAAGGLSLLFVYS-LDYARTRLAADARGSKSTSQRQFNGLLDVYKKTLKTDGLLGLYRGF 184

Query: 203 FPTMIRAGHGLGTYFLVYEA----LVAREIGTGLTRNEIPPWKLCLFGAFSGTMLWLTVY 258
            P+++      G YF +Y++    L+   +      + +  W + + GA + +      Y
Sbjct: 185 VPSVLGIIVYRGLYFGLYDSFKPVLLTGALEGSFVASFLLGWVITM-GASTAS------Y 237

Query: 259 PLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATFL- 317
           PLD V+  +     +  KY  ++  + K I  KEG  + FKG G  + R     G   L 
Sbjct: 238 PLDTVRRRMMMTSGQTIKYDGALDCLRK-IVQKEGAYSLFKGCGANIFRGVAAAGVISLY 296

Query: 318 -TFELVM 323
              +L+M
Sbjct: 297 DQLQLIM 303

 Score = 33.9 bits (76), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 45/187 (24%), Positives = 77/187 (41%), Gaps = 31/187 (16%)

Query: 143 SQYYVCGLTGGVVNSFL---ASPIEQIRIRLQTQ----TSNGGDREFKGPWDCIKKLKAQ 195
           S + V  L GGV  +     A+PIE++++ +Q Q         D  +KG  DC K+    
Sbjct: 11  SHFGVDFLMGGVSAAIAKTGAAPIERVKLLMQNQEEMLKQGSLDTRYKGILDCFKRTATH 70

Query: 196 GGLM---RGLFPTMIRAGHGLGTYF------LVYEALVAREIGTGLTRNEIPPWKLC-LF 245
            G++   RG    ++R       YF        ++  +   +     R+    W    LF
Sbjct: 71  EGIVSFWRGNTANVLR-------YFPTQALNFAFKDKIKSLLSYDRERDGYAKWFAGNLF 123

Query: 246 -GAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYK-----NSISYVAKTIYAKEGIRAFFK 299
            G  +G +  L VY LD  ++ +  D  R  K       N +  V K     +G+   ++
Sbjct: 124 SGGAAGGLSLLFVYSLDYARTRLAADA-RGSKSTSQRQFNGLLDVYKKTLKTDGLLGLYR 182

Query: 300 GFGPTMV 306
           GF P+++
Sbjct: 183 GFVPSVL 189

>AAR036W [222] [Homologous to ScYGR096W - SH]
           complement(406887..407840) [954 bp, 317 aa]
          Length = 317

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 44/205 (21%), Positives = 93/205 (45%), Gaps = 17/205 (8%)

Query: 121 ASKNPNMSSQDVDLSRSNTLPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDR 180
           +S +P ++++D  L +   +      V G   G+V   + +P++ ++IR Q Q ++  + 
Sbjct: 4   SSGSPQLATED-HLRKGEAVSGLHAVVAGSVSGLVARSVTAPMDTVKIRRQLQLAS--EH 60

Query: 181 EFKGPWDCIKKLKAQGGLMRGLFPTMIRAGHGLGTYFLVYEAL---VAREIGTGLTRNEI 237
           ++ G     + +  + G +R L+   + A       +++Y +L       + T      +
Sbjct: 61  KYHGILHTFRTVAREEG-VRALWKGNVPA----SAMYVLYGSLQFGTYAWLNTAAASAGL 115

Query: 238 PPWKLCL-FGAFSGTMLWLTVYPLDVVKS-IIQNDDLRKPKYKNSISYVAKTIYAKEGIR 295
           PP    L  GA +G +  L  YPLD++++ ++ N    +  +  S+   A+ I+  EG  
Sbjct: 116 PPQAHSLAVGALAGLVSSLLTYPLDLLRTRLVAN----RSAHFFSLRRQARVIWDTEGPA 171

Query: 296 AFFKGFGPTMVRSAPVNGATFLTFE 320
            FF+G    +  +    G  F  +E
Sbjct: 172 GFFRGGAWAIAATTLTTGLIFGIYE 196

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 65/325 (20%), Positives = 112/325 (34%), Gaps = 47/325 (14%)

Query: 19  KVTTPNEKRELSSNRVLKDIFAGTIGGIAQVLVGQPFDXXXXXXXXXXXXXXX----XXX 74
           ++ T +  R+  +   L  + AG++ G+    V  P D                      
Sbjct: 9   QLATEDHLRKGEAVSGLHAVVAGSVSGLVARSVTAPMDTVKIRRQLQLASEHKYHGILHT 68

Query: 75  XXXXXKNEGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDL 134
                + EGV A +KG +       +  S+QFG    +             N ++    L
Sbjct: 69  FRTVAREEGVRALWKGNVPASAMYVLYGSLQFGTYAWL-------------NTAAASAGL 115

Query: 135 SRSNTLPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSN---GGDREFKGPWDCIKK 191
                 P +     G   G+V+S L  P++ +R RL    S       R+ +  WD    
Sbjct: 116 P-----PQAHSLAVGALAGLVSSLLTYPLDLLRTRLVANRSAHFFSLRRQARVIWDT--- 167

Query: 192 LKAQGGLMRGLFPTMIRAGHGLGTYFLVYEALVAREIGTGLTRNEIPPWKLCLFGAFSGT 251
            +   G  RG    +       G  F +YE         GL      PW        +G 
Sbjct: 168 -EGPAGFFRGGAWAIAATTLTTGLIFGIYETCTIAADTYGL------PWLAAAASPTAGL 220

Query: 252 MLWLTVYPLDVVKSIIQNDDLRKPKY--KNSISY----------VAKTIYAKEGIRAFFK 299
           +    V+PLD V+  +Q  D +   +  ++  +Y          +A  +   EGI + +K
Sbjct: 221 VSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAVHMVRAEGIASLYK 280

Query: 300 GFGPTMVRSAPVNGATFLTFELVMR 324
           G    + +S P    T   ++  +R
Sbjct: 281 GLTMALCKSTPTTVITLWVYQRCLR 305

>AFR131C [3323] [Homologous to ScYGR257C - SH] (672999..674033)
           [1035 bp, 344 aa]
          Length = 344

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 60/268 (22%), Positives = 108/268 (40%), Gaps = 52/268 (19%)

Query: 82  EGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASK-NPNMSSQDVDLSRSNTL 140
           EG+   ++G     LG+ + ++V   V      +F  Y A + N  ++S+         L
Sbjct: 94  EGLPTLWRG-----LGITLVMAVPANVV-----YFSGYEALRDNSPLASR---------L 134

Query: 141 PLSQYYVCGLTGGVVNSFLASPIEQIRIRLQT-QTSNGGDREFKGPWDCIKKLKAQGGLM 199
           P++   VCG    ++ +   +P+E +R RLQ+   +   +R      D +++++ +  +M
Sbjct: 135 PVANPLVCGAFARILAATTIAPLELLRTRLQSVPRARDTERTIYLIGDLLREMRHEVSVM 194

Query: 200 ------RGLFPTMIR----AGHGLGTYFLVYEALVAREIGTGLTRNEIPPWKLCL----F 245
                 +GL  T+ R    +    GTY        AR   T    N    W   +     
Sbjct: 195 GYRALFKGLEITLWRDVPFSAIYWGTYEFCKTQFWARHAATHNASN----WDHFIGSFAC 250

Query: 246 GAFSGTMLWLTVYPLDVVKSIIQ------------NDDLRKPKYKNSISYVAKTIYAKEG 293
           G+  G +  L  +P DV K+ +Q                +    +   S++   I   EG
Sbjct: 251 GSMGGAVAALLTHPFDVGKTRMQIAIASPQQLTVGGKATKTDDSRGMFSFL-NAIRKSEG 309

Query: 294 IRAFFKGFGPTMVRSAPVNGATFLTFEL 321
           IRA + G  P +++ AP       T+EL
Sbjct: 310 IRALYTGLLPRVMKIAPSCAIMISTYEL 337

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 53/223 (23%), Positives = 90/223 (40%), Gaps = 61/223 (27%)

Query: 147 VCGLTGGVVNSFLASPIEQIRIRLQTQT-------------------------SNGGDRE 181
           V    G +V S   +P++ +R+RL  Q                          +N G RE
Sbjct: 16  VSASAGSLVTSLFLTPLDVVRVRLHQQEMLPSCTCTGQLSKPAGKVFWQDECFANVGCRE 75

Query: 182 ----FKGPWDCIKKLKAQGG---LMRGLFPTMIRAGHGLGTYFLVYEALVAREIGTGLTR 234
                +G  + ++K+    G   L RGL  T++ A      YF  YEAL  R+     +R
Sbjct: 76  PAARLQGTLEGLRKIAQLEGLPTLWRGLGITLVMAVPANVVYFSGYEAL--RDNSPLASR 133

Query: 235 NEIPPWKLCLFGAFSGTMLWLTVYPLDVVKSIIQN---------------DDLRKPKYKN 279
             +    +C  GAF+  +   T+ PL+++++ +Q+               D LR+ +++ 
Sbjct: 134 LPVANPLVC--GAFARILAATTIAPLELLRTRLQSVPRARDTERTIYLIGDLLREMRHEV 191

Query: 280 SISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATFLTFELV 322
           S+           G RA FKG   T+ R  P +   + T+E  
Sbjct: 192 SVM----------GYRALFKGLEITLWRDVPFSAIYWGTYEFC 224

>KLLA0D04950g 424550..425374 similar to sp|P38921 Saccharomyces
           cerevisiae YNL003c PET8 member of the mitochondrial
           carrier (MCF) family, start by similarity
          Length = 274

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 62/243 (25%), Positives = 100/243 (41%), Gaps = 27/243 (11%)

Query: 81  NEGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTL 140
           N G    Y+G  + ++      S+ F   ++MK + +       P    Q  D     TL
Sbjct: 43  NGGYKGVYRGLGSAVVASAPSASLFFVAYDSMKCWSRPVIGQLLPKGEDQTAD-----TL 97

Query: 141 PLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQG---G 197
               + V    G +    +  P E I+ R QT  +N   +  +     ++    +G    
Sbjct: 98  ---SHMVSSSFGEISACMVRVPAEVIKQRTQTHRTNSSLQTLQA---LLRNENGEGLRRN 151

Query: 198 LMRGLFPTMIRAGHGLGTYFLVYEALVAREIGTGLTRNEIPPWKLCLFGAFSGTMLWLTV 257
           L RG   T++R        F +YE +  R       +    PW+  + G  +G +     
Sbjct: 152 LYRGWSTTIMREIPFTCIQFPLYEYMKKRWAEVQ-GKERAAPWQGSVCGCIAGGIAAAAT 210

Query: 258 YPLDVVKSIIQNDDLRKPKYKNSIS--YVAKTIYAKEGIRAFFKGFGP-TMVRSAPVNGA 314
            PLDV+K+ I         +  S+S  ++AKT+  +EG++ FF G GP TM  SA   GA
Sbjct: 211 TPLDVLKTRIM-------LHHKSVSALHLAKTMLQEEGVKVFFSGVGPRTMWISA--GGA 261

Query: 315 TFL 317
            FL
Sbjct: 262 IFL 264

 Score = 28.5 bits (62), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 18/75 (24%), Positives = 32/75 (42%), Gaps = 15/75 (20%)

Query: 246 GAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTM 305
           GA +GT   L  +P+D +K+ +Q                    +A  G +  ++G G  +
Sbjct: 13  GAAAGTSTDLAFFPIDTLKTRLQAKG---------------GFFANGGYKGVYRGLGSAV 57

Query: 306 VRSAPVNGATFLTFE 320
           V SAP     F+ ++
Sbjct: 58  VASAPSASLFFVAYD 72

>Kwal_55.21106
          Length = 328

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 60/253 (23%), Positives = 94/253 (37%), Gaps = 36/253 (14%)

Query: 80  KNEGVFAFYKGALTPLL-GVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSN 138
           K +GV   Y+G  T ++ G     S  F  +   K FF+ Y   +            R  
Sbjct: 72  KTKGVLGLYQGLWTSIIAGFLQSFSYFFWYSIVRKSFFR-YKLLRG-----------RLG 119

Query: 139 TLPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTS--NGGDRE-----------FKGP 185
                +  + G+    V+    SPI  I  R QT TS   GG RE             G 
Sbjct: 120 KFSTPEELLLGIVAAAVSQIFTSPIGVISTRQQTSTSGSKGGFREVLHQIYSEQNNITGF 179

Query: 186 WDCIKKLKAQGGLMRGLFPTMIRAGHGLGTYFLVYEALVAREIGTGL-TRNEIPPWKLCL 244
           W   K       L+  + P++  A +       +       E G  L T  ++ P +  L
Sbjct: 180 WRGFKV-----SLILTVNPSITFASYEKLQDIFITSKRAVDENGQLLETSGQLSPRQNFL 234

Query: 245 FGAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPT 304
            G FS  +  L   PL V K+ +Q        ++  + Y    +Y +EG+ + +KG  P 
Sbjct: 235 LGVFSKVISTLITQPLIVSKAYLQRTGSNFQSFQQVLLY----LYKQEGLISLWKGLAPQ 290

Query: 305 MVRSAPVNGATFL 317
           + +   V G  F+
Sbjct: 291 LSKGILVQGLLFM 303

 Score = 32.0 bits (71), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 20/98 (20%), Positives = 48/98 (48%), Gaps = 20/98 (20%)

Query: 246 GAFSGTMLWLTVYPLDVVKSIIQNDD-------------------LRKPKYKNSISYVAK 286
           GA + ++  + VYPLD+VK++IQ  +                   +++ +YK+S+  + K
Sbjct: 10  GAVASSLANVVVYPLDLVKTLIQTQNKEPNIGSEAGVKPQAKKSRVQEIRYKHSLDALIK 69

Query: 287 TIYAKEGIRAFFKGFGPTMVRSAPVNGATFLTFELVMR 324
            I+  +G+   ++G   +++     + + F  + +V +
Sbjct: 70  -IFKTKGVLGLYQGLWTSIIAGFLQSFSYFFWYSIVRK 106

>Scas_702.10
          Length = 302

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 57/250 (22%), Positives = 96/250 (38%), Gaps = 33/250 (13%)

Query: 80  KNEGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNT 139
           +NE V   Y G    +L      +V+FG  + MK            N+  Q         
Sbjct: 56  RNENVMGLYSGLSAAVLRQCTYTTVRFGAYDLMKE-----------NLIPQGHINDMVYL 104

Query: 140 LPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGD--REFKGPWDCIKKLKAQGG 197
           LP S +   G  GG+V +F     + + IR+Q  ++   +  R ++   D + K+    G
Sbjct: 105 LPCSMF--SGAIGGLVGNF----ADVVNIRMQNDSALKPELRRNYRNAIDGVYKIYMHEG 158

Query: 198 ----LMRGLFPTMIRAGHGLGTYFLVYEAL---VAREIGTGLTRNEIPPWKLCLFGAFSG 250
               L+ G  P M+R      +  + Y+     +  ++     +N        L G  + 
Sbjct: 159 GIKTLLTGWKPNMVRGVLMTASQVVTYDVFKNYLVTKLSFDPKKNSTHLSASLLAGLVAT 218

Query: 251 TMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAP 310
           T+      P DV+K+ I N    K + +++I  +   I  KEG    F+G+ P   R  P
Sbjct: 219 TI----CSPADVIKTRIMNA--HKTESESAIKILTSAI-KKEGPSFMFRGWLPIFTRLGP 271

Query: 311 VNGATFLTFE 320
                F   E
Sbjct: 272 FTMLIFFAIE 281

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 39/78 (50%), Gaps = 4/78 (5%)

Query: 248 FSGTMLWLTVYPLDVVKSIIQNDDLRKPK----YKNSISYVAKTIYAKEGIRAFFKGFGP 303
           FSG +  L     DVV   +QND   KP+    Y+N+I  V K    + GI+    G+ P
Sbjct: 110 FSGAIGGLVGNFADVVNIRMQNDSALKPELRRNYRNAIDGVYKIYMHEGGIKTLLTGWKP 169

Query: 304 TMVRSAPVNGATFLTFEL 321
            MVR   +  +  +T+++
Sbjct: 170 NMVRGVLMTASQVVTYDV 187

 Score = 30.4 bits (67), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 19/84 (22%), Positives = 35/84 (41%), Gaps = 7/84 (8%)

Query: 239 PWKLCLFGAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFF 298
           PW    +G  +G    +  +PLD+ K  +Q   L KP    ++  +  TI   E +   +
Sbjct: 12  PW---WYGGAAGIFACVMTHPLDLAKVRLQAAPLPKP----TLGRMLTTILRNENVMGLY 64

Query: 299 KGFGPTMVRSAPVNGATFLTFELV 322
            G    ++R        F  ++L+
Sbjct: 65  SGLSAAVLRQCTYTTVRFGAYDLM 88

>YGR096W (TPC1) [2056] chr7 (676623..677567) Mitochondrial thiamine
           pyrophosphate transporter, controls import of thiamine
           pyrophosphate during growth on fermentative carbon
           sources, member of the mitochondrial carrier family
           (MCF) of membrane transporters [945 bp, 314 aa]
          Length = 314

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 31/143 (21%), Positives = 52/143 (36%), Gaps = 12/143 (8%)

Query: 35  LKDIFAGTIGGIAQVLVGQPFDXXXXXXXXXXXXXXXXXXXXXXX--KNEGVFAFYKGAL 92
           L  +  G   GI   +V  PFD                         K EG+  F+KG++
Sbjct: 113 LHSLVVGAFAGITSSIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSI 172

Query: 93  TPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTLPLSQYYVCGLTG 152
             +  + +  S+ FG  E ++ +      +   +   +   L+ S           G  G
Sbjct: 173 ASMTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHS----------AGTIG 222

Query: 153 GVVNSFLASPIEQIRIRLQTQTS 175
           GV+   +  P+E IR R+Q   S
Sbjct: 223 GVIAKIITFPLETIRRRMQFMNS 245

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 42/89 (47%), Gaps = 1/89 (1%)

Query: 237 IPPWKLCLFGAFSGTMLWLTVYPLDVVKSIIQNDDLRKPK-YKNSISYVAKTIYAKEGIR 295
           +  WK  L GA SG +      P+D +K  +Q       K + + +  VA+++   EGIR
Sbjct: 14  VAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIR 73

Query: 296 AFFKGFGPTMVRSAPVNGATFLTFELVMR 324
           +F+KG  P  +       A F ++ L  R
Sbjct: 74  SFWKGNIPGSLLYVTYGSAQFSSYSLFNR 102

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 45/211 (21%), Positives = 91/211 (43%), Gaps = 34/211 (16%)

Query: 127 MSSQDVDLSRSNTLPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPW 186
           M  ++  L +   +   +  + G   G++   + +P++ I+IRLQ   +NG         
Sbjct: 1   MFKEEDSLRKGQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANG--------- 51

Query: 187 DCIKKLKAQGGLMRGLFPTMIRAGHGLGTYF-------LVYEALVAREIGT-GLTRNEIP 238
                LK  G  +  +  +MI+   G+ +++       L+Y    + +  +  L    + 
Sbjct: 52  -----LKPFGSQVMEVARSMIK-NEGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLT 105

Query: 239 PWKL------CLFGAFSGTMLWLTVYPLDVVKS-IIQNDDLRKPKYKNSISYVAKTIYAK 291
           P+ L       + GAF+G    +  YP DV+++ ++ N+ +    +  SI+   + I+  
Sbjct: 106 PFGLEARLHSLVVGAFAGITSSIVSYPFDVLRTRLVANNQM----HSMSITREVRDIWKL 161

Query: 292 EGIRAFFKGFGPTMVRSAPVNGATFLTFELV 322
           EG+  FFKG   +M          F T+E +
Sbjct: 162 EGLPGFFKGSIASMTTITLTASIMFGTYETI 192

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 54/264 (20%), Positives = 97/264 (36%), Gaps = 41/264 (15%)

Query: 80  KNEGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNT 139
           KNEG+ +F+KG +   L      S QF       R+   +               +R ++
Sbjct: 68  KNEGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLE------------ARLHS 115

Query: 140 LPLSQYYVCGLTGGVVNSFLASPIEQIRIRL---QTQTSNGGDREFKGPWDCIKKLKAQG 196
           L      V G   G+ +S ++ P + +R RL       S    RE +  W    KL+   
Sbjct: 116 L------VVGAFAGITSSIVSYPFDVLRTRLVANNQMHSMSITREVRDIW----KLEGLP 165

Query: 197 GLMRGLFPTMIRAGHGLGTYFLVYEALVAREIGTGLTRNEIPPWKLCLF----GAFSGTM 252
           G  +G   +M          F  YE +         T      W+L       G   G +
Sbjct: 166 GFFKGSIASMTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGVI 225

Query: 253 LWLTVYPLDVVKSIIQ---NDDLRKPKYKNSI--SY-------VAKTIYAKEGIRAFFKG 300
             +  +PL+ ++  +Q   +  L K    +S+  SY       +   I  +EG+ + ++G
Sbjct: 226 AKIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRG 285

Query: 301 FGPTMVRSAPVNGATFLTFELVMR 324
               + ++ P    +F  +E  + 
Sbjct: 286 ILVALSKTIPTTFVSFWGYETAIH 309

>Kwal_23.3529
          Length = 395

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 60/259 (23%), Positives = 98/259 (37%), Gaps = 41/259 (15%)

Query: 87  FYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTLPLSQYY 146
            Y G    +LG     ++ FG  E  KR   +              D   + TL    + 
Sbjct: 142 LYGGYTAAMLGSFPSAAIFFGTYELTKRKLID--------------DWGVNETL---SHL 184

Query: 147 VCGLTGGVVNSFLASPIEQIRIRLQTQ--------TSNGGDREFKGPWDCIKKLKAQGGL 198
             GL+G +V+S +  P E ++ RLQ Q         S    R  +     I +L+    L
Sbjct: 185 TAGLSGDLVSSVVYVPSEVLKTRLQLQGCYNNPHFHSGYNYRNLRDAITAIVRLEGWQTL 244

Query: 199 MRGLFPTMIRAGHGLGTYFLVYEALVAREIGTGLTRNEIPPWKLCLFG-----AFSGTML 253
             G   T+ R        F  YE    R+    L   + P   L L       A +G + 
Sbjct: 245 FFGYKATLCRDLPFSAFQFAFYEKF--RQWAFTL-EGKTPSQDLSLLNELLTGAAAGGLA 301

Query: 254 WLTVYPLDVVKSIIQ--------NDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTM 305
            +   P+DV+K+ IQ        +D  R  + +NS+      +Y  EG   FF G GP  
Sbjct: 302 GIITTPMDVIKTRIQTQMPSTVASDSTRLVRIENSLIKGLTAVYRSEGTLGFFSGVGPRF 361

Query: 306 VRSAPVNGATFLTFELVMR 324
           + ++  +    L +++ ++
Sbjct: 362 IWTSIQSSIMLLLYQVTLK 380

 Score = 36.6 bits (83), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 36/69 (52%), Gaps = 3/69 (4%)

Query: 257 VYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGI-RAFFKGFGPTMVRSAPVNGAT 315
           ++ LD VK+  Q      PKY+N IS   K I+ +EGI R  + G+   M+ S P     
Sbjct: 103 MHSLDTVKTR-QQGAPNAPKYRNMISAYQK-IFMEEGIRRGLYGGYTAAMLGSFPSAAIF 160

Query: 316 FLTFELVMR 324
           F T+EL  R
Sbjct: 161 FGTYELTKR 169

>Sklu_2433.8 YFR045W, Contig c2433 11995-13257 reverse complement
          Length = 420

 Score = 42.4 bits (98), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 35/126 (27%), Positives = 59/126 (46%), Gaps = 6/126 (4%)

Query: 197 GLMRGLFPTMIRAGHGLGTYFLVYEALVAREIGTGLTRNEIPPWKLCLFGAFSGTMLWLT 256
           G ++G  PT+ R        F  Y +L  + I      NE   + L   G  S   +   
Sbjct: 285 GFVQGTAPTIFRQMGNSAVRFTTYTSL-KQLISPNKPLNEYYAFVL---GFISSCAVVAV 340

Query: 257 VYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATF 316
             P+DV+K+ +Q+       YKNS++  A  I+ +EGI  F+KG+ P +++     G +F
Sbjct: 341 TQPIDVIKTRMQSK-YAWANYKNSLN-CAYRIFVEEGIPKFWKGWAPRLMKVGLSGGVSF 398

Query: 317 LTFELV 322
             ++ V
Sbjct: 399 GVYQYV 404

 Score = 28.9 bits (63), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 25/94 (26%), Positives = 38/94 (40%), Gaps = 6/94 (6%)

Query: 26  KRELSSNRVLKDIFA---GTIGGIAQVLVGQPFDXXXXXXXXXXXXXXXXXXXXXXXK-- 80
           K+ +S N+ L + +A   G I   A V V QP D                       +  
Sbjct: 312 KQLISPNKPLNEYYAFVLGFISSCAVVAVTQPIDVIKTRMQSKYAWANYKNSLNCAYRIF 371

Query: 81  -NEGVFAFYKGALTPLLGVGICVSVQFGVNEAMK 113
             EG+  F+KG    L+ VG+   V FGV + ++
Sbjct: 372 VEEGIPKFWKGWAPRLMKVGLSGGVSFGVYQYVE 405

>Kwal_55.21338
          Length = 323

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 57/244 (23%), Positives = 101/244 (41%), Gaps = 27/244 (11%)

Query: 80  KNEGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNT 139
           + +G   F+ G  + L G  +   V          ++  Y AS    + ++      +  
Sbjct: 71  RKDGAMGFFAGLESALFGTTLSNFV----------YYYCYEASSRCVLRAR-----HTQR 115

Query: 140 LPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQGGLM 199
           L  ++  + G   G +N+  A+P+     R+  Q S+ G       +D +K  +   GL 
Sbjct: 116 LTTAESMLVGSIAGSLNATAANPLWVANTRMTVQKSDRG--TLSTIFDIVKD-EGISGLF 172

Query: 200 RGLFPTMIRAGHGLGTYFLVYEALVAREIGTGLTRNEIPPWKLCLFGAFSGTMLWLTVYP 259
           +GL P +I   + +  Y  VYE L    + +  TR   P W   L GA        + YP
Sbjct: 173 KGLNPALILVINPIIQY-TVYEQLKNWILSSRQTRTLSPSWAFIL-GAVGKLAATGSTYP 230

Query: 260 LDVVKSIIQNDDLRKPKY----KNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGAT 315
              +K+ +      K       ++ +S +A+ I  K+GI   ++G G  +V+S  +  A 
Sbjct: 231 YVTMKARMHLLGEHKSSTAAPPRSLLSLMAEII-KKDGILGLYRGIGIKLVQS--ILTAA 287

Query: 316 FLTF 319
           FL F
Sbjct: 288 FLFF 291

 Score = 31.2 bits (69), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 30/67 (44%), Gaps = 2/67 (2%)

Query: 258 YPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATFL 317
           YPL VV + +Q  D +  K   S++   K IY K+G   FF G    +  +   N   + 
Sbjct: 41  YPLIVVTTKLQTQDAKGEKL--SLADTIKDIYRKDGAMGFFAGLESALFGTTLSNFVYYY 98

Query: 318 TFELVMR 324
            +E   R
Sbjct: 99  CYEASSR 105

 Score = 31.2 bits (69), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 38/154 (24%), Positives = 62/154 (40%), Gaps = 18/154 (11%)

Query: 159 LASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQGGLMRGLFPTMIRAGHGLG---- 214
           L  P+  +  +LQTQ + G         D IK +  + G M G F  +  A  G      
Sbjct: 39  LTYPLIVVTTKLQTQDAKGEKLSLA---DTIKDIYRKDGAM-GFFAGLESALFGTTLSNF 94

Query: 215 TYFLVYEALVAREIGTGLTRNEIPPWKLCLFGAFSGTMLWLTVYPLDVVKS--IIQNDDL 272
            Y+  YEA  +R +        +   +  L G+ +G++      PL V  +   +Q  D 
Sbjct: 95  VYYYCYEA-SSRCVLRARHTQRLTTAESMLVGSIAGSLNATAANPLWVANTRMTVQKSD- 152

Query: 273 RKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMV 306
                + ++S +   I   EGI   FKG  P ++
Sbjct: 153 -----RGTLSTIFD-IVKDEGISGLFKGLNPALI 180

>Scas_715.45
          Length = 305

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 50/193 (25%), Positives = 80/193 (41%), Gaps = 21/193 (10%)

Query: 144 QYYVCGLTGGVV----NSFLASPIEQIRIRLQT-----QTSNGGDREFKGPWDCIKKLKA 194
           +YY     GG+V         +P++ I+ RLQ      +++  G  +       I K + 
Sbjct: 14  EYYAACTLGGIVACGPTHSSVTPLDLIKCRLQVDPTLYRSNTSGIIQ-------ILKKEG 66

Query: 195 QGGLMRGLFPTMI-RAGHGLGTYFLVYEALVAREIGTGLTRNEIPPWKL--CLFGAFSGT 251
            G L  G+  T I  +  G G Y   YE L  R   T L ++E   +K    ++   S T
Sbjct: 67  LGKLFTGVGATCIGYSLQGAGKYG-GYE-LFKRLYSTHLVKDEATAYKYRTSIYLLSSAT 124

Query: 252 MLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPV 311
             +     L   ++I        P + N++    K +YAKEG+  F+KG  P   R  P 
Sbjct: 125 AEFFADIMLCPFEAIKVKQQTTMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPY 184

Query: 312 NGATFLTFELVMR 324
               F +FE ++ 
Sbjct: 185 TMCKFTSFERIVE 197

>YLR348C (DIC1) [3731] chr12 complement(826976..827872)
           Mitochondrial dicarboxylate transport protein, member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [897 bp, 298 aa]
          Length = 298

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 52/244 (21%), Positives = 96/244 (39%), Gaps = 24/244 (9%)

Query: 81  NEGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTL 140
           NEGV   Y G    +L      +V+FG  + +K            N+  ++   + +  L
Sbjct: 61  NEGVVGLYSGLSAAVLRQCTYTTVRFGAYDLLKE-----------NVIPREQLTNMAYLL 109

Query: 141 PLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQGGLMR 200
           P S +   G  GG+  +F  + +  IR++  +       R +K   D + K+    G ++
Sbjct: 110 PCSMF--SGAIGGLAGNF--ADVVNIRMQNDSALEAAKRRNYKNAIDGVYKIYRYEGGLK 165

Query: 201 GLF----PTMIRAGHGLGTYFLVYEALVAREIGTGLTRNEIPPWKLCLFGAFSGTMLWLT 256
            LF    P M+R      +  + Y+ +    + T L  +    +        +G +    
Sbjct: 166 TLFTGWKPNMVRGILMTASQVVTYD-VFKNYLVTKLDFDASKNYTHLTASLLAGLVATTV 224

Query: 257 VYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATF 316
             P DV+K+ I N       ++ ++  +A  +  KEG    F+G+ P+  R  P     F
Sbjct: 225 CSPADVMKTRIMNGS---GDHQPALKILADAV-RKEGPSFMFRGWLPSFTRLGPFTMLIF 280

Query: 317 LTFE 320
              E
Sbjct: 281 FAIE 284

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 51/113 (45%), Gaps = 11/113 (9%)

Query: 213 LGTYFLVYEALVAREIGTGLTRNEIPPWKLCLFGAFSGTMLWLTVYPLDVVKSIIQNDDL 272
            G Y L+ E ++ RE  T +         L     FSG +  L     DVV   +QND  
Sbjct: 86  FGAYDLLKENVIPREQLTNMAY-------LLPCSMFSGAIGGLAGNFADVVNIRMQNDSA 138

Query: 273 ----RKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATFLTFEL 321
               ++  YKN+I  V K    + G++  F G+ P MVR   +  +  +T+++
Sbjct: 139 LEAAKRRNYKNAIDGVYKIYRYEGGLKTLFTGWKPNMVRGILMTASQVVTYDV 191

 Score = 33.1 bits (74), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 19/84 (22%), Positives = 38/84 (45%), Gaps = 7/84 (8%)

Query: 239 PWKLCLFGAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFF 298
           PW    +G  +G    +  +PLD+ K  +Q   + KP    ++  + ++I A EG+   +
Sbjct: 16  PW---WYGGAAGIFATMVTHPLDLAKVRLQAAPMPKP----TLFRMLESILANEGVVGLY 68

Query: 299 KGFGPTMVRSAPVNGATFLTFELV 322
            G    ++R        F  ++L+
Sbjct: 69  SGLSAAVLRQCTYTTVRFGAYDLL 92

>AGR191W [4502] [Homologous to ScYDL198C (YHM1) - SH]
           complement(1114974..1115870) [897 bp, 298 aa]
          Length = 298

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 42/151 (27%), Positives = 66/151 (43%), Gaps = 13/151 (8%)

Query: 162 PIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQG-GLMRGLFPTMIRAGHGLGTYFLVY 220
           P++ ++I+ QT   +   R F      ++ L+ +G GL RG   T  R  +  G++ L  
Sbjct: 137 PLDVLKIKRQTNPESFRGRGF------LRILRDEGMGLYRGWGWTAAR--NAPGSFALFG 188

Query: 221 EALVAREIGTGLTRNEIPPWKLCLFGAFSGTMLWLTV-YPLDVVKSIIQNDDLRKPKYKN 279
               A+E   GL       W      +  G    L V  PLDV+K+ IQ+ +    +   
Sbjct: 189 GNAFAKEYILGLKDYSQATWGQNFVSSIFGASASLIVSAPLDVIKTRIQSRNFESAESGF 248

Query: 280 SISYVAKTIYAKEGIRAFFKGFGPTMVRSAP 310
           +I    K     EG  AFFKG  P ++ + P
Sbjct: 249 TI---VKNTLKNEGATAFFKGLTPKLLTTGP 276

>Kwal_26.7972
          Length = 358

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 39/82 (47%), Gaps = 3/82 (3%)

Query: 244 LFGAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKT---IYAKEGIRAFFKG 300
           L G  +G+     + PLD +K + Q  +    KY  S   + +    I A +GIR F++G
Sbjct: 32  LAGGIAGSCAKTLIAPLDRIKILFQTSNPHYLKYSGSTMGLIRAGAHINAHDGIRGFYQG 91

Query: 301 FGPTMVRSAPVNGATFLTFELV 322
              T++R  P     F+ +E +
Sbjct: 92  HSATLIRIFPYAAIKFIAYEQI 113

 Score = 33.9 bits (76), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 50/207 (24%), Positives = 83/207 (40%), Gaps = 36/207 (17%)

Query: 143 SQYYV--CGLTGGVVNSF---LASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQ-- 195
           S +Y+   GL GG+  S    L +P+++I+I  QT  SN    ++ G    + +  A   
Sbjct: 23  SAHYILRSGLAGGIAGSCAKTLIAPLDRIKILFQT--SNPHYLKYSGSTMGLIRAGAHIN 80

Query: 196 -----GGLMRGLFPTMIRAGHGLGTYFLVYEALVAREIGTGLTRNEIPPWKLCLFGAFSG 250
                 G  +G   T+IR        F+ YE +  R         E    +L   G+ +G
Sbjct: 81  AHDGIRGFYQGHSATLIRIFPYAAIKFIAYEQI--RHFMIPSKEYETHARRLAS-GSMAG 137

Query: 251 TMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIY---AKEGIRA----------- 296
                  YPLD+++  +     R    +  +  V K IY   A E + +           
Sbjct: 138 LCSVFMTYPLDLIRVRLAYVTDRS---RIKMLPVIKQIYTERASESLTSKSYVPRWFAHW 194

Query: 297 --FFKGFGPTMVRSAPVNGATFLTFEL 321
             F++GF PT++   P  G +F   +L
Sbjct: 195 CNFYRGFTPTVLGMIPYAGVSFFAHDL 221

>CAGL0D04774g complement(467712..468680) similar to tr|Q06497
           Saccharomyces cerevisiae YPR128c, start by similarity
          Length = 322

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 40/85 (47%), Gaps = 9/85 (10%)

Query: 246 GAFSGTMLWLTVYPLDVVKSIIQN--------DDLRKPKYKNSISYVAKTIYAKEGIRAF 297
           GA + ++   TVYPLD+ K++IQ         D   + KYKN I  + K I+ K G    
Sbjct: 10  GAVASSLAATTVYPLDLAKTLIQTQHKNADSGDSKEEEKYKNVIDCIIK-IFKKRGFLGL 68

Query: 298 FKGFGPTMVRSAPVNGATFLTFELV 322
           ++G    +  +   N   F  + L+
Sbjct: 69  YQGLATNVAANFVQNFIYFFWYSLI 93

 Score = 32.0 bits (71), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 50/206 (24%), Positives = 87/206 (42%), Gaps = 24/206 (11%)

Query: 129 SQDVDLSRSNTLPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDC 188
           S+ ++LS    L L      G++ G +   + +PI  I  R Q  T +G D   K     
Sbjct: 111 SKFIELSTIEELAL------GMSAGAMTQVVTNPISVISTR-QQLTKDGEDASLKA---V 160

Query: 189 IKKL--KAQGGLM---RGLFPTMIRAGHGLGTY----FLVYEALVAREI-GTGLTRNEIP 238
           IK++  ++ G L    +G    ++ + +   TY     L    L A+ + G+     ++ 
Sbjct: 161 IKQIYEESNGDLTAFWKGFKVALVLSTNPAITYGSYQKLKSMILTAKGLSGSQKISTQLS 220

Query: 239 PWKLCLFGAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFF 298
             +  L G FS  +      PL V K  +Q    +  K+K +   V + IY  EG  + +
Sbjct: 221 AGENFLLGMFSKMISTFVTQPLIVAKITLQG---KGSKFK-TFQEVLQHIYQNEGFLSLW 276

Query: 299 KGFGPTMVRSAPVNGATFLTFELVMR 324
           KG  P + +   V G  F   + ++R
Sbjct: 277 KGVIPQVSKGVIVQGLLFTYKDEIVR 302

>KLLA0D09889g complement(834904..835998) similar to sp|Q03829
           Saccharomyces cerevisiae YMR166c, start by similarity
          Length = 364

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 46/200 (23%), Positives = 82/200 (41%), Gaps = 20/200 (10%)

Query: 145 YYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNG-----GDREFKGPWDCIKKLKAQGG-- 197
           +   G  G  ++SF+  P E ++ RLQ Q             +K   D +  +  + G  
Sbjct: 153 HLTAGFLGDFISSFVYVPSEVLKTRLQLQGRYNNPFFRSGYNYKNLTDAVTTIVRREGWP 212

Query: 198 -LMRGLFPTMIRAGHGLGTYFLVYEAL--VAREIGTGLTRNEIPPWKLCLFGAFSGTMLW 254
            L  G   T+ R     G  F  YE    +A  +       ++      + GA +G +  
Sbjct: 213 TLFFGYKATLSRDLPFSGLQFAFYEKFRQLAFAVENKTFDEDLSLSNEIITGAAAGGLAG 272

Query: 255 LTVYPLDVVKSIIQ----------NDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPT 304
           +   PLDVVK+ IQ          + +L++    NSI+    T+Y  EG+   F G GP 
Sbjct: 273 IITTPLDVVKTRIQTQLPDIPENSSQNLKQQTLTNSITKGMMTVYKTEGLAGLFSGVGPR 332

Query: 305 MVRSAPVNGATFLTFELVMR 324
            + ++  +    L +++ ++
Sbjct: 333 FIWTSIQSSIMLLLYQVALK 352

>YDL119C (YDL119C) [751] chr4 complement(246689..247612) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [924 bp, 307 aa]
          Length = 307

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 49/202 (24%), Positives = 86/202 (42%), Gaps = 42/202 (20%)

Query: 143 SQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQGGLMRGL 202
           S + + G  GG+ ++    P++ ++ R+Q       D++    W  +K++ +   L RG 
Sbjct: 11  SSHLIGGFFGGLTSAVALQPLDLLKTRIQQ------DKK-ATLWKNLKEIDSPLQLWRGT 63

Query: 203 FPTMIRAGHGLGTYF----LVYEALVAREIGTGLTRNEIPP------------------- 239
            P+ +R   G   Y     L+  +L  R       RN +P                    
Sbjct: 64  LPSALRTSIGSALYLSCLNLMRSSLAKR-------RNAVPSLTNDSNIVYNKSSSLPRLT 116

Query: 240 -WKLCLFGAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFF 298
            ++  L GAF+  ++     P+ V+K   ++        K +I++    IY KEG+  FF
Sbjct: 117 MYENLLTGAFARGLVGYITMPITVIKVRYESTLYNYSSLKEAITH----IYTKEGLFGFF 172

Query: 299 KGFGPTMVRSAPVNGATFLTFE 320
           +GFG T +R AP  G   L +E
Sbjct: 173 RGFGATCLRDAPYAGLYVLLYE 194

>KLLA0A09383g complement(818752..819852) similar to sp|P53320
           Saccharomyces cerevisiae YGR257c, start by similarity
          Length = 366

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 52/241 (21%), Positives = 85/241 (35%), Gaps = 60/241 (24%)

Query: 136 RSNTLPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQT-----SNGGDREFKGP----- 185
           RS+T  + +  +    G  + SF  +P++ +RIRLQ Q      S G   E KG      
Sbjct: 5   RSSTAIMKERMLSACAGSFLTSFFLTPMDVVRIRLQQQVMLPDCSCGAASELKGSVGTEV 64

Query: 186 ------------------------------------WDCIKKLKAQGG---LMRGLFPTM 206
                                               W+   K+    G   L RGL  T+
Sbjct: 65  IYDHVVANKNSPKIFWQDVCFQDIQCKNSALRFNSTWEAFTKISEVEGLATLWRGLSITL 124

Query: 207 IRAGHGLGTYFLVYEALVAREIGTGLTRNEIPPWKLCLFGAFSGTMLWLTVYPLDVVKSI 266
           + A      YF  YE            R+  P       GA +  +   TV PL+++K+ 
Sbjct: 125 LMAIPANVVYFSGYEMFRDH----SPMRDSYPSLNPLFCGATARMVAATTVAPLELIKTR 180

Query: 267 IQN------DDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATFLTFE 320
           +Q+      D   +  +K+ +      I +  G +  FKG   T+ R  P +   + ++E
Sbjct: 181 LQSIPRSRKDTTTQMMFKDLLKETRNEIRSG-GYKVLFKGLEITLWRDVPFSAIYWGSYE 239

Query: 321 L 321
            
Sbjct: 240 F 240

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 54/207 (26%), Positives = 85/207 (41%), Gaps = 33/207 (15%)

Query: 148 CGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDRE----FKGPWDCIKKLKAQ---GG--- 197
           CG T  +V +   +P+E I+ RLQ+   +  D      FK   D +K+ + +   GG   
Sbjct: 159 CGATARMVAATTVAPLELIKTRLQSIPRSRKDTTTQMMFK---DLLKETRNEIRSGGYKV 215

Query: 198 LMRGLFPTMIR----AGHGLGTYFLVYEALVAREIGTGLTRNEIPPWKLCLF----GAFS 249
           L +GL  T+ R    +    G+Y    +          L  N  P W   +     G+ S
Sbjct: 216 LFKGLEITLWRDVPFSAIYWGSYEFYKKNFWIDFSEQCLRWNLSPNWDFFINSFIGGSVS 275

Query: 250 GTMLWLTVYPLDVVKSII---------QNDDLRKPKYKNSISYVAKTIY---AKEGIRAF 297
           G+   L  +P DV K+ +         Q + L  PK + S   + K +Y     EG  A 
Sbjct: 276 GSSAALLTHPFDVGKTRMQITMDIENKQRNTLVSPKKRVSARGMFKFLYNIKQTEGYGAL 335

Query: 298 FKGFGPTMVRSAPVNGATFLTFELVMR 324
           + G  P +++ AP       T+EL  R
Sbjct: 336 YTGLIPRVMKIAPSCAIMISTYELSKR 362

>CAGL0F08305g complement(827705..828829) similar to sp|P53320
           Saccharomyces cerevisiae YGR257c, start by similarity
          Length = 374

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 50/205 (24%), Positives = 83/205 (40%), Gaps = 31/205 (15%)

Query: 147 VCGLTGGVVNSFLASPIEQIRIRLQTQTS----NGGDREFKGPWDCIKKLKAQGG----L 198
           +CG     + +   +P+E I+ +LQ+  S    NG    ++  ++ IK   A  G    +
Sbjct: 171 ICGAFARTLAATSVAPLELIKTKLQSIPSSSMKNGSVIMYRDLFNEIKSEIAMRGVAQTM 230

Query: 199 MRGLFPTMIRAGHGLGTYFLVYE---ALVAREIGTGLTRNEIPPWKLC---LFGAFSGTM 252
            +GL  T+ R       Y+  YE     VA    +   +N    +      L G  SG++
Sbjct: 231 FKGLEITLWRDVPFSAIYWASYEFYKTKVAYLSPSTFDKNSSNWFHFTNSFLGGFISGSL 290

Query: 253 LWLTVYPLDVVKSIIQNDDLRKPKYKNS-------------ISYVAKTIYAKEGIRAFFK 299
             +  +P DV K+  Q   +   K  NS             ++Y+ KT    EGI A + 
Sbjct: 291 AAICTHPFDVGKTRQQISLVTDKKLANSNLKYGSSNTMFGFLNYIRKT----EGIGALYT 346

Query: 300 GFGPTMVRSAPVNGATFLTFELVMR 324
           G  P + + AP       ++EL  R
Sbjct: 347 GLAPRVAKIAPSCAIMISSYELTKR 371

>AFR253W [3445] [Homologous to ScYFR045W - SH]
           complement(892939..892986,893047..894033) [1035 bp, 344
           aa]
          Length = 344

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 37/163 (22%), Positives = 69/163 (42%), Gaps = 6/163 (3%)

Query: 160 ASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQGGLMRGLFPTMIRAGHGLGTYFLV 219
           A P++    R            F G    I + +   G ++G  PT+ R        F  
Sbjct: 173 ARPVQTAHERWLLHYERQPSSHFAGTVLEIYRTRGVRGFLQGAMPTIFRQLGNSVVRFTT 232

Query: 220 YEALVAREIGTGLTRNEIPPWKLCLFGAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKN 279
           Y A + + +      +E   ++    GA S   +     P+DV+K+ +Q+       YK+
Sbjct: 233 Y-AWIVQSLSPHKALDE---YQAFAAGALSSAAVVALTQPIDVIKTRMQSKTAWF-TYKS 287

Query: 280 SISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATFLTFELV 322
           S++  A  I+ +EG R  +KG+ P + + +   G +F  ++ V
Sbjct: 288 SLN-CAYRIFVEEGFRYMWKGWVPRLFKVSLSGGISFGVYQYV 329

>AGL064W [4247] [Homologous to ScYBR291C (CTP1) - SH]
           complement(587623..588513) [891 bp, 296 aa]
          Length = 296

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 40/80 (50%), Gaps = 3/80 (3%)

Query: 244 LFGAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGP 303
           L GA SG +      P+D VK+ +Q  D    +Y +++    + +  +EG+RA ++G  P
Sbjct: 216 LVGALSGIVTVYATMPVDTVKTRMQALD--AARYGSTVGCF-RAVVREEGVRALWRGATP 272

Query: 304 TMVRSAPVNGATFLTFELVM 323
            + R     G  F  +E ++
Sbjct: 273 RLGRLVLSGGIVFTAYEKLL 292

 Score = 28.5 bits (62), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 26/125 (20%), Positives = 47/125 (37%), Gaps = 19/125 (15%)

Query: 103 SVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTLPLSQYYVCGLTGGVVNSFLASP 162
           +V+FG    +K+  Q Y  +                 L   Q ++ G   G+V  +   P
Sbjct: 184 AVRFGCYTQLKQAVQRYAGTPA------------DQPLGSGQTFLVGALSGIVTVYATMP 231

Query: 163 IEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQGG---LMRGLFPTMIRAGHGLGTYFLV 219
           ++ ++ R+Q   +      +     C + +  + G   L RG  P + R     G  F  
Sbjct: 232 VDTVKTRMQALDAA----RYGSTVGCFRAVVREEGVRALWRGATPRLGRLVLSGGIVFTA 287

Query: 220 YEALV 224
           YE L+
Sbjct: 288 YEKLL 292

>Scas_673.17
          Length = 314

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 43/184 (23%), Positives = 77/184 (41%), Gaps = 12/184 (6%)

Query: 143 SQYYVCGLTG----GVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQGGL 198
           S Y+   L G    G  +S L  P++ ++ R+Q + +   ++   G +  I   +  G L
Sbjct: 18  SDYFKFALAGAIGCGTTHSSLV-PVDVVKTRIQLEPTVY-NKGMVGSFKKIIADEGAGAL 75

Query: 199 MRGLFPTMIRAGHGLGTYFLVYEALVAREIGTGLTRNEIPPWKLCLFG--AFSGTMLWLT 256
           + G  PT++         F  YE      I T    N +        G  A +  +  + 
Sbjct: 76  LTGFGPTLLGYSVQGAFKFGGYEVFKKLSIDTIGYENAVHYKNSVYMGSAAVAEFLADIA 135

Query: 257 VYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATF 316
           + PL+  +  +    + +P + N +      I  +EG+ +F+ GF P + +  P N A F
Sbjct: 136 LCPLEATRIRL----VSQPTFANGLVGGFSRILKEEGVGSFYSGFTPILFKQIPYNIAKF 191

Query: 317 LTFE 320
           L FE
Sbjct: 192 LVFE 195

>KLLA0E02750g 260854..261768 similar to ca|CA6127|IPF149 Candida
           albicans peroxisomal membrane protein (by homology),
           start by similarity
          Length = 304

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 64/305 (20%), Positives = 114/305 (37%), Gaps = 44/305 (14%)

Query: 23  PNEKRELSSNRVLKDIFAGTIGGIAQVLVGQPFDXXXXXXXXXXXXXXXXXXXXXXXKNE 82
           PN+  EL+         AG++GG A + V  P                          N+
Sbjct: 6   PNDVDELA------HAIAGSLGGAASIAVTYPLVTITTNLQTKENEARPKLETIKEIYNK 59

Query: 83  -GVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTLP 141
            G+  ++ G  + + G+     V +        +F  + A     ++++         L 
Sbjct: 60  NGIIGYFLGLESAVYGMATTNFVYY--------YFYEWCAKTARTLTTKQY-------LS 104

Query: 142 LSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQG--GLM 199
             +  +     G + +  ++PI     R+    SN            I  +K  G   L+
Sbjct: 105 TWESILASTIAGSMTAVASNPIWVANTRMTVAKSNHSTLR-----TVIDIVKTDGPLTLL 159

Query: 200 RGLFPTMIRAGHGLGTYFLVYEALVAREIGTGLTRNEI--PPWKLCLFGAFSGTMLWLTV 257
            GL P ++   + +  Y  VYE L  + +   L R ++  P W   L GA        T 
Sbjct: 160 NGLKPALVLVSNPIIQY-TVYEQL--KNLVLRLQRKKVLSPSWAF-LLGAIGKLAATGTT 215

Query: 258 YPLDVVKS---IIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGA 314
           YP   +K+   ++QND    PK++ S+  +   I  K+G+   + G    +V+S  +  A
Sbjct: 216 YPYITLKTRMHLMQND----PKHQKSMWSLIVEIVKKDGVSGLYNGVAVKLVQS--IMTA 269

Query: 315 TFLTF 319
            FL F
Sbjct: 270 AFLFF 274

>Scas_687.15*
          Length = 328

 Score = 38.1 bits (87), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 58/126 (46%), Gaps = 6/126 (4%)

Query: 197 GLMRGLFPTMIRAGHGLGTYFLVYEALVAREIGTGLTRNEIPPWKLCLFGAFSGTMLWLT 256
           G  +G  PT+ R        F  Y  L  + I      NE+  + +   G FS   +   
Sbjct: 195 GFAQGAMPTVFRQVSNSTVRFTAYTTL-KQLISPTQPLNEVYAFGI---GLFSSCAVVAL 250

Query: 257 VYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATF 316
             P+DVVK+ +Q+       YKNS++  A  ++ +EG+ + +KG+ P + +     G +F
Sbjct: 251 TQPIDVVKTRMQSKTAHY-FYKNSLN-CAYRVFVEEGMVSLWKGWLPRLFKVGLSGGISF 308

Query: 317 LTFELV 322
             ++ V
Sbjct: 309 GVYQYV 314

>Scas_645.9
          Length = 391

 Score = 38.1 bits (87), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 48/206 (23%), Positives = 83/206 (40%), Gaps = 36/206 (17%)

Query: 147 VCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKL-----------KAQ 195
           +CG    ++ +   +P+E ++ +LQ+             W  +K+L            A 
Sbjct: 190 MCGAIARILAASTVAPLELLKTKLQSIPRVSKS---TTSWMMVKELLKETRQEMRISGAS 246

Query: 196 GGLMRGLFPTMIRAGHGLGTYFLVYEALVAREIGTGLTRNEIPPWKLCLF------GAFS 249
             L +GL  T+ R       Y+  YE      +    +++      L  F      G+ S
Sbjct: 247 NALFKGLEITLWRDVPFSAIYWGSYE-FCKTHLWMDTSKSHS---NLTFFINSFIGGSIS 302

Query: 250 GTMLWLTVYPLDVVK-----SIIQNDD---LRKP---KYKNSISYVAKTIYAKEGIRAFF 298
           GT+  L  +P DV K     S + N+D   ++ P   + KN   ++ + I+  EG  A +
Sbjct: 303 GTIAALVTHPFDVGKTRWQISFMGNNDKSVVKSPDIEQTKNMFKFL-RNIWKLEGWGALY 361

Query: 299 KGFGPTMVRSAPVNGATFLTFELVMR 324
            G  P MV+ AP       ++EL  R
Sbjct: 362 TGLVPRMVKIAPSCAIMISSYELSKR 387

 Score = 30.8 bits (68), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 33/63 (52%), Gaps = 3/63 (4%)

Query: 114 RFFQNYNASKNPNM---SSQDVDLSRSNTLPLSQYYVCGLTGGVVNSFLASPIEQIRIRL 170
           RF QN +   N  +    ++ +  + ++ L L Q  +   TG ++ S   +P++ +RIRL
Sbjct: 5   RFKQNLDPESNLFLLESCNRAMSTNATDGLTLHQRMLSASTGSLLTSLTLTPMDVVRIRL 64

Query: 171 QTQ 173
           Q Q
Sbjct: 65  QQQ 67

>CAGL0C02013g complement(209930..210919) weakly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1, hypothetical
           start
          Length = 329

 Score = 37.7 bits (86), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 31/120 (25%), Positives = 51/120 (42%), Gaps = 38/120 (31%)

Query: 241 KLCLFGAFSGTMLWLTVYPLDVVK-SIIQNDDL-------------------------RK 274
           +L + GA +GTM  L + P + VK ++IQN  L                         +K
Sbjct: 103 QLLMAGALTGTMESLCIIPFENVKVAMIQNSLLSHERLNTTTSNVQGQVANEVKKTFHKK 162

Query: 275 PKYKNS------------ISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATFLTFELV 322
           P  ++S            +   A  +Y + G+RA+FKG  PT++R    +   F TF ++
Sbjct: 163 PTLRSSYEALFPEKLPTNVLTTAAELYRQHGLRAYFKGTMPTLMRQVGNSVVRFTTFTML 222

>Scas_705.9
          Length = 323

 Score = 37.0 bits (84), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 38/72 (52%), Gaps = 13/72 (18%)

Query: 246 GAFSGTMLWLTVYPLDVVKSIIQND------------DLRKPKYKNSISYVAKTIYAKEG 293
           GA + TM  + VYPLDV K++IQ++            D R  + +N I  + + I+ K G
Sbjct: 10  GAIASTMANVIVYPLDVAKTVIQSETKAKETDELSEKDKRILRQENVIRCLIR-IFRKRG 68

Query: 294 IRAFFKGFGPTM 305
           +R  ++G   ++
Sbjct: 69  LRGLYQGMSTSV 80

 Score = 35.8 bits (81), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 35/73 (47%), Gaps = 4/73 (5%)

Query: 244 LFGAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGP 303
           + GA +  +  +   PL V K  +Q  + +   ++  + Y    +Y +EG+ A +KG GP
Sbjct: 227 ILGALAKIISTIITQPLIVAKVSLQRSNSKFKHFEEVLRY----LYKEEGVLALWKGVGP 282

Query: 304 TMVRSAPVNGATF 316
            + +   V G  F
Sbjct: 283 QLTKGVLVQGLVF 295

>YJR077C (MIR1) [2970] chr10 complement(577169..578104) Phosphate
           transporter of the mitochondrial carrier (MCF) family
           [936 bp, 311 aa]
          Length = 311

 Score = 37.0 bits (84), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 37/166 (22%), Positives = 74/166 (44%), Gaps = 17/166 (10%)

Query: 162 PIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQGGLMRGLFPTM----IRAGHGLGTYF 217
           PI+ ++ R+Q + +   ++   G +  I   +  G L+ G  PT+    I+     G Y 
Sbjct: 37  PIDVVKTRIQLEPTVY-NKGMVGSFKQIIAGEGAGALLTGFGPTLLGYSIQGAFKFGGY- 94

Query: 218 LVYEALVAREIGTGLTRNEIPPWKLCLF---GAFSGTMLWLTVYPLDVVKSIIQNDDLRK 274
            V++      +G     +    +K  ++    A +  +  + + PL+  +  +    + +
Sbjct: 95  EVFKKFFIDNLG----YDTASRYKNSVYMGSAAMAEFLADIALCPLEATRIRL----VSQ 146

Query: 275 PKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATFLTFE 320
           P++ N +      I  +EGI +F+ GF P + +  P N A FL FE
Sbjct: 147 PQFANGLVGGFSRILKEEGIGSFYSGFTPILFKQIPYNIAKFLVFE 192

 Score = 34.7 bits (78), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 31/67 (46%), Gaps = 3/67 (4%)

Query: 240 WKLCLFGAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFK 299
            K  L GA        ++ P+DVVK+ IQ   L    Y   +    K I A EG  A   
Sbjct: 18  MKFALAGAIGCGSTHSSMVPIDVVKTRIQ---LEPTVYNKGMVGSFKQIIAGEGAGALLT 74

Query: 300 GFGPTMV 306
           GFGPT++
Sbjct: 75  GFGPTLL 81

 Score = 31.6 bits (70), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 38/93 (40%), Gaps = 3/93 (3%)

Query: 23  PNEKRELSSNRVLKDIFAGTIGGIAQVLVGQPFDXXXXXXXXXXXX--XXXXXXXXXXXK 80
           P EK   S++  L ++ +G   G+A  +V QP D                         K
Sbjct: 204 PKEKLS-STSTTLLNLLSGLTAGLAAAIVSQPADTLLSKVNKTKKAPGQSTVGLLAQLAK 262

Query: 81  NEGVFAFYKGALTPLLGVGICVSVQFGVNEAMK 113
             G F  + G  T L+ VG   S+QFG+  ++K
Sbjct: 263 QLGFFGSFAGLPTRLVMVGTLTSLQFGIYGSLK 295

>AER450C [2950] [Homologous to ScYJR077C (MIR1) - SH]
           (1500683..1501609) [927 bp, 308 aa]
          Length = 308

 Score = 36.6 bits (83), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 33/66 (50%), Gaps = 3/66 (4%)

Query: 241 KLCLFGAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKG 300
           K  L GA         + P+DVVK+ IQ + L   KY + +    + I  +EG  A   G
Sbjct: 17  KFALAGAIGCGATHSAMVPIDVVKTRIQLEPL---KYSSGMVGSFRKIVGEEGAAALLTG 73

Query: 301 FGPTMV 306
           FGPT++
Sbjct: 74  FGPTLL 79

 Score = 33.9 bits (76), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 26/49 (53%)

Query: 272 LRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATFLTFE 320
           + +P + N +      I  +EGI +F+ GF P + +  P N A F+ FE
Sbjct: 142 VSQPTFANGLVGGFARILKEEGIGSFYNGFTPILFKQIPYNIAKFVVFE 190

>Kwal_33.15597
          Length = 305

 Score = 36.6 bits (83), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 43/167 (25%), Positives = 76/167 (45%), Gaps = 19/167 (11%)

Query: 162 PIEQIRIRLQ---TQTSNGGDREFKGPWDCIKKLKAQGGLMRGLFPTMIRAGHGL-GTY- 216
           PI+ ++ R+Q   T  + G    FK     I   +  G L+ G  PT++  G+ L G++ 
Sbjct: 33  PIDVVKTRIQLEPTVYNKGMISSFK----QIISSEGAGALLTGFGPTLL--GYSLQGSFK 86

Query: 217 FLVYEALVAREIGTGLTRNEIPPWKLCLF---GAFSGTMLWLTVYPLDVVKSIIQNDDLR 273
           F  YE      I T L  ++   +K  ++    A +     + + PL+  +  +    + 
Sbjct: 87  FGGYEVFKKLFIDT-LGYDQAVNYKNSIYIGSAAIAEFFADIALCPLEATRIRL----VS 141

Query: 274 KPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATFLTFE 320
           +P + N +      I  +EG+ +F+ GF P + +  P N A FL FE
Sbjct: 142 QPTFANGLVGGFSRILKEEGLSSFYNGFTPILFKQIPYNIAKFLVFE 188

>CAGL0F00231g 29705..30628 highly similar to sp|P23641 Saccharomyces
           cerevisiae YJR077c MIR1, hypothetical start
          Length = 307

 Score = 36.6 bits (83), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 37/162 (22%), Positives = 69/162 (42%), Gaps = 9/162 (5%)

Query: 162 PIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQGGLMRGLFPTMIRAGHGLGTYFLVYE 221
           PI+ ++ R+Q + +   ++   G +  I   +  G L+ G  PT++         F  YE
Sbjct: 33  PIDVVKTRIQLEPTVY-NKGMVGSFRKIIAEEGAGALLTGFGPTLLGYSIQGAFKFGGYE 91

Query: 222 ALVAREIGTGLTRNEIPPWKLCLFGAFSGTMLWLTVYPLDVVKSIIQNDDLR---KPKYK 278
                 I T L  +    +K  ++   +    +L     D+    ++   +R   +P + 
Sbjct: 92  VFKKFFIDT-LGYDTAARYKNSVYIGSAAAAEFLA----DIALCPLEATRIRLVSQPTFA 146

Query: 279 NSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATFLTFE 320
           N +      I  +EG+ +F+ GF P + +  P N A FL FE
Sbjct: 147 NGLVGGFSRILKEEGVGSFYSGFTPILFKQIPYNIAKFLVFE 188

>KLLA0E18788g complement(1661093..1662238) similar to sp|P38702
           Saccharomyces cerevisiae YHR002w, start by similarity
          Length = 381

 Score = 36.6 bits (83), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 45/199 (22%), Positives = 80/199 (40%), Gaps = 34/199 (17%)

Query: 149 GLTGGVVNSF---LASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQ-------GGL 198
           GL GGV  S    L +P+++I+I  QT  SN    ++ G +  +              G+
Sbjct: 57  GLAGGVAGSCAKTLIAPLDRIKILFQT--SNPHYVKYAGSFQGLLNAGVHIWSRDRLRGV 114

Query: 199 MRGLFPTMIRAGHGLGTYFLVYEALVAREIGTGLTRNEIPPWKLCLFGAFSGTMLWLTVY 258
            +G   T++R        F+ YE +  R +       E    +LC  G+ +G       Y
Sbjct: 115 FQGHSATLLRIFPYAAVKFIAYEQI--RNVIIPSKEYETHFRRLCS-GSLAGLCSVFCTY 171

Query: 259 PLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRA----------------FFKGFG 302
           PLD+++  +         +K  +  + K IY++    A                F++G+ 
Sbjct: 172 PLDLIRVRLA---YVTEHHKVRVWPLVKQIYSEPASEALSSKAYVPKWFAQWCNFYRGYI 228

Query: 303 PTMVRSAPVNGATFLTFEL 321
           PT++   P  G +F   +L
Sbjct: 229 PTVIGMIPYAGVSFFAHDL 247

>KLLA0B14454g complement(1268709..1269626) highly similar to
           sp|P23641 Saccharomyces cerevisiae YJR077c MIR1
           phosphate transport protein, mitochondrial (MCF), start
           by similarity
          Length = 305

 Score = 35.8 bits (81), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 32/66 (48%), Gaps = 3/66 (4%)

Query: 241 KLCLFGAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKG 300
           K  L GA    +   ++ P+DVVK+ IQ   L    Y   +    K I + EG  A   G
Sbjct: 15  KFALAGAIGCGITHSSMVPIDVVKTRIQ---LEPTVYNKGMVSSFKQIISSEGAGALLTG 71

Query: 301 FGPTMV 306
           FGPT++
Sbjct: 72  FGPTLL 77

 Score = 33.9 bits (76), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 40/183 (21%), Positives = 82/183 (44%), Gaps = 13/183 (7%)

Query: 143 SQYYVCGLTG-GVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQGGLMRG 201
           +++ + G  G G+ +S +  PI+ ++ R+Q + +   ++     +  I   +  G L+ G
Sbjct: 14  AKFALAGAIGCGITHSSMV-PIDVVKTRIQLEPTVY-NKGMVSSFKQIISSEGAGALLTG 71

Query: 202 LFPTMIRAGHGL-GTY-FLVYEALVAREIGTGLTRNEIPPWKLCLFGAFSGTMLW--LTV 257
             PT++  G+ L G++ F  YE      I      N +        G+ +    +  + +
Sbjct: 72  FGPTLL--GYSLQGSFKFGGYELFKKLAIDNMGYDNAVNYKNTIYIGSAAIAEFFADIAL 129

Query: 258 YPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATFL 317
            PL+  +  +    + +P + N +      I  +EG+ +F+ GF P + +  P N A F 
Sbjct: 130 CPLEATRIRL----VSQPTFANGLFGGFSRILKEEGVGSFYNGFTPILFKQIPYNIAKFF 185

Query: 318 TFE 320
            FE
Sbjct: 186 VFE 188

>KLLA0A00979g complement(92561..93592) weakly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, mitochondrial (MCF), start by similarity
          Length = 343

 Score = 35.4 bits (80), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 42/77 (54%), Gaps = 2/77 (2%)

Query: 246 GAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTM 305
           G FS   +     P+DVVK+ +Q+       Y+NS++ V +T + +EG+ + +KG+ P +
Sbjct: 253 GVFSSCAVVALTQPIDVVKTRMQSK-YTWSLYRNSLNCVYRT-FIEEGLTSLWKGWVPRL 310

Query: 306 VRSAPVNGATFLTFELV 322
            +     G +F  ++ V
Sbjct: 311 FKVGLSGGVSFGVYQYV 327

>CAGL0F07711g complement(751794..752900) similar to sp|Q03829
           Saccharomyces cerevisiae YMR166c, hypothetical start
          Length = 368

 Score = 35.0 bits (79), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 57/266 (21%), Positives = 100/266 (37%), Gaps = 62/266 (23%)

Query: 99  GICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTLPLSQYYVCGLTGGVVNSF 158
           G C ++  G   +   FF  Y  +K   ++   ++ + S       +   G  G   +SF
Sbjct: 113 GYCAAM-LGSFPSAAIFFSTYEFTKRTMINDYHLNDTFS-------HLTAGFLGDFFSSF 164

Query: 159 LASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQGGL----MRGLFPTMIRAGHGLG 214
           +  P E ++ RLQ Q              C        G     +R    T+ R   G+ 
Sbjct: 165 VYVPSEVLKTRLQLQ-------------GCYNNPHFNSGYNYKSLRNAIATIYRT-EGVA 210

Query: 215 TYFLVYEALVAREI---------------------GTGLTRNEIPPWKLCLFGAFSGTML 253
             F  Y+A +AR++                     G  + ++++      + GA +G + 
Sbjct: 211 ALFFGYKATLARDLPFSALQFAFYEKFRQWAFLLEGKDIYKHDLSISNEIVTGACAGGLA 270

Query: 254 WLTVYPLDVVKSIIQND--------------DLRKP-KYKNSISYVAKTIYAKEGIRAFF 298
            +   PLDVVK+ +Q                ++ KP    NSI    +T+Y  EG   FF
Sbjct: 271 GILTTPLDVVKTRVQTQLPSQIDISTDTKIKNVSKPVTLTNSIFKSLRTVYTSEGFFGFF 330

Query: 299 KGFGPTMVRSAPVNGATFLTFELVMR 324
            G GP  V ++  +    L +++ +R
Sbjct: 331 SGVGPRFVWTSVQSSIMLLLYQMALR 356

>KLLA0D04312g 367160..367471 highly similar to sgd|S0006215
           Saccharomyces cerevisiae YPR011c, hypothetical start
          Length = 103

 Score = 32.7 bits (73), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 43/87 (49%), Gaps = 6/87 (6%)

Query: 240 WKLCLFGAFSGTMLWLTVYPLDVVKSIIQ----NDDLRKPKYKNSISYVAKTIYAKEGIR 295
           +KL + GA SG +    VYP D+++   Q      +    +YK S+S    TI   EG +
Sbjct: 12  YKLAM-GAISGGVAQTLVYPFDLLRRRFQVLAMGGNELGFRYK-SVSDALITIGKTEGPK 69

Query: 296 AFFKGFGPTMVRSAPVNGATFLTFELV 322
            ++KG    + +  P    ++L +E++
Sbjct: 70  GYYKGLTANLFKVIPSTAVSWLVYEVI 96

>Sklu_1119.1 YJR077C, Contig c1119 366-1289
          Length = 307

 Score = 34.3 bits (77), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 49/198 (24%), Positives = 83/198 (41%), Gaps = 24/198 (12%)

Query: 131 DVDLSRSNTLPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQ---TQTSNGGDREFKGPWD 187
           D  LS      L+    CG T   +      PI+ ++ R+Q   T  + G    FK    
Sbjct: 7   DYSLSDYAKFALAGAIGCGTTHSAM-----VPIDVVKTRIQLEPTVYNKGMISSFK---- 57

Query: 188 CIKKLKAQGGLMRGLFPTMIRAGHGL-GTY-FLVYEALVAREIGTGLTRNEIPPWKLCLF 245
            I   +  G L+ G  PT++  G+ L G++ F  YE      I   L  ++   +K  ++
Sbjct: 58  QIISSEGAGALLTGFGPTLL--GYSLQGSFKFGGYEVFKKLFIDV-LGYDQAVNYKNSIY 114

Query: 246 ---GAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFG 302
               A +     + + PL+  +  +    + +P + N +      I  +EG  +F+ GF 
Sbjct: 115 IGSAAIAEFFADIALCPLEATRIRL----VSQPTFANGLVGGFSRILKEEGAGSFYNGFT 170

Query: 303 PTMVRSAPVNGATFLTFE 320
           P + +  P N A FL FE
Sbjct: 171 PILFKQIPYNIAKFLVFE 188

>AFL196W [2999] [Homologous to ScYMR166C - SH]
           complement(66955..68040) [1086 bp, 361 aa]
          Length = 361

 Score = 34.3 bits (77), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 36/159 (22%), Positives = 63/159 (39%), Gaps = 25/159 (15%)

Query: 178 GDREFKGPWDCIKKLKAQGGLMRGLF----PTMIRAGHGLGTYFLVYEALVAREIGTGLT 233
           G+ +++      + L  + G+ RGL+      M+ +      +F  YE +          
Sbjct: 86  GEVKYRHMISAYRTLALEEGVRRGLYGGYGAAMLGSFPSAAVFFGTYEWV---------K 136

Query: 234 RNEIPPWKLC-----LFGAFSGTMLWLTVY-PLDVVKSIIQ------NDDLRKPKYKNSI 281
           R  I  W++      L   F G +    VY P +V+K+ +Q      N   +       +
Sbjct: 137 RQMINEWQIHETYSHLAAGFLGDLFSSVVYVPSEVLKTRLQLQGCYNNRHFQSGYNYRGL 196

Query: 282 SYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATFLTFE 320
           S   +TI   EG+ A F G+  T+ R  P +   F  +E
Sbjct: 197 SDAVRTIVRTEGVSALFFGYKATLSRDLPFSALQFAFYE 235

 Score = 32.7 bits (73), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 37/69 (53%), Gaps = 3/69 (4%)

Query: 257 VYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIR-AFFKGFGPTMVRSAPVNGAT 315
           ++ LD VK+  Q     + KY++ IS   +T+  +EG+R   + G+G  M+ S P     
Sbjct: 71  MHSLDTVKTR-QQGAPGEVKYRHMIS-AYRTLALEEGVRRGLYGGYGAAMLGSFPSAAVF 128

Query: 316 FLTFELVMR 324
           F T+E V R
Sbjct: 129 FGTYEWVKR 137

 Score = 32.7 bits (73), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 48/213 (22%), Positives = 76/213 (35%), Gaps = 47/213 (22%)

Query: 145 YYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQGGL-MRGL- 202
           +   G  G + +S +  P E ++ RLQ Q              C      Q G   RGL 
Sbjct: 151 HLAAGFLGDLFSSVVYVPSEVLKTRLQLQ-------------GCYNNRHFQSGYNYRGLS 197

Query: 203 --FPTMIRAGHGLGTYFLVYEALVAREIGTGLTR----NEIPPWKLCL------------ 244
               T++R   G+   F  Y+A ++R++     +         W   L            
Sbjct: 198 DAVRTIVRT-EGVSALFFGYKATLSRDLPFSALQFAFYERFRKWAFLLERKPVDGHLSFT 256

Query: 245 ----FGAFSGTMLWLTVYPLDVVKSIIQND--------DLRKPKYKN-SISYVAKTIYAK 291
                GA +G +  +   PLDVVK+ IQ          D   P   N SI      +   
Sbjct: 257 AEVVTGASAGGLAGIITTPLDVVKTRIQTQPRGSAGTPDASAPARLNGSIFRSLLVVLRY 316

Query: 292 EGIRAFFKGFGPTMVRSAPVNGATFLTFELVMR 324
           EG+   F G GP  + ++  +    L ++  +R
Sbjct: 317 EGLGGAFSGVGPRFIWTSIQSSIMLLLYQTALR 349

>YGR257C (MTM1) [2204] chr7 complement(1006210..1007310) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [1101 bp, 366 aa]
          Length = 366

 Score = 33.9 bits (76), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 42/207 (20%), Positives = 77/207 (37%), Gaps = 26/207 (12%)

Query: 137 SNTLPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQG 196
           ++T P      CG    V  +   +P+E ++ +LQ+   +    +    W  +K L  + 
Sbjct: 153 ASTYPTLNPLFCGAIARVFAATSIAPLELVKTKLQSIPRSSKSTK---TWMMVKDLLNET 209

Query: 197 -----------GLMRGLFPTMIRAGHGLGTYFLVYEALVAREIGTGLTRNEIPPWKLCLF 245
                       L +GL  T+ R       Y+  YE L    +    TR          F
Sbjct: 210 RQEMKMVGPSRALFKGLEITLWRDVPFSAIYWSSYE-LCKERLWLDSTRFASKDANWVHF 268

Query: 246 ------GAFSGTMLWLTVYPLDVVK-----SIIQNDDLRKPKYKNSISYVAKTIYAKEGI 294
                 G  SG +  +  +P DV K     S++ N D +      ++    +TI+  EG+
Sbjct: 269 INSFASGCISGMIAAICTHPFDVGKTRWQISMMNNSDPKGGNRSRNMFKFLETIWRTEGL 328

Query: 295 RAFFKGFGPTMVRSAPVNGATFLTFEL 321
            A + G    +++  P       ++E+
Sbjct: 329 AALYTGLAARVIKIRPSCAIMISSYEI 355

 Score = 33.5 bits (75), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 25/41 (60%)

Query: 133 DLSRSNTLPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQ 173
           D + SN+L L +  +    G V+ S + +P++ +RIRLQ Q
Sbjct: 3   DRNTSNSLTLKERMLSAGAGSVLTSLILTPMDVVRIRLQQQ 43

>Sklu_2127.4 , Contig c2127 6322-7293
          Length = 323

 Score = 33.5 bits (75), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 34/152 (22%), Positives = 64/152 (42%), Gaps = 12/152 (7%)

Query: 159 LASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQGGLMRGLFPTMIRAGHGLG---- 214
           L  P+  I  +LQTQ  N  + + K   + IK++  + GL+ G +  +  A +G+     
Sbjct: 30  LTYPLVTITTKLQTQ-GNDENNQVKSKLETIKEIYRKDGLL-GFYAGLESAIYGMALTNF 87

Query: 215 TYFLVYEALVAREIGTGLTRNEIPPWKLCLFGAFSGTMLWLTVYPLDVVKSIIQNDDLRK 274
            Y+  YE L +R +       ++   +  L G  +G++  +   P+ V      N  +  
Sbjct: 88  VYYYFYE-LTSRNVLKVRKHKKLNTLESMLTGCVAGSVTAIASNPIWVA-----NTRMTV 141

Query: 275 PKYKNSISYVAKTIYAKEGIRAFFKGFGPTMV 306
            K + +       I  K+  +  F G  P +V
Sbjct: 142 TKSEKTALATIIEIVKKDSAKTLFNGLKPALV 173

>YPR128C (ANT1) [5547] chr16 complement(791212..792198)
           Peroxisome-localized protein involved in adenine
           nucleotide transport, medium-chain fatty acid
           metabolism, and peroxisome proliferation, has similarity
           to ADP/ATP carrier proteins [987 bp, 328 aa]
          Length = 328

 Score = 33.5 bits (75), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 44/95 (46%), Gaps = 14/95 (14%)

Query: 243 CLFGAFSGTMLWLTVYPLDVVKSIIQ-------NDD------LRKPKYKNSISYVAKTIY 289
            L GA +  M  + VYPLD+ K+IIQ       ++D      L   +YKN +  +   I+
Sbjct: 7   ALTGAVASAMANIAVYPLDLSKTIIQSQVSPSSSEDSNEGKVLPNRRYKNVVDCMIN-IF 65

Query: 290 AKEGIRAFFKGFGPTMVRSAPVNGATFLTFELVMR 324
            ++GI   ++G   T V +   N   F  +  + +
Sbjct: 66  KEKGILGLYQGMTVTTVATFVQNFVYFFWYTFIRK 100

 Score = 33.1 bits (74), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 18/73 (24%), Positives = 36/73 (49%), Gaps = 4/73 (5%)

Query: 244 LFGAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGP 303
           + G  S  +  L   PL V K+++Q+   +   ++ ++ Y    +Y  EG+++ +KG  P
Sbjct: 227 ILGVLSKMISTLVTQPLIVAKAMLQSAGSKFTTFQEALLY----LYKNEGLKSLWKGVLP 282

Query: 304 TMVRSAPVNGATF 316
            + +   V G  F
Sbjct: 283 QLTKGVIVQGLLF 295

>YFR045W (YFR045W) [1727] chr6 (242129..242986) Member of the
           mitochondrial carrier family (MCF) family of membrane
           transporters [858 bp, 285 aa]
          Length = 285

 Score = 33.1 bits (74), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 45/76 (59%), Gaps = 3/76 (3%)

Query: 247 AFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMV 306
           A S T++ +T  P+DVVK+ + + +  K +YKN+++ + + I+ +EG+  F+KG     +
Sbjct: 203 ATSFTLVAMT-QPIDVVKTRMMSQN-AKTEYKNTLNCMYR-IFVQEGMATFWKGSIFRFM 259

Query: 307 RSAPVNGATFLTFELV 322
           +     G TF  +E V
Sbjct: 260 KVGISGGLTFTVYEQV 275

>ABL023W [569] [Homologous to ScYKL120W (OAC1) - SH]
           complement(355977..356906) [930 bp, 309 aa]
          Length = 309

 Score = 32.0 bits (71), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 42/174 (24%), Positives = 72/174 (41%), Gaps = 24/174 (13%)

Query: 161 SPIEQIRIRLQTQTSNGGDREFKGPWDCIKKL----KAQG--GLMRGLFPTMIRAGHGLG 214
           SP++ ++ R+Q        R    P    ++L    K +G  GL +G+   ++R G G  
Sbjct: 136 SPLQLVKTRMQALAPR---RVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSA 192

Query: 215 TYFLVY----EALVAREIGTGLTRNEIPPWKLCLFGAFSGTMLWLTVYPLDVVKSIIQND 270
               VY    EAL +R +  G+           L  A S   + + + P DV  + + + 
Sbjct: 193 VQLAVYSHAKEAL-SRHVPDGMALYT-------LASALSSVAVCIAMNPFDVAMTRMYHH 244

Query: 271 DLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATFLTFELVMR 324
             R   Y+  +  + KT+  +EG  A +KG    ++R AP         E  +R
Sbjct: 245 --RGGLYRGPLDCLCKTVR-QEGFSALYKGHLAQLLRIAPHTILCLTLMEQALR 295

>YER053C (PIC2) [1481] chr5 complement(258736..259638) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, has similarity to C. elegans mitochondrial
           phosphate carrier protein [903 bp, 300 aa]
          Length = 300

 Score = 32.0 bits (71), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 28/51 (54%), Gaps = 1/51 (1%)

Query: 275 PKYKNSISYVAKTIYAKEG-IRAFFKGFGPTMVRSAPVNGATFLTFELVMR 324
           P + N++    K +YA+ G ++AF+KG  P   R  P     F +FE +++
Sbjct: 142 PPFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQ 192

>KLLA0B11319g 988293..989360 similar to sgd|S0006332 Saccharomyces
           cerevisiae YPR128c, start by similarity
          Length = 355

 Score = 31.6 bits (70), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 36/155 (23%), Positives = 67/155 (43%), Gaps = 16/155 (10%)

Query: 163 IEQIRIRLQ--TQTSNGGDREFKGPWDCIKKL---KAQGGLMRGLFPTMIRAGHGLGTYF 217
           I+QI+ + +  T T    ++ +K   D I K+   +  GGL  GL  +++       +YF
Sbjct: 66  IQQIKPKPEPPTATKESLEQRYKHALDVIVKVYRNEGFGGLYHGLSASLLGTFIQSFSYF 125

Query: 218 LVYEAL------VAREIGTGLTRNEIPPWKLCLFGAFSGTMLWLTVYPLDVVKSIIQNDD 271
             Y  +      V +  G     + I    L +  A +  +      P+++V +  Q   
Sbjct: 126 FWYTLIRRHYFRVKKVKGEAARFSTIEELLLSMLAAATSQLF---TNPINIVSTKQQTR- 181

Query: 272 LRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMV 306
            R  +  NS   +AK +Y ++GI  F+K    ++V
Sbjct: 182 -RGLEGDNSFKAIAKEVYDEDGITGFWKSLKVSLV 215

>YEL032W (MCM3) [1393] chr5 (86937..89852) Member of the MCM/P1
           family, part of the MCM complex that assembles at ARS
           elements to initiate replication [2916 bp, 971 aa]
          Length = 971

 Score = 31.6 bits (70), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 26/55 (47%), Gaps = 6/55 (10%)

Query: 239 PWKLCLFGAFSGTML---WLTVYPLD---VVKSIIQNDDLRKPKYKNSISYVAKT 287
           PWKL   G+F    L    LT   L+    V+ I+    L +PK   S+ Y AKT
Sbjct: 152 PWKLSFKGSFGAHALSPRTLTAQHLNKLVSVEGIVTKTSLVRPKLIRSVHYAAKT 206

>ADR036C [1777] [Homologous to ScYPR128C (ANT1) - SH]
           (771097..772119) [1023 bp, 340 aa]
          Length = 340

 Score = 30.8 bits (68), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 36/181 (19%), Positives = 67/181 (37%), Gaps = 18/181 (9%)

Query: 147 VCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQGGLMRGLFPTM 206
           V G+     +    +PI  +  R QT+    G  + +      +++ A+ G  RG +  +
Sbjct: 140 VLGIVAAATSQLFVNPINVVATRQQTRGQAAGAADMR---TVAREVHAENG-WRGFWAGL 195

Query: 207 -------IRAGHGLGTYFLVYEALVAREIGTGLTRNE---IPPWKLCLFGAFSGTMLWLT 256
                  +       TY  + EAL           +    + P +  + G  S  +  + 
Sbjct: 196 KVSLVLTVNPSITYATYERLREALFPTPAAASHLVDSAALLSPGQNFVMGVLSKIVSTVL 255

Query: 257 VYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATF 316
             PL + K+ +Q    R          V   +Y+ EG  + +KG GP + +   V G  F
Sbjct: 256 TQPLIIAKASLQ----RSGSCFQDFHQVLHHLYSTEGPLSLWKGLGPQITKGVLVQGLLF 311

Query: 317 L 317
           +
Sbjct: 312 M 312

>AFR147C [3339] [Homologous to NOHBY] (703270..704217) [948 bp, 315
           aa]
          Length = 315

 Score = 30.0 bits (66), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 39/160 (24%), Positives = 67/160 (41%), Gaps = 15/160 (9%)

Query: 159 LASPIEQIRIRLQT--QTSNGGDREFKGPWDCIKKLKAQGGLMRGLFPTMIRAGHGLGT- 215
           L  P+  +  R+Q   Q    G R  K   + ++++  + G++ G +  +  A +G+   
Sbjct: 33  LTMPLVTLATRMQVSEQDKEPGTRS-KSKLEAVREIYRKEGVV-GFYYGLESAMYGMAAN 90

Query: 216 ---YFLVYEALVAREIGTGLTRNEIPPWKLCLFGAFSGTMLWLTVYPLDVVKSIIQNDDL 272
              Y+  YE L AR          +   +  L  A +G+M  +   P+ VV     N  +
Sbjct: 91  SLNYYYFYE-LAARATMRVRGSRRLNTSEAILSSAVAGSMTAIASNPIWVV-----NTRM 144

Query: 273 RKPKYKNSISYVAKTIYAKEGIRAFFKGFGPT-MVRSAPV 311
              K + S   V   I  K+G+ A F G  P  M+ S P+
Sbjct: 145 TVAKSEQSTLAVLLDIVRKDGVTALFNGLRPALMLVSNPI 184

>CAGL0L01397g 152718..155555 highly similar to sp|P24279
           Saccharomyces cerevisiae YEL032w MCM3 replication
           initiation protein, hypothetical start
          Length = 945

 Score = 30.0 bits (66), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 26/55 (47%), Gaps = 6/55 (10%)

Query: 239 PWKLCLFGAFS------GTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKT 287
           PW+L   G+F       GT+  + +  L  ++ I+    L +PK   S+ Y  KT
Sbjct: 145 PWRLSFKGSFGSHTLSPGTLNAMYLNKLVSIEGIVTKTSLVRPKLMRSVHYAEKT 199

>Scas_696.9
          Length = 312

 Score = 29.6 bits (65), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 19/33 (57%)

Query: 284 VAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATF 316
           V ++IYAKEG+R  +KG     +R     G+ F
Sbjct: 156 VFRSIYAKEGLRGIYKGVNAVAIRQMTNWGSRF 188

>Sklu_2194.3 YMR241W, Contig c2194 5245-6183
          Length = 312

 Score = 29.6 bits (65), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 42/168 (25%), Positives = 74/168 (44%), Gaps = 18/168 (10%)

Query: 149 GLTGGVVNSFLASPIEQI--RIRLQTQTSNGGDREFKGPWDCIKKL-KAQG--GLMRGLF 203
           G+TGGV  ++L          + +  + S G     +  W   K++ K  G  G+ +G+ 
Sbjct: 115 GVTGGVAQAYLTMGFCTCMKTVEITKKKSAGAGAIPQSSWGAFKEIYKKDGIKGINKGVN 174

Query: 204 PTMIRAGHGLGTYFLVYEALVAREI--GTGLTRNEIPPWKLCLFGAFSGTMLW--LTVY- 258
              IR     G+ F  +  LV   I   TG T    P  KL      + + +   L+ + 
Sbjct: 175 AVAIRQMTNWGSRF-GFSRLVEEGIRNATGKTN---PDDKLTALEKIAASAIGGGLSAWN 230

Query: 259 -PLDVVKSIIQN--DDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGP 303
            P++V++  +Q+  +D  +PK   ++S   K IY   GI+  ++G  P
Sbjct: 231 QPIEVIRVEMQSKKEDPNRPK-NLTVSSAFKYIYQSSGIKGLYRGVAP 277

>AEL060C [2446] [Homologous to NOHBY] (525069..526358) [1290 bp, 429
           aa]
          Length = 429

 Score = 29.3 bits (64), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 30/117 (25%), Positives = 49/117 (41%), Gaps = 3/117 (2%)

Query: 209 AGHGLGTYFLVYEALVAREIGTGLTRNEIPPW--KLCLFGAFSGTMLWLTVYPLDVVKS- 265
           AG  L T +L   + +   +G G    + PP    +   G  +G    +   P+D + + 
Sbjct: 124 AGVVLYTTYLSSLSFLRGPLGAGGEHGQSPPRISDVVCAGFMAGVAQAVASAPIDAIYTR 183

Query: 266 IIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATFLTFELV 322
              ND L   K  NS+         + G+   F GFG ++V+ +      F TFEL+
Sbjct: 184 STANDLLSSAKKYNSLWLYGIDKLKEIGLVGCFGGFGLSLVKESVGFAVYFTTFELL 240

>KLLA0F08547g 796328..797254 similar to sp|Q04013 Saccharomyces
           cerevisiae YMR241w YHM2 yeast suppressor gene of HM
           (mitochondrial histone) mutant (ABF2) singleton, start
           by similarity
          Length = 308

 Score = 28.1 bits (61), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 35/133 (26%), Positives = 58/133 (43%), Gaps = 19/133 (14%)

Query: 105 QFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTLPLSQYYVCGLTGGVVNSFLASPIE 164
           +FG +  ++   + +    NP     D  L+      L + +   + GG+  S    PIE
Sbjct: 183 RFGFSRLVEEGLRKFTGKTNP-----DDKLT-----ALEKIFASAIGGGL--SAWNQPIE 230

Query: 165 QIRIRLQTQTSNGG---DREFKGPWDCIKKLKAQGGLMRGLFPTMIRAGHGLG-TYFLVY 220
            IR+ +Q++T++     D      +  I +     GL RG+ P   R G G+  T F+V 
Sbjct: 231 VIRVEMQSKTNDPNRPKDLTVGKAFRYIYQSNGVKGLYRGVTP---RIGLGIWQTVFMVG 287

Query: 221 EALVAREIGTGLT 233
              +ARE    LT
Sbjct: 288 CGDIAREFVGKLT 300

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.321    0.138    0.412 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,544,183
Number of extensions: 373329
Number of successful extensions: 2102
Number of sequences better than 10.0: 205
Number of HSP's gapped: 1471
Number of HSP's successfully gapped: 427
Length of query: 324
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 222
Effective length of database: 13,065,073
Effective search space: 2900446206
Effective search space used: 2900446206
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 62 (28.5 bits)