Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YBR102C (EXO84)75374036710.0
Scas_718.776479017660.0
CAGL0K12166g76476216440.0
ADL321W69774313960.0
Kwal_27.1258369575013241e-173
KLLA0E11319g72074811811e-152
CAGL0D05258g117064770.41
KLLA0D12914g1494133760.66
YHL027W (RIM101)62557711.9
Scas_721.7844456658.9
Sklu_2329.51036106669.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YBR102C
         (740 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YBR102C (EXO84) [291] chr2 complement(445019..447280) Subunit of...  1418   0.0  
Scas_718.7                                                            684   0.0  
CAGL0K12166g complement(1188432..1190726) similar to sp|P38261 S...   637   0.0  
ADL321W [1420] [Homologous to ScYBR102C (EXO84) - SH] complement...   542   0.0  
Kwal_27.12583                                                         514   e-173
KLLA0E11319g 996736..998898 similar to sp|P38261 Saccharomyces c...   459   e-152
CAGL0D05258g 500858..504370 similar to sp|P38989 Saccharomyces c...    34   0.41 
KLLA0D12914g complement(1101471..1105955) weakly similar to sgd|...    34   0.66 
YHL027W (RIM101) [2259] chr8 (51109..52986) Transcription factor...    32   1.9  
Scas_721.78                                                            30   8.9  
Sklu_2329.5 YDL215C, Contig c2329 7786-10896 reverse complement        30   9.1  

>YBR102C (EXO84) [291] chr2 complement(445019..447280) Subunit of
           the exocyst complex, required for pre-spliceosome
           formation and intron-dependent mRNA splicing [2262 bp,
           753 aa]
          Length = 753

 Score = 1418 bits (3671), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 696/740 (94%), Positives = 696/740 (94%)

Query: 1   MVEFSLKKARNNWKHVKKSASSPAKQKTPPSPAKPKQKTKKNPYSDLKDPATSYTLPTIN 60
           MVEFSLKKARNNWKHVKKSASSPAKQKTPPSPAKPKQKTKKNPYSDLKDPATSYTLPTIN
Sbjct: 1   MVEFSLKKARNNWKHVKKSASSPAKQKTPPSPAKPKQKTKKNPYSDLKDPATSYTLPTIN 60

Query: 61  ARERSRVATSMQRRLSIHNTNYAPPTLDYSMPLPDMPNMIVPXXXXXXXXXXXXFTTENE 120
           ARERSRVATSMQRRLSIHNTNYAPPTLDYSMPLPDMPNMIVP            FTTENE
Sbjct: 61  ARERSRVATSMQRRLSIHNTNYAPPTLDYSMPLPDMPNMIVPNDNVDSSHNNSSFTTENE 120

Query: 121 SVSSKGPSNSLNLSTADLSLNDSSYNKVPARSAMRNTVNPSGSNDPFNNSTSLRKMLANP 180
           SVSSKGPSNSLNLSTADLSLNDSSYNKVPARSAMRNTVNPSGSNDPFNNSTSLRKMLANP
Sbjct: 121 SVSSKGPSNSLNLSTADLSLNDSSYNKVPARSAMRNTVNPSGSNDPFNNSTSLRKMLANP 180

Query: 181 HFNAKDFVHDKLGNASAITIDKFTSNLTDLSIQVQEEVKLNINKSYNEIMTVNNDLNVAM 240
           HFNAKDFVHDKLGNASAITIDKFTSNLTDLSIQVQEEVKLNINKSYNEIMTVNNDLNVAM
Sbjct: 181 HFNAKDFVHDKLGNASAITIDKFTSNLTDLSIQVQEEVKLNINKSYNEIMTVNNDLNVAM 240

Query: 241 LELKRVRANINDLNEVLDQCTKIAEKRLQLQDQIDQERQGNFNNVESHSNSPALLPPLKA 300
           LELKRVRANINDLNEVLDQCTKIAEKRLQLQDQIDQERQGNFNNVESHSNSPALLPPLKA
Sbjct: 241 LELKRVRANINDLNEVLDQCTKIAEKRLQLQDQIDQERQGNFNNVESHSNSPALLPPLKA 300

Query: 301 GQNGNLMRRDRSSVLILEKFWDTELDQLFKNVEGAQKFINSTKGRHILMNSANWMELNTT 360
           GQNGNLMRRDRSSVLILEKFWDTELDQLFKNVEGAQKFINSTKGRHILMNSANWMELNTT
Sbjct: 301 GQNGNLMRRDRSSVLILEKFWDTELDQLFKNVEGAQKFINSTKGRHILMNSANWMELNTT 360

Query: 361 TGKPLQMVQIFILNDLVLIADKSRDKQNDFIVSQCYPLKDVTVTQEEFSTKRLLFKFXXX 420
           TGKPLQMVQIFILNDLVLIADKSRDKQNDFIVSQCYPLKDVTVTQEEFSTKRLLFKF   
Sbjct: 361 TGKPLQMVQIFILNDLVLIADKSRDKQNDFIVSQCYPLKDVTVTQEEFSTKRLLFKFSNS 420

Query: 421 XXXLYECRDADECSRLLDVIRKAKDDLCDIFHVEEENSKRIRESFRYLQSTQQTPGXXXX 480
              LYECRDADECSRLLDVIRKAKDDLCDIFHVEEENSKRIRESFRYLQSTQQTPG    
Sbjct: 421 NSSLYECRDADECSRLLDVIRKAKDDLCDIFHVEEENSKRIRESFRYLQSTQQTPGRENN 480

Query: 481 XXXXXXXXXXMGGSITPGRNVTGAMDQYLLQNLTLSMHSRPRSRDMSSTAQRLKFLDEGV 540
                     MGGSITPGRNVTGAMDQYLLQNLTLSMHSRPRSRDMSSTAQRLKFLDEGV
Sbjct: 481 RSPNKNKRRSMGGSITPGRNVTGAMDQYLLQNLTLSMHSRPRSRDMSSTAQRLKFLDEGV 540

Query: 541 EEIDIELARLRFESAVETLLDIESQLEDLSERISDEELMLLNLISLKIEQRREAXXXXXX 600
           EEIDIELARLRFESAVETLLDIESQLEDLSERISDEELMLLNLISLKIEQRREA      
Sbjct: 541 EEIDIELARLRFESAVETLLDIESQLEDLSERISDEELMLLNLISLKIEQRREAISSKLS 600

Query: 601 XXXXXXNEIVHLKSGTENMIKLGLPEQALDLFLQNRSNFIQDLILQIGSVDNPTNYLTQL 660
                 NEIVHLKSGTENMIKLGLPEQALDLFLQNRSNFIQDLILQIGSVDNPTNYLTQL
Sbjct: 601 QSILSSNEIVHLKSGTENMIKLGLPEQALDLFLQNRSNFIQDLILQIGSVDNPTNYLTQL 660

Query: 661 AVIRFQTIKKTVEDFQDIFKELGAKISSILVDWCSDEVDNHFKLIDKQLLNDEMLSPGSI 720
           AVIRFQTIKKTVEDFQDIFKELGAKISSILVDWCSDEVDNHFKLIDKQLLNDEMLSPGSI
Sbjct: 661 AVIRFQTIKKTVEDFQDIFKELGAKISSILVDWCSDEVDNHFKLIDKQLLNDEMLSPGSI 720

Query: 721 KSSRKQIDGLKAVGLDFVYK 740
           KSSRKQIDGLKAVGLDFVYK
Sbjct: 721 KSSRKQIDGLKAVGLDFVYK 740

>Scas_718.7
          Length = 764

 Score =  684 bits (1766), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/790 (49%), Positives = 510/790 (64%), Gaps = 89/790 (11%)

Query: 1   MVEFSLKKARNNWKHVKKSASSPAKQKTPPSPAK--------------PKQKTKK----- 41
           MV+FSL+KARNNWK  K   +SP KQKTP SP+K              PK++T K     
Sbjct: 1   MVDFSLRKARNNWKSSK--LTSPIKQKTPSSPSKTHHTPSPTPSSNDKPKKRTAKTNKGA 58

Query: 42  NPYSDLKDPATSYTLPTINARERSRVATSMQRRLSIHNTNYAPPTLDYSMPLPDMPNMIV 101
           NPYS ++  +   +LPT++++ +++VATSMQRRLSIHN+NY PP LDYSMPLP M    +
Sbjct: 59  NPYSTMQMTSDYSSLPTMDSKSKNKVATSMQRRLSIHNSNYVPPKLDYSMPLPSMSQ--I 116

Query: 102 PXXXXXXXXXXXXFTTENESVSSKGPSNSLNLSTADLSLNDSSYNKVPARSAMRNTVNPS 161
           P                      + P+     S     LN     +  ARS++     P 
Sbjct: 117 P----------------------ESPNKLDTTSHMQKPLNTGRPKE--ARSSLAKISQPK 152

Query: 162 GSNDPFNNSTSLRKMLANPHFNAKDFVHDKLGNASAITIDKFTSNLTDLSIQVQEEVKLN 221
                     +LR +L+NP FNAK+FVH+ L  A+AI ID+FTSNLT+L+  V EE+K N
Sbjct: 153 ----------TLRSILSNPSFNAKNFVHENLSEANAIDIDQFTSNLTNLAEYVSEEIKRN 202

Query: 222 INKSYNEIMTVNNDLNVAMLELKRVRANINDLNEVLDQCTKIAEKRLQLQDQIDQERQG- 280
           IN SY+EIM VN DLNVAM ELK++R NI  L+ V++Q   +A++RL L+    QE +  
Sbjct: 203 INDSYHEIMNVNKDLNVAMNELKQLRINIVQLSGVMEQFETLAQRRLDLEYSSMQEHENE 262

Query: 281 --NFNNVESH-SNSPALLPPLKAGQNGNLMRRDRSSVLILEKFWDTELDQLFKNVEGAQK 337
             + N  +S    +  LLPP+K+  +G    RDRSSV+ILEK WD EL  LFKN+EG QK
Sbjct: 263 DEDLNATQSQRRGNSTLLPPMKSTTDGKGKYRDRSSVMILEKVWDEELTNLFKNIEGIQK 322

Query: 338 FINSTK----------GRHILMNSANWMELNTTTGKPLQMVQIFILNDLVLI--ADKSRD 385
           FIN+ +           RH+L+ S +WMELN  T KP Q V+IFILNDL+L+      RD
Sbjct: 323 FINNDEFKNNSKLKKNARHLLLESNDWMELNVNTLKPFQNVKIFILNDLILVVAGKHGRD 382

Query: 386 --KQNDFIVSQCYPLKDVT-VTQEEFSTKRLLFKFXXXXXXLYECRDADECSRLLDVIRK 442
             KQN+F+VSQC PL +V  VT+++    RL F F      LYE R  +EC +++D +RK
Sbjct: 383 LIKQNEFVVSQCVPLGNVVGVTKDKMIRNRLYFDFGNGNHCLYENRTEEECDKVMDRVRK 442

Query: 443 AKDDLCDIFHVEEENSKRIRESFRYLQS-TQQTPGXXXXXXXXXXXXXXMGGSITPGR-- 499
           AKDDLCDIF  E+ENS++IRESF+YLQS  QQTP                   +TP R  
Sbjct: 443 AKDDLCDIFQTEQENSRKIRESFKYLQSQNQQTPSGNKDMNKSPMKSQRRSLGMTPHRMN 502

Query: 500 -------NVTGAMDQYLLQNLTLSMHSRPRSRDMSSTAQRLKFLDEGVEEIDIELARLRF 552
                  NVT   +Q+ LQ L+ SMHSR RS DM+S +++LK LD+ +EE+DIEL RL+F
Sbjct: 503 SLATNSNNVTST-EQFFLQTLSFSMHSRTRSHDMNSISRKLKKLDDSIEEVDIELTRLKF 561

Query: 553 ESAVETLLDIESQLEDLSERISDEELMLLNLISLKIEQRRE-AXXXXXXXXXXXXNEIVH 611
           + AV+TLLDIESQL ++ ++I+DE+LML  LISLK++QRRE              NEI  
Sbjct: 562 DIAVDTLLDIESQLTEIFDKINDEDLMLHKLISLKVDQRRELIISKLSQNILFSNNEISQ 621

Query: 612 LKSGTENMIKLGLPEQALDLFLQNRSNFIQDLILQIGSVDNPTNYLTQLAVIRFQTIKKT 671
           L +  + MIKLGLPEQ+LDLFL NRSN IQDLILQIGS DN TNYLTQLAVIRFQT+K+T
Sbjct: 622 LMTNLKTMIKLGLPEQSLDLFLTNRSNLIQDLILQIGSFDNSTNYLTQLAVIRFQTMKQT 681

Query: 672 VEDFQDIFKEL-GAKISSILVDWCSDEVDNHFKLIDKQLLNDEMLSPGSIKSSRKQIDGL 730
           V +F+ IF++L  +KISSILV WC++EVD +F+L+D+QLLNDE LS  SIK+SRKQ+D L
Sbjct: 682 VLNFEQIFQKLCSSKISSILVSWCNEEVDKYFRLVDQQLLNDENLSIESIKASRKQLDDL 741

Query: 731 KAVGLDFVYK 740
           K+VGLDFVYK
Sbjct: 742 KSVGLDFVYK 751

>CAGL0K12166g complement(1188432..1190726) similar to sp|P38261
           Saccharomyces cerevisiae YBR102c EXO84 exocyst protein
           essential for secretion, start by similarity
          Length = 764

 Score =  637 bits (1644), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/762 (46%), Positives = 492/762 (64%), Gaps = 33/762 (4%)

Query: 1   MVEFSLKKARNNWKHVKKSASSPAKQKTPPS-PAKPKQKTKKNPYSDLKDPATSYTLPTI 59
           MV+FSL+K RN WK     ++S +KQ +  S     K+K   NPY++L  P  +  LPT+
Sbjct: 1   MVDFSLRKTRNYWK----GSNSSSKQNSEVSLKNAEKKKPVTNPYANLTVPNAA-NLPTL 55

Query: 60  NARERSRVATSMQRRLSIHNTNYAPPTLDYSMPLP-----------DMPNMIVPX----- 103
           +A+ER++ A+SMQRRLSIH  NY  P LDYSMPLP           + P   VP      
Sbjct: 56  DAKERNKAASSMQRRLSIHTANYTAPNLDYSMPLPSSNLIDQAMGDEQPTGKVPAINVDD 115

Query: 104 -XXXXXXXXXXXFTTENESVSSKGPSNSLNLSTADLSLNDSSYNKVPARSAMRNTVNPSG 162
                         T+NE+           L+   L  + SS     +R  M   +NP  
Sbjct: 116 EYGQRNGHSRSATPTDNETSRRPETLRPPELNRKRLGGSGSSAPSGSSRMTMVAPLNPLS 175

Query: 163 SNDPFNNSTSLRKMLANPHFNAKDFVHDKLGNASAITIDKFTSNLTDLSIQVQEEVKLNI 222
                 +  SLRK+L++P F+AK F+H++L  ASA+ ID FTSNLT+LS  VQEEVK NI
Sbjct: 176 PYANLFHPASLRKILSDPQFSAKKFIHERLSEASAVDIDLFTSNLTELSTDVQEEVKRNI 235

Query: 223 NKSYNEIMTVNNDLNVAMLELKRVRANINDLNEVLDQCTKIAEKRLQLQDQ---IDQERQ 279
            KSYNEI+TVNNDL+ A  ELK++R++I++L +V DQ   +A+ R+Q+ +Q   +  +R 
Sbjct: 236 YKSYNEIITVNNDLHEASAELKQLRSSISELTKVTDQFVTVAKSRIQMDEQQKMLHTQRP 295

Query: 280 GNFNNVESHSNSPALLPPLKAGQNGNLMRRDRSSVLILEKFWDTELDQLFKNVEGAQKFI 339
            +    +S S  P +   +    NG   +RDR+SV+ILEK WDT+L  L+KNVEGAQK +
Sbjct: 296 SSPQKTQSSSLLPPVSSDI----NGTNPKRDRTSVMILEKMWDTQLATLYKNVEGAQKHL 351

Query: 340 NSTKGRHILMNSANWMELNTTTGKPLQMVQIFILNDLVLIADKSRDKQNDFIVSQCYPLK 399
                RH+L+ S++W ELN +T KPLQ VQ++ILND VL+A K+++KQ++ IVSQC P++
Sbjct: 352 GPASNRHLLIESSDWTELNISTQKPLQTVQLYILNDAVLVAGKTKNKQHELIVSQCCPIR 411

Query: 400 DVTV-TQEEFSTKRLLFKFXXXXXXLYECRDADECSRLLDVIRKAKDDLCDIFHVEEENS 458
           DVT+ T  E+ TK L+F F      LYE RD +EC R+LD  RKAKDDL DI   E+ENS
Sbjct: 412 DVTISTDREYRTK-LMFNFGNSNTCLYETRDINECMRVLDAFRKAKDDLRDITENEKENS 470

Query: 459 KRIRESFRYLQSTQQTPGXXXXXXXXXXXXXXMGGSITPGRNVTGAMDQYLLQNLTLSMH 518
           KRI+ES  YLQ+TQQTPG              +  S +  R ++ +MDQ++LQNL++S+H
Sbjct: 471 KRIKESLVYLQNTQQTPGREGSKSPAKRRSMGLSPS-SASRPLSASMDQFILQNLSISVH 529

Query: 519 SRPRSRDMSSTAQRLKFLDEGVEEIDIELARLRFESAVETLLDIESQLEDLSERISDEEL 578
           SR +S D SS + + K +D  +EE+DI+LARL+F+SAV TLL+ ESQL  + +   +E+ 
Sbjct: 530 SRSKSHDWSSLSHKFKLVDNLIEEVDIDLARLKFDSAVNTLLEAESQLATMKDPTKEEDA 589

Query: 579 MLLNLISLKIEQRREAXXXXXXXXXXXXNEIVHLKSGTENMIKLGLPEQALDLFLQNRSN 638
           ++LN+++LK++QRR+             NEI HL+ G + +I+LGLPE  LDL LQN+SN
Sbjct: 590 IILNVLTLKLDQRRDDILTKVTQRNLFINEIAHLREGVKTLIRLGLPEAGLDLLLQNKSN 649

Query: 639 FIQDLILQIGSVDNPTNYLTQLAVIRFQTIKKTVEDFQDIFKELGAKISSILVDWCSDEV 698
            IQ+L+LQ+GS ++P+ YLT+LA++RFQ IK+TV  F+++F     K+SSILV WCS EV
Sbjct: 650 LIQELLLQVGSSEHPSLYLTELAIVRFQIIKRTVIVFRELFHRDHDKLSSILVSWCSHEV 709

Query: 699 DNHFKLIDKQLLNDEMLSPGSIKSSRKQIDGLKAVGLDFVYK 740
           + HF L+ KQLLN + LSP +I+ SRKQID LK VGLDFVYK
Sbjct: 710 EKHFNLVSKQLLNGDKLSPDAIRYSRKQIDDLKTVGLDFVYK 751

>ADL321W [1420] [Homologous to ScYBR102C (EXO84) - SH]
           complement(130700..132793) [2094 bp, 697 aa]
          Length = 697

 Score =  542 bits (1396), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/743 (41%), Positives = 438/743 (58%), Gaps = 62/743 (8%)

Query: 1   MVEFSLKKARNNWKHVKKSASSPAKQKTPPSPAKPKQKTKKNPYSDLKDPATSYTLPTIN 60
           MV+FSL+KARNNW  +    SSP K +   SP K     K N Y D   P  +  LP I 
Sbjct: 1   MVDFSLRKARNNWSKL----SSPGKTRQQGSPTK----LKSNAYEDFVSPRDTLQLPEIG 52

Query: 61  ARERSRVATSMQRRLSIHNTNYAPPTLDYSMPLPDMPNMIVPXXXXXXXXXXXXFTTENE 120
            ++R +V TSMQRRLS+HN  Y PP +DY+   P +P  +                    
Sbjct: 53  MKDRRKVGTSMQRRLSVHNAKYIPPPIDYASA-PALPTAV-------------------- 91

Query: 121 SVSSKGPSNSLNLSTADLSLNDSSYNKVPARSAMRNTVNPSGSNDPFNNSTSLRKMLANP 180
                       L   D SL  S   K   R   R  V+  G         SLR++L+NP
Sbjct: 92  -----------ELPVRDNSLLSSELMKPNHR---RPPVDIYGGR-------SLREILSNP 130

Query: 181 HFNAKDFVHDKLGNASAITIDKFTSNLTDLSIQVQEEVKLNINKSYNEIMTVNNDLNVAM 240
            F AK FVH+KLG+A+A+ ID F SNL  LS ++++E+K NINKSYNE+M VN +L VA 
Sbjct: 131 QFQAKRFVHEKLGDATALEIDHFASNLNHLSQEIEQEIKSNINKSYNELMQVNKELAVAS 190

Query: 241 LELKRVRANINDLNEVLDQCTKIAEKRLQLQDQIDQERQGNFNNVESHSNSPALLPPLKA 300
            ELK +R+ +  L  V+ Q T +AEKRL L+ +  ++   +    +S S    LLPP+K+
Sbjct: 191 TELKDLRSKVQQLQVVMGQFTAMAEKRLLLEKEHFRQSNTSVMTTKSGSTGSGLLPPVKS 250

Query: 301 GQNGNLMRRDRSSVLILEKFWDTELDQLFKNVEGAQKFINSTKGRHILMNSANWMELNTT 360
           G      ++DRS+V+ LEK W  EL  LF++VEGAQK+I    GR IL+ S +WME+N  
Sbjct: 251 GA----AKKDRSTVITLEKIWTNELSSLFRSVEGAQKYIAPAPGRRILLESNDWMEINIA 306

Query: 361 TGKPLQMVQIFILNDLVLIADKSRDKQNDFIVSQCYPLKDVTVTQEEFSTKRLLFKFXXX 420
           T KPL   +IF+LND++L+A    DK+ + + +QC  L+++TV +E  S   L F F   
Sbjct: 307 TLKPLHATRIFLLNDMILVAVCRSDKKGELVANQCCSLRELTVAEE--SNYTLSFHFGNK 364

Query: 421 XXXLYECRDADECSRLLDVIRKAKDDLCDIFHVEEENSKRIRESFRYLQSTQQTPGXXXX 480
              LY  R     + LL+ I+ AKD+L DI+  EE+N++++R+ F YLQSTQQ+P     
Sbjct: 365 HHSLYRSRTPTGYTALLNEIKSAKDELRDIYQAEEDNARKLRDFFTYLQSTQQSPSRDIS 424

Query: 481 XXXXXXXXXXMGGSI--TPGRNVTGAMDQYLLQNLTLSMHSRPRSRDMSSTAQRLKFLDE 538
                       G++  TP R  T    + LLQN+++SMH+R RS  ++ TA +L  + E
Sbjct: 425 SPARGHSRQRSLGTLQNTPSRAST--YQENLLQNISMSMHTRSRSGGVNQTAVKLNLVYE 482

Query: 539 GVEEIDIELARLRFESAVETLLDIESQLEDLSERISDEELMLLNLISLKIEQRRE-AXXX 597
            +EE+ + + R+ F  A++ L  IE+ L+ ++   ++ E+MLLNL+ +K  Q R      
Sbjct: 483 ELEELSVPVTRMNFGLAIKKLHSIENILKGITAE-AEGEVMLLNLLRMKCNQTRTLITQK 541

Query: 598 XXXXXXXXXNEIVHLKSGTENMIKLGLPEQALDLFLQNRSNFIQDLILQIGSVDNPTNYL 657
                    ++   L+S T+++I LG+P +AL LFL NRSNFIQDL+LQ+G  DN  +Y+
Sbjct: 542 LTHVINTEYSDANKLESSTKSLILLGMPAEALQLFLHNRSNFIQDLVLQVGVHDNSNSYI 601

Query: 658 TQLAVIRFQTIKKTVEDFQDIFKELGAKISSILVDWCSDEVDNHFKLIDKQLLNDEMLSP 717
           TQ+AVIR QTIKK    FQ +F+   AK SS+LV WC+DEVD HF L+ KQL+ND+ L+P
Sbjct: 602 TQVAVIRCQTIKKVAIQFQKLFEGTTAKYSSVLVSWCNDEVDKHFFLMKKQLINDDQLTP 661

Query: 718 GSIKSSRKQIDGLKAVGLDFVYK 740
            +IK SRKQID LK+VG+DFVYK
Sbjct: 662 QAIKISRKQIDELKSVGMDFVYK 684

>Kwal_27.12583
          Length = 695

 Score =  514 bits (1324), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 296/750 (39%), Positives = 427/750 (56%), Gaps = 78/750 (10%)

Query: 1   MVEFSLKKARNNWKHVKKSASSPAKQKTPPSPAKPKQKTKKNPYSDLKDPATSYTLPTIN 60
           MV+ SL+KARNNWK +     +  + ++P       +  K NPY +LK P+    LPTI 
Sbjct: 1   MVDLSLRKARNNWKQMSSPPKAKGRSRSPED-----KNFKSNPYQNLKVPSNYSQLPTIG 55

Query: 61  ARERSRVATSMQRRLSIHNTNYAPPTLDY-SMPLPDMPNMIVPXXXXXXXXXXXXFTTEN 119
            +ER++V TSMQRRLS HN  Y PPT D+ ++PLP +                       
Sbjct: 56  TKERNKVGTSMQRRLSFHNPKYVPPTSDHMAVPLPQL----------------------- 92

Query: 120 ESVSSKGPSNSLNLSTADLSLNDSSYNKVPARSAMRNTVNPSGSNDP---FNNSTSLRKM 176
                 G S  LN+++ D               A R+  N + +  P      + SLR++
Sbjct: 93  ------GSSELLNVNSGDF--------------ATRHRSNSNFAKGPELDLYGNQSLRQI 132

Query: 177 LANPHFNAKDFVHDKLGNASAITIDKFTSNLTDLSIQVQEEVKLNINKSYNEIMTVNNDL 236
           L +P F  K F+   LGNASA+ ID+FTS+L DLS++V +E+K NI++SY ++  VN D+
Sbjct: 133 LGDPKFKPKHFITQTLGNASALEIDRFTSDLNDLSLEVSDEIKDNISRSYAQVSQVNKDI 192

Query: 237 NVAMLELKRVRANINDLNEVLDQCTKIAEKRLQLQDQIDQERQGNFNNVESHSNSPALLP 296
           + A  ELK +R++I +L EV+ +   +AEKRLQL      ER+ +     + S  P+LLP
Sbjct: 193 DRASSELKLLRSSITELKEVISEFETMAEKRLQL------ERRPS---TRARSEQPSLLP 243

Query: 297 PLKAGQNGNLMRRDRSSVLILEKFWDTELDQLFKNVEGAQKFINSTKGRHILMNSANWME 356
           P KA +      RDR+SV++LEK WD+EL  LFK VEGAQKFI    GRHILM + +W E
Sbjct: 244 PAKASRA-----RDRTSVMMLEKMWDSELASLFKAVEGAQKFIAPLPGRHILMETGDWYE 298

Query: 357 LNTTTGKPLQMVQIFILNDLVLIADKSRDK-QNDFIVSQCYPLKDVTVTQEEFSTKRLLF 415
           +N  T KPL+ + IF+LND++LIA +++D+ Q++++   C+ L+D ++  +     R+  
Sbjct: 299 VNAATLKPLRSIHIFVLNDMLLIAARNQDRRQHEYVACHCHALRDTSINPQR--ENRIEL 356

Query: 416 KFXXXXXXLYECRDADECSRLLDVIRKAKDDLCDIFHVEEENSKRIRESFRYLQSTQQTP 475
            F      L + ++A    RL+  +R A+DDL  I   EEEN++R+R+SF Y+Q+TQQTP
Sbjct: 357 CFGNRSQCLVQAKNARNYDRLVSTVRGAQDDLNVISQAEEENARRLRDSFSYMQATQQTP 416

Query: 476 GXXXXXXXXXXXXXXMGGSITPGRNVTGAMD----QYLLQNLTLSMHSRPRSRDMSSTAQ 531
           G               G + + G N     D     YLLQ +T SM S+P+    +    
Sbjct: 417 GRELAISPTKGH----GRNSSLGNNTPHPRDDPKESYLLQTITASMQSQPQFAGSNVGLG 472

Query: 532 RLKFLDEGVEEIDIELARLRFESAVETLLDIESQLEDLSERISDEELMLLNLISLKIEQR 591
                D+ VEE DIE AR  ++ A++ L  ++  ++ L +    E LM+LNL+ L++  R
Sbjct: 473 DFGRFDDEVEEFDIEFARHNYKEAIKKLESLKKAVQVLEQHTPHENLMILNLLGLRVSHR 532

Query: 592 REAXXXXXXX-XXXXXNEIVHLKSGTENMIKLGLPEQALDLFLQNRSNFIQDLILQIGSV 650
            +               +   L    +N+I L     AL LFLQNRS +I +LIL+IG+ 
Sbjct: 533 SQILVAKLTHLTATEIFDFSKLADYVQNLISLNYAHDALVLFLQNRSKYINELILKIGTF 592

Query: 651 DNPTNYLTQLAVIRFQTIKKTVEDFQDIFKELGAKISSILVDWCSDEVDNHFKLIDKQLL 710
            +P +YL+Q+AVIRFQT+KK V   Q+ F+  G   SS LV WC +E D HF LI+KQ L
Sbjct: 593 HDPVHYLSQIAVIRFQTLKKVVLRVQEQFQNTGDNFSSTLVSWCDEEADKHFALINKQFL 652

Query: 711 NDEMLSPGSIKSSRKQIDGLKAVGLDFVYK 740
           N EM+ P SIKSSR+QID LK+VGLDFVYK
Sbjct: 653 NLEMIPPSSIKSSRRQIDELKSVGLDFVYK 682

>KLLA0E11319g 996736..998898 similar to sp|P38261 Saccharomyces
           cerevisiae YBR102c EXO84 exocyst protein essential for
           secretion singleton, start by similarity
          Length = 720

 Score =  459 bits (1181), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 288/748 (38%), Positives = 437/748 (58%), Gaps = 49/748 (6%)

Query: 1   MVEFSLKKARNNWKHVKKSASSPAKQKTPPSPAKPKQKTKKNPYSDLK--DPATSYTLPT 58
           MV+FSLKK      H   S    +  +   S        K + Y D+K  DP     LP 
Sbjct: 1   MVDFSLKK------HGVSSWGRGSLSRKESSAGDSSSTFKSSRYQDMKVSDPE----LPK 50

Query: 59  INARERSRVATSMQRRLSIHNTN-YAPPTLDYSMPLPDMPNMIVPXXXXXXXXXXXXFTT 117
           ++A+ERS+  T M+RRLS+H +N +    +D+   +P +P+                   
Sbjct: 51  VSAKERSKAGTMMKRRLSVHQSNNFGAVKMDFD-NMPALPSS----------------AA 93

Query: 118 ENESVSSKGPSNSLNLSTADLSLNDSSYNKVPARSAMRNTVNPSGS--NDPFNNSTSLRK 175
           +    S+ G +   +L T D         ++P R+    ++N +    +    +S SLR+
Sbjct: 94  DYSFASNVGNATQTSLITED---------QLPDRNTSLASLNTNTRRPDQELYSSKSLRQ 144

Query: 176 MLANPHFNAKDFVHDKLGNASAITIDKFTSNLTDLSIQVQEEVKLNINKSYNEIMTVNND 235
           +L+NP F AK F+ +KLG+A+A+ ID+FTSNL DLS+++Q+E+K NI+KS+ EI+ VN  
Sbjct: 145 ILSNPDFKAKKFITEKLGDATAVDIDQFTSNLNDLSLEIQDEIKFNIDKSFKEILIVNKG 204

Query: 236 LNVAMLELKRVRANINDLNEVLDQCTKIAEKRLQLQDQIDQERQGNFNNVESHSNSPALL 295
           L  A  ELK +R  + ++ ++++Q   IAEK+LQ +   ++    N  +  +  ++ +LL
Sbjct: 205 LETATTELKVLRTKVQEMKDIMNQFVTIAEKKLQAEQAANETADLNRTSSSASLSNHSLL 264

Query: 296 PPLKAGQNGNLMRRDRSSVLILEKFWDTELDQLFKNVEGAQKFINSTKGRHILMNSANWM 355
           PPLK   +    R+DR+SV ILE+ W+ EL  LFKNV+GA K+I ST GRHIL+ S NW+
Sbjct: 265 PPLKPTPSAT--RKDRTSVYILERMWNEELMTLFKNVDGAHKYITSTPGRHILLESDNWI 322

Query: 356 ELNTTTGKPLQMVQIFILNDLVLIADKSRDKQNDFIVSQCYPLKDVTVTQEEFSTKRLLF 415
           E+N  T KPLQ V++FILND+VLIA     KQ +  VS+  PL+DVTV  E  S   L F
Sbjct: 323 EINPATLKPLQKVRLFILNDVVLIAAPKPSKQTELTVSRFSPLRDVTV--EVQSEHELSF 380

Query: 416 KFXXXXXXLYECRDADECSRLLDVIRKAKDDLCDIFHVEEENSKRIRESFRYLQSTQQTP 475
            F      LY  RD    S+++D+IR+AKD L +I   EE+ +++IR S+  LQ  ++TP
Sbjct: 381 NFSNKQHTLYRHRDPQVFSKVIDIIRQAKDALREISQAEEDTTRKIRNSYTLLQQ-ERTP 439

Query: 476 GXXXXXX--XXXXXXXXMGGSITPGRNVTGAMDQYLLQNLTLSMHSRPRSRDMSSTAQRL 533
                             GG+ TP R+ + A +  LL N+T S+H R  S + +   +RL
Sbjct: 440 NRDATTSPVKVHGRQRSYGGTGTPSRHRSDAQNDALLTNITRSIHVRMGSEETTEVTKRL 499

Query: 534 KFLDEGVEEIDIELARLRFESAVETLLDIESQLEDLSERISDEELMLLNLISLKIEQRRE 593
           K LD+ +E++D+E+ R  F+ A+  L  I+S L+ L    + +E +++ L+SLK  QR+ 
Sbjct: 500 KRLDDALEDLDLEIGRQNFDLAITKLNHIQSSLKSLYSSATFDESVMVELLSLKCSQRKT 559

Query: 594 AXXXXXXXXXX-XXNEIVHLKSGTENMIKLGLPEQALDLFLQNRSNFIQDLILQIGSVDN 652
                         +++  LKS   N++ L  P  AL++FLQNRSNFI DL LQIG +DN
Sbjct: 560 ILYTKLTNLLACETSDMTKLKSYMLNLVALNEPVDALEVFLQNRSNFINDLTLQIGIIDN 619

Query: 653 PTNYLTQLAVIRFQTIKKTVEDFQDIFKELGAKISSILVDWCSDEVDNHFKLIDKQLLND 712
            T+++TQ+A+IRFQT+KK  + + ++ K L    +S+LV WCS+EVD HF+L++++L N 
Sbjct: 620 VTSFITQVAIIRFQTLKKVTQQYLEVSKNLKRDYTSLLVCWCSEEVDKHFQLMERELSNS 679

Query: 713 EMLSPGSIKSSRKQIDGLKAVGLDFVYK 740
             LS  +IK +RKQID LK VG+D+VYK
Sbjct: 680 STLSVQAIKITRKQIDELKPVGMDYVYK 707

>CAGL0D05258g 500858..504370 similar to sp|P38989 Saccharomyces
           cerevisiae YFR031c SMC2 chromosome segregation protein,
           start by similarity
          Length = 1170

 Score = 34.3 bits (77), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 41/64 (64%), Gaps = 6/64 (9%)

Query: 205 SNLTDLSIQVQEEVKLN--INKSYNEIMTVNNDLNVAMLELKRVRANINDLNEVLDQCTK 262
           S + D+  +++EE+K+N  +  S  E+M+V NDLNV   E KR+ +NI+D  E L++  K
Sbjct: 844 STVQDIEKKLEEEIKINKMLKTSEEELMSVQNDLNV---ERKRI-SNIDDELEELERTIK 899

Query: 263 IAEK 266
             E+
Sbjct: 900 QKEE 903

>KLLA0D12914g complement(1101471..1105955) weakly similar to
           sgd|S0006163 Saccharomyces cerevisiae YPL242c IQG1
           involved in cytokinesis, has, hypothetical start
          Length = 1494

 Score = 33.9 bits (76), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 35/133 (26%), Positives = 63/133 (47%), Gaps = 30/133 (22%)

Query: 222 INKSYNEIMTVNNDLNVAMLELKRVRANINDLNEVLDQCTKIAEKRLQLQDQIDQER--- 278
           +N+S NE+ + N         L++++ANIND+N+ + +  +   K++ ++D +++ R   
Sbjct: 746 LNQSDNELFSAN---------LQKLKANINDVNDEVGELQESLRKKVLMKDSLEKRRIDV 796

Query: 279 ------------QGNFNNVESHSNSPALLPPLKAGQNGNLMRRDRSSVLILEK----FWD 322
                       +  FN + S  N  A L  L  G+ G L++ D     +L K    F  
Sbjct: 797 CKFLTPAGRQQLEIQFNAISS-DNISANLKSL-YGKAGFLLQVDSFYWHLLAKGDPRFCV 854

Query: 323 TELDQLFKNVEGA 335
           T L +LF  + GA
Sbjct: 855 TNLPKLFAPIRGA 867

>YHL027W (RIM101) [2259] chr8 (51109..52986) Transcription factor
           involved in induction of IME1, IME2, DIT1, and DIT2
           transcription, has three C2H2-type zinc fingers [1878
           bp, 625 aa]
          Length = 625

 Score = 32.0 bits (71), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 30/57 (52%), Gaps = 4/57 (7%)

Query: 280 GNFNNVESHSNSPALLPPLKAGQNGNLMRRDRSSVLILEKFWDTELDQLFKNVEGAQ 336
           G+F   +SHS SP +LPPL  G + +L  + +   + L +    EL Q +K V   Q
Sbjct: 279 GSF---KSHSTSPQILPPLPVGISQHLPSQQQQRAISLNQLCSDELSQ-YKPVYSPQ 331

>Scas_721.78
          Length = 444

 Score = 29.6 bits (65), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 30/56 (53%), Gaps = 6/56 (10%)

Query: 616 TENMIKLGLPEQALDLFLQNRSNF------IQDLILQIGSVDNPTNYLTQLAVIRF 665
           +EN  K+   EQ+L L LQ R+N       I++LI    S+ N  N L QL  +++
Sbjct: 179 SENEFKMNSKEQSLKLKLQERNNMKLAKRKIRNLISYRESLSNLQNQLDQLETLKY 234

>Sklu_2329.5 YDL215C, Contig c2329 7786-10896 reverse complement
          Length = 1036

 Score = 30.0 bits (66), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 26/106 (24%), Positives = 53/106 (50%), Gaps = 5/106 (4%)

Query: 170 STSLRKMLANPHFNAKDFVHDKLGNASAITIDKFTSNLTDLSIQVQEEVKLNINKSYNEI 229
           ++S  ++LA+   N  DFV + +G        + T    D  I+VQ++++ N    +N++
Sbjct: 865 TSSSSEVLASLALNDDDFVGEFIGEKEG----ERTKLYQDYVIEVQQKIQRNAVFEFNQL 920

Query: 230 MTVNNDLNVAMLELKRVRA-NINDLNEVLDQCTKIAEKRLQLQDQI 274
             +N      + EL  V +  IN LN+ L   +++    L+L++ +
Sbjct: 921 WELNQSTGTPISELSNVLSQTINKLNDDLIHSSELWLNDLKLRNYL 966

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.130    0.362 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 22,417,408
Number of extensions: 964345
Number of successful extensions: 4015
Number of sequences better than 10.0: 85
Number of HSP's gapped: 4094
Number of HSP's successfully gapped: 87
Length of query: 740
Length of database: 16,596,109
Length adjustment: 109
Effective length of query: 631
Effective length of database: 12,822,747
Effective search space: 8091153357
Effective search space used: 8091153357
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 65 (29.6 bits)