Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YBR068C (BAP2)60959931890.0
YDR046C (BAP3)60460023920.0
Scas_569.559355023070.0
CAGL0L07546g63461923030.0
Scas_718.4259558922670.0
CAGL0H08393g61255320950.0
AGR038C58057719730.0
Kwal_27.1053860254918970.0
CAGL0K05753g66061717580.0
YDR508C (GNP1)66362617280.0
CAGL0B01012g62360017150.0
AGR039C58655616900.0
Kwal_33.1320460755916570.0
Kwal_33.1321559858216460.0
YCL025C (AGP1)59557515910.0
KLLA0C01606g62057115910.0
AFR698C60957115300.0
Scas_517.267961515250.0
AGR040C57357715080.0
YBR069C (TAT1)61957214000.0
Scas_718.4161454613500.0
Sklu_2029.259855412761e-170
YKR039W (GAP1)60259112731e-169
Kwal_27.1268159356512691e-168
ADL272W56451212531e-166
CAGL0L03267g59754512491e-165
Sklu_2390.160553312321e-163
KLLA0A06886g58754212111e-160
Kwal_33.1427659657511891e-156
Kwal_33.1540758756911771e-155
CAGL0B03773g60556611791e-155
AGR319W62660711731e-154
YGR191W (HIP1)60353011621e-152
KLLA0A11770g58157011441e-150
KLLA0F01012g55651711301e-148
Scas_479.159554011281e-147
Scas_507.159258211251e-147
Scas_607.459951411051e-144
KLLA0A06930g58754210901e-142
AFR230C60454610731e-139
CAGL0D02178g57757610641e-138
AEL030W73953810701e-137
YOL020W (TAT2)59255810501e-136
KLLA0A10813g58457610461e-135
Kwal_34.162544814919621e-124
Kwal_56.229515965999411e-119
KLLA0B06776g5885609311e-118
YLL061W (MMP1)5835649091e-115
Scas_536.13723588771e-113
YPL274W (SAM3)5875708921e-112
YNL268W (LYP1)6115978331e-103
CAGL0J08162g5975098221e-102
Scas_706.36d6075948161e-101
YEL063C (CAN1)5905658141e-101
AER405C4974998001e-99
KLLA0E16335g6055967913e-97
CAGL0J08184g5725477841e-96
Kwal_33.134115605627805e-96
Scas_706.375445247603e-93
KLLA0C02365g5795277623e-93
KLLA0C02343g5815137615e-93
Kwal_33.134015595567571e-92
AFR667C5635097562e-92
CAGL0A01199g6135457558e-92
YPL265W (DIP5)6085247462e-90
AFR668W5564997342e-89
YNL270C (ALP1)5735447353e-89
Scas_486.25975847121e-85
Scas_377.24904956988e-85
YOR348C (PUT4)6276227052e-84
Kwal_33.155455765457013e-84
Scas_520.2*3723566827e-84
Kwal_26.96125435546687e-80
KLLA0F27093g5635076646e-79
Scas_84.12132066269e-78
CAGL0E05632g5985036404e-75
Sklu_2438.145585176341e-74
AFR156W5585276271e-73
YFL055W (AGP3)5585236234e-73
ACL135W5885816255e-73
Kwal_26.69405705386166e-72
Kwal_23.28175805596167e-72
CAGL0M00154g5505486079e-71
KLLA0B14685g5714295922e-68
KLLA0F23419g5735265834e-67
Kwal_8.5906295935682e-64
Scas_552.35585335527e-63
Kwal_26.80975445514949e-55
Kwal_23.40265344864791e-52
Sklu_2365.98055704777e-51
Scas_460.35845514619e-50
Scas_377.11481374192e-48
AAR038W5665164474e-48
YBR132C (AGP2)5965754495e-48
KLLA0C15873g5685064441e-47
Kwal_23.38475794494311e-45
CAGL0C00539g5725004301e-45
KLLA0D16830g8325864221e-43
Kwal_53.194615655693983e-41
KLLA0B09922g7976163991e-40
Kwal_27.119007265823927e-40
CAGL0E01089g8536683788e-38
Scas_619.2*4714703671e-37
YDR160W (SSY1)8526163715e-37
AGL171W8515623653e-36
Scas_682.308455683619e-36
Scas_485.4*2372083071e-31
Scas_476.42372083071e-31
Scas_642.222372083035e-31
Sklu_2147.45683161085e-05
Scas_622.105622091051e-04
Kwal_33.138065493001042e-04
Scas_233.114190920.001
Scas_689.19612273980.001
Sklu_2305.6541416940.003
KLLA0A06666g560142910.006
YKL174C61888850.031
Scas_670.14585439850.031
CAGL0M08272g62186800.14
YHL036W (MUP3)546279790.19
KLLA0C15521g547406770.28
CAGL0H03399g556280750.49
CAGL0B02838g592399730.86
AFR326W1309147730.96
YGL077C (HNM1)563100721.3
Scas_720.18569318721.4
AEL125C57577711.5
YGR055W (MUP1)574428683.5
CAGL0E04004g527199674.8
ACL073W525221665.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YBR068C
         (599 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YBR068C (BAP2) [258] chr2 complement(373821..375650) Branched-ch...  1233   0.0  
YDR046C (BAP3) [899] chr4 complement(548758..550572) Branched ch...   926   0.0  
Scas_569.5                                                            893   0.0  
CAGL0L07546g complement(831824..833728) highly similar to sp|P38...   891   0.0  
Scas_718.42                                                           877   0.0  
CAGL0H08393g 821998..823836 highly similar to sp|P41815 Saccharo...   811   0.0  
AGR038C [4348] [Homologous to ScYDR046C (BAP3) - SH; ScYBR068C (...   764   0.0  
Kwal_27.10538                                                         735   0.0  
CAGL0K05753g 564282..566264 highly similar to sp|P48813 Saccharo...   681   0.0  
YDR508C (GNP1) [1322] chr4 complement(1466441..1468432) High aff...   670   0.0  
CAGL0B01012g 91330..93201 similar to sp|P25376 Saccharomyces cer...   665   0.0  
AGR039C [4349] [Homologous to ScYDR046C (BAP3) - SH; ScYBR068C (...   655   0.0  
Kwal_33.13204                                                         642   0.0  
Kwal_33.13215                                                         638   0.0  
YCL025C (AGP1) [519] chr3 complement(76131..77918) Broad substra...   617   0.0  
KLLA0C01606g complement(123485..125347) similar to sp|P48813 Sac...   617   0.0  
AFR698C [3891] [Homologous to ScYDR508C (GNP1) - SH; ScYCL025C (...   593   0.0  
Scas_517.2                                                            592   0.0  
AGR040C [4350] [Homologous to ScYBR069C (TAT1) - SH] (782289..78...   585   0.0  
YBR069C (TAT1) [259] chr2 complement(376534..378393) Amino acid ...   543   0.0  
Scas_718.41                                                           524   0.0  
Sklu_2029.2 , Contig c2029 2095-3891                                  496   e-170
YKR039W (GAP1) [3292] chr11 (514705..516513) General amino acid ...   494   e-169
Kwal_27.12681                                                         493   e-168
ADL272W [1469] [Homologous to ScYDR508C (GNP1) - NSH] complement...   487   e-166
CAGL0L03267g 372787..374580 highly similar to sp|P19145 Saccharo...   485   e-165
Sklu_2390.1 YGR191W, Contig c2390 5453-7270 reverse complement        479   e-163
KLLA0A06886g complement(621646..623409) similar to sp|P19145 Sac...   471   e-160
Kwal_33.14276                                                         462   e-156
Kwal_33.15407                                                         457   e-155
CAGL0B03773g 373956..375773 highly similar to sp|P06775 Saccharo...   458   e-155
AGR319W [4630] [Homologous to ScYGR191W (HIP1) - SH] complement(...   456   e-154
YGR191W (HIP1) [2141] chr7 (880423..882234) Histidine permease, ...   452   e-152
KLLA0A11770g 1014918..1016663 similar to sp|P06775 Saccharomyces...   445   e-150
KLLA0F01012g complement(90772..92442) similar to sp|P48813 Sacch...   439   e-148
Scas_479.1                                                            439   e-147
Scas_507.1                                                            437   e-147
Scas_607.4                                                            430   e-144
KLLA0A06930g complement(625498..627261) similar to sp|P19145 Sac...   424   e-142
AFR230C [3422] [Homologous to ScYKR039W (GAP1) - NSH] (855416..8...   417   e-139
CAGL0D02178g 222597..224330 highly similar to sp|P38967 Saccharo...   414   e-138
AEL030W [2476] [Homologous to ScYOL020W (TAT2) - SH] complement(...   416   e-137
YOL020W (TAT2) [4796] chr15 (286172..287950) High affinity trypt...   409   e-136
KLLA0A10813g complement(936126..937880) similar to sp|P38967 Sac...   407   e-135
Kwal_34.16254                                                         375   e-124
Kwal_56.22951                                                         367   e-119
KLLA0B06776g 594172..595938 similar to sgd|S0006195 Saccharomyce...   363   e-118
YLL061W (MMP1) [3363] chr12 (17956..19707) High affinity S-methy...   354   e-115
Scas_536.1                                                            342   e-113
YPL274W (SAM3) [5177] chr16 (22938..24701) High affinity S-adeno...   348   e-112
YNL268W (LYP1) [4340] chr14 (138549..140384) High affinity lysin...   325   e-103
CAGL0J08162g complement(801555..803348) Highly similar to sp|P32...   321   e-102
Scas_706.36d                                                          318   e-101
YEL063C (CAN1) [1365] chr5 complement(31694..33466) Permease for...   318   e-101
AER405C [2905] [Homologous to ScYPL274W (SAM3) - NSH] (1413790.....   312   1e-99
KLLA0E16335g 1455271..1457088 gi|28565044|gb|AAO32605.1 Kluyvero...   309   3e-97
CAGL0J08184g 804507..806225 similar to sp|P04817 Saccharomyces c...   306   1e-96
Kwal_33.13411                                                         305   5e-96
Scas_706.37                                                           297   3e-93
KLLA0C02365g 208462..210201 similar to sp|P32487 Saccharomyces c...   298   3e-93
KLLA0C02343g complement(203552..205297) similar to sp|P04817 Sac...   297   5e-93
Kwal_33.13401                                                         296   1e-92
AFR667C [3860] [Homologous to ScYNL268W (LYP1) - SH] (1657064..1...   295   2e-92
CAGL0A01199g 121067..122908 similar to sp|P53388 Saccharomyces c...   295   8e-92
YPL265W (DIP5) [5186] chr16 (41043..42869) Dicarboxylic amino ac...   291   2e-90
AFR668W [3861] [Homologous to ScYEL063C (CAN1) - SH; ScYNL270C (...   287   2e-89
YNL270C (ALP1) [4339] chr14 complement(135939..137660) Arginine ...   287   3e-89
Scas_486.2                                                            278   1e-85
Scas_377.2                                                            273   8e-85
YOR348C (PUT4) [5125] chr15 complement(986894..988777) High affi...   276   2e-84
Kwal_33.15545                                                         274   3e-84
Scas_520.2*                                                           267   7e-84
Kwal_26.9612                                                          261   7e-80
KLLA0F27093g 2501049..2502740 similar to sp|P43548 Saccharomyces...   260   6e-79
Scas_84.1                                                             245   9e-78
CAGL0E05632g complement(556619..558415) similar to sp|P15380 Sac...   251   4e-75
Sklu_2438.14 YOR348C, Contig c2438 29357-31033                        248   1e-74
AFR156W [3348] [Homologous to ScYOR348C (PUT4) - NSH] complement...   246   1e-73
YFL055W (AGP3) [1629] chr6 (17004..18680) Amino acid permease fo...   244   4e-73
ACL135W [914] [Homologous to ScYPL265W (DIP5) - NSH] complement(...   245   5e-73
Kwal_26.6940                                                          241   6e-72
Kwal_23.2817                                                          241   7e-72
CAGL0M00154g 22039..23691 similar to sp|P32487 Saccharomyces cer...   238   9e-71
KLLA0B14685g complement(1289025..1290740) similar to sp|P15380 S...   232   2e-68
KLLA0F23419g complement(2187386..2189107) similar to sp|P15380 S...   229   4e-67
Kwal_8.590                                                            223   2e-64
Scas_552.3                                                            217   7e-63
Kwal_26.8097                                                          194   9e-55
Kwal_23.4026                                                          189   1e-52
Sklu_2365.9 YDR160W, Contig c2365 13522-15939                         188   7e-51
Scas_460.3                                                            182   9e-50
Scas_377.1                                                            166   2e-48
AAR038W [224] [Homologous to ScYBR132C (AGP2) - SH] complement(4...   176   4e-48
YBR132C (AGP2) [319] chr2 complement(499608..501398) Plasma memb...   177   5e-48
KLLA0C15873g 1381699..1383405 similar to sp|P38090 Saccharomyces...   175   1e-47
Kwal_23.3847                                                          170   1e-45
CAGL0C00539g 57784..59502 highly similar to sp|P38090 Saccharomy...   170   1e-45
KLLA0D16830g 1426856..1429354 similar to sp|Q03770 Saccharomyces...   167   1e-43
Kwal_53.19461                                                         157   3e-41
KLLA0B09922g complement(867748..870141) weakly similar to sp|Q03...   158   1e-40
Kwal_27.11900                                                         155   7e-40
CAGL0E01089g complement(96582..99143) similar to sp|Q03770 Sacch...   150   8e-38
Scas_619.2*                                                           145   1e-37
YDR160W (SSY1) [1002] chr4 (776157..778715) Component of an extr...   147   5e-37
AGL171W [4141] [Homologous to ScYDR160W (SSY1) - SH] complement(...   145   3e-36
Scas_682.30                                                           143   9e-36
Scas_485.4*                                                           122   1e-31
Scas_476.4                                                            122   1e-31
Scas_642.22                                                           121   5e-31
Sklu_2147.4 YKL174C, Contig c2147 6541-8247 reverse complement         46   5e-05
Scas_622.10                                                            45   1e-04
Kwal_33.13806                                                          45   2e-04
Scas_233.1                                                             40   0.001
Scas_689.19                                                            42   0.001
Sklu_2305.6 YGL077C, Contig c2305 10656-12281                          41   0.003
KLLA0A06666g complement(603169..604851) similar to sp|P36029 Sac...    40   0.006
YKL174C (YKL174C) [3097] chr11 complement(120385..122241) Member...    37   0.031
Scas_670.14                                                            37   0.031
CAGL0M08272g complement(823019..824884) highly similar to sp|P36...    35   0.14 
YHL036W (MUP3) [2250] chr8 (26239..27879) Low affinity methionin...    35   0.19 
KLLA0C15521g complement(1347098..1348741) similar to sp|P19807 S...    34   0.28 
CAGL0H03399g complement(316110..317780) highly similar to sp|P19...    33   0.49 
CAGL0B02838g complement(274984..276762) highly similar to sp|P50...    33   0.86 
AFR326W [3518] [Homologous to ScYDR011W (SNQ2 ) - NSH; ScYNR070W...    33   0.96 
YGL077C (HNM1) [1905] chr7 complement(362226..363917) Choline pe...    32   1.3  
Scas_720.18                                                            32   1.4  
AEL125C [2381] [Homologous to ScYKL174C - SH] (387763..389490) [...    32   1.5  
YGR055W (MUP1) [2018] chr7 (599419..601143) High-affinity methio...    31   3.5  
CAGL0E04004g complement(383385..384968) similar to sp|P38734 Sac...    30   4.8  
ACL073W [976] [Homologous to ScYHL036W (MUP3) - SH] complement(2...    30   5.7  

>YBR068C (BAP2) [258] chr2 complement(373821..375650) Branched-chain
           amino acid permease, also transports alanine and
           aromatic and sulfur containing amino acids [1830 bp, 609
           aa]
          Length = 609

 Score = 1233 bits (3189), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 599/599 (100%), Positives = 599/599 (100%)

Query: 1   MLSSEDFGSSGKKETSPDSISIRSFSAGNNFQSSSSEKTYSKQKSGSDKLIHRFADSFKR 60
           MLSSEDFGSSGKKETSPDSISIRSFSAGNNFQSSSSEKTYSKQKSGSDKLIHRFADSFKR
Sbjct: 1   MLSSEDFGSSGKKETSPDSISIRSFSAGNNFQSSSSEKTYSKQKSGSDKLIHRFADSFKR 60

Query: 61  AEGSTTRTKQINENTSDLEDGVESITSDSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKG 120
           AEGSTTRTKQINENTSDLEDGVESITSDSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKG
Sbjct: 61  AEGSTTRTKQINENTSDLEDGVESITSDSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKG 120

Query: 121 LHYGGPAALIIGYILVSFETYFMIQAAGEMAVTYPTLPANFNAYSSIFISKSFGFATVWL 180
           LHYGGPAALIIGYILVSFETYFMIQAAGEMAVTYPTLPANFNAYSSIFISKSFGFATVWL
Sbjct: 121 LHYGGPAALIIGYILVSFETYFMIQAAGEMAVTYPTLPANFNAYSSIFISKSFGFATVWL 180

Query: 181 YCFQWLTVLPLELITASMTIQFGNDKINPDIYILIFYVFLVFIHFFGVKAYGETEFIFNC 240
           YCFQWLTVLPLELITASMTIQFGNDKINPDIYILIFYVFLVFIHFFGVKAYGETEFIFNC
Sbjct: 181 YCFQWLTVLPLELITASMTIQFGNDKINPDIYILIFYVFLVFIHFFGVKAYGETEFIFNC 240

Query: 241 CKILMIAGFIILSIVINCGGAGNDGYIGATYWHNPGAFAGDTSIGRFKNVCYILVTAYFS 300
           CKILMIAGFIILSIVINCGGAGNDGYIGATYWHNPGAFAGDTSIGRFKNVCYILVTAYFS
Sbjct: 241 CKILMIAGFIILSIVINCGGAGNDGYIGATYWHNPGAFAGDTSIGRFKNVCYILVTAYFS 300

Query: 301 FGGMELFALSVQEQSNPRKSTPVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLMGAGGS 360
           FGGMELFALSVQEQSNPRKSTPVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLMGAGGS
Sbjct: 301 FGGMELFALSVQEQSNPRKSTPVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLMGAGGS 360

Query: 361 ATHASPYVLAASIHGVKIVPHIINAVILISVVSVANSSLYAGPRLICSLAQQGYAPKFLD 420
           ATHASPYVLAASIHGVKIVPHIINAVILISVVSVANSSLYAGPRLICSLAQQGYAPKFLD
Sbjct: 361 ATHASPYVLAASIHGVKIVPHIINAVILISVVSVANSSLYAGPRLICSLAQQGYAPKFLD 420

Query: 421 YVDREGRPLRALIVCCVFGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFR 480
           YVDREGRPLRALIVCCVFGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFR
Sbjct: 421 YVDREGRPLRALIVCCVFGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFR 480

Query: 481 QAMKVQGRSLDELGYKATTGIWGSIYGVFFNILVFVAQFWVALAPLGNGGKCDAESFFQN 540
           QAMKVQGRSLDELGYKATTGIWGSIYGVFFNILVFVAQFWVALAPLGNGGKCDAESFFQN
Sbjct: 481 QAMKVQGRSLDELGYKATTGIWGSIYGVFFNILVFVAQFWVALAPLGNGGKCDAESFFQN 540

Query: 541 YLAFPIWLAFYFGYMVYNRDFTLLNPLDKIDLDFHRRIYDPELMRQEDEENKEKLRNMS 599
           YLAFPIWLAFYFGYMVYNRDFTLLNPLDKIDLDFHRRIYDPELMRQEDEENKEKLRNMS
Sbjct: 541 YLAFPIWLAFYFGYMVYNRDFTLLNPLDKIDLDFHRRIYDPELMRQEDEENKEKLRNMS 599

>YDR046C (BAP3) [899] chr4 complement(548758..550572) Branched chain
           amino acid permease, also transports threonine, alanine
           and aromatic and sulfur containing amino acids [1815 bp,
           604 aa]
          Length = 604

 Score =  926 bits (2392), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 435/600 (72%), Positives = 513/600 (85%), Gaps = 11/600 (1%)

Query: 4   SEDFGSSGKKETSPDSISIRSFSAGNNFQSSSSEKTYSKQKSGSDK----LIHRFADSFK 59
           S+   +S K E S +   +   +  NNF +S++     + K  S++    L+HRF DSF+
Sbjct: 2   SDPIVTSSKMEKSAE-FEVTDSALYNNFNTSTTASLTPEIKEHSEESRNGLVHRFVDSFR 60

Query: 60  RAEGSTTRTKQINENTSDLEDGVESITSDSKLKKSMKSRHVVMMSLGTGIGTGLLVANAK 119
           RAE       Q  E  +DLEDG +S+ S++ LKKSMKSRHVVMMSLGTGIGTGLLVANAK
Sbjct: 61  RAE------SQRLEEDNDLEDGTKSMKSNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAK 114

Query: 120 GLHYGGPAALIIGYILVSFETYFMIQAAGEMAVTYPTLPANFNAYSSIFISKSFGFATVW 179
           GL   GP +L+IGY++VSF TYFM+QAAGEM VTYPTLP NFNAY+SIFISKSFGFAT W
Sbjct: 115 GLSLAGPGSLVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFISKSFGFATTW 174

Query: 180 LYCFQWLTVLPLELITASMTIQFGNDKINPDIYILIFYVFLVFIHFFGVKAYGETEFIFN 239
           L+C QWLTVLPLELIT+SMT+++ ND IN D++I+IFYVFL+FIHFFGVKAYGETEFIFN
Sbjct: 175 LFCIQWLTVLPLELITSSMTVKYWNDTINADVFIVIFYVFLLFIHFFGVKAYGETEFIFN 234

Query: 240 CCKILMIAGFIILSIVINCGGAGNDGYIGATYWHNPGAFAGDTSIGRFKNVCYILVTAYF 299
            CKILM+AGFIILS+VINCGGAG DGYIG  YW +PG+FA  +   RFK +CYILV+AYF
Sbjct: 235 SCKILMVAGFIILSVVINCGGAGVDGYIGGKYWRDPGSFAEGSGATRFKGICYILVSAYF 294

Query: 300 SFGGMELFALSVQEQSNPRKSTPVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLMGAGG 359
           SFGG+ELF LS+ EQSNPRKSTPVAAKRS+YRI++IYLLTMILIGFNVP+N+DQLMG+GG
Sbjct: 295 SFGGIELFVLSINEQSNPRKSTPVAAKRSVYRILIIYLLTMILIGFNVPHNNDQLMGSGG 354

Query: 360 SATHASPYVLAASIHGVKIVPHIINAVILISVVSVANSSLYAGPRLICSLAQQGYAPKFL 419
           SATHASPYVLAASIH V+++PHIINAVILISV+SVANS+LYA PRL+CSLAQQGYAPKFL
Sbjct: 355 SATHASPYVLAASIHKVRVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPKFL 414

Query: 420 DYVDREGRPLRALIVCCVFGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRF 479
           +Y+DREGRPLRAL+VC + GV+ FVA S +EE  FTWLAAIAGLSELFTW+ IMLSH+RF
Sbjct: 415 NYIDREGRPLRALVVCSLVGVVGFVACSPQEEQAFTWLAAIAGLSELFTWSGIMLSHIRF 474

Query: 480 RQAMKVQGRSLDELGYKATTGIWGSIYGVFFNILVFVAQFWVALAPLGNGGKCDAESFFQ 539
           R+AMKVQGRSLDE+GYKA TGIWGS YGVFFN+LVF+AQFWVAL+P+GNGGKCDA++FF+
Sbjct: 475 RKAMKVQGRSLDEVGYKANTGIWGSYYGVFFNMLVFMAQFWVALSPIGNGGKCDAQAFFE 534

Query: 540 NYLAFPIWLAFYFGYMVYNRDFTLLNPLDKIDLDFHRRIYDPELMRQEDEENKEKLRNMS 599
           +YLA P+W+  Y GYMVY RDFT LNPLDKIDLDFHRR+YDPE+MRQEDEENKE+L+N S
Sbjct: 535 SYLAAPLWIFMYVGYMVYKRDFTFLNPLDKIDLDFHRRVYDPEIMRQEDEENKERLKNSS 594

>Scas_569.5
          Length = 593

 Score =  893 bits (2307), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 425/550 (77%), Positives = 484/550 (88%), Gaps = 9/550 (1%)

Query: 50  LIHRFADSFKRAEGSTTRTKQINENTSDLEDGVESITSDSKLKKSMKSRHVVMMSLGTGI 109
           L+HRF DSFKRA+ ST       EN  DLEDG + +   S LKK+MKSRHV+MM +GTGI
Sbjct: 43  LVHRFVDSFKRAQDST-------EN--DLEDGTKPLGDASHLKKAMKSRHVIMMCVGTGI 93

Query: 110 GTGLLVANAKGLHYGGPAALIIGYILVSFETYFMIQAAGEMAVTYPTLPANFNAYSSIFI 169
           GTGLLVANA GL YGGP +L+IGY+LVSF TYFMIQAAGEMAV YPTLP NFN+Y+S+FI
Sbjct: 94  GTGLLVANASGLSYGGPGSLVIGYVLVSFVTYFMIQAAGEMAVAYPTLPGNFNSYTSMFI 153

Query: 170 SKSFGFATVWLYCFQWLTVLPLELITASMTIQFGNDKINPDIYILIFYVFLVFIHFFGVK 229
           SK FGFATVWL+  QWLTV PLELITAS+TI++ NDKIN D++I+IFYVFL+FIHFFGVK
Sbjct: 154 SKPFGFATVWLFFIQWLTVFPLELITASLTIKYWNDKINADVFIVIFYVFLLFIHFFGVK 213

Query: 230 AYGETEFIFNCCKILMIAGFIILSIVINCGGAGNDGYIGATYWHNPGAFAGDTSIGRFKN 289
           AYGE EFIFN CK+LMIAGFIILSIVINCGGAG DGYIGA YW +PG+FA   S+ +FK 
Sbjct: 214 AYGEAEFIFNSCKVLMIAGFIILSIVINCGGAGKDGYIGAKYWRDPGSFAEGDSVEKFKG 273

Query: 290 VCYILVTAYFSFGGMELFALSVQEQSNPRKSTPVAAKRSIYRIVVIYLLTMILIGFNVPY 349
           +CYILVTAYFS+GG ELF+LSV EQ NPRKSTP AAK+SIYRI++IYLLTMILIGFNVP+
Sbjct: 274 ICYILVTAYFSYGGAELFSLSVNEQENPRKSTPQAAKQSIYRILIIYLLTMILIGFNVPH 333

Query: 350 NDDQLMGAGGSATHASPYVLAASIHGVKIVPHIINAVILISVVSVANSSLYAGPRLICSL 409
           N+DQLMG+GGSATHASPYVLAASIHGVK+VPH INAVILISV+SVANS+LYA PRL+CSL
Sbjct: 334 NNDQLMGSGGSATHASPYVLAASIHGVKVVPHFINAVILISVISVANSALYASPRLMCSL 393

Query: 410 AQQGYAPKFLDYVDREGRPLRALIVCCVFGVIAFVAASSKEEIVFTWLAAIAGLSELFTW 469
           A+QGYAPKFLDYVDREGRPLRALI+C VFGVI FV+ASSKEE VFTWLAAIAGLSELFTW
Sbjct: 394 AEQGYAPKFLDYVDREGRPLRALILCAVFGVIGFVSASSKEEEVFTWLAAIAGLSELFTW 453

Query: 470 TSIMLSHLRFRQAMKVQGRSLDELGYKATTGIWGSIYGVFFNILVFVAQFWVALAPLGNG 529
           + IMLSH+RFRQ MK+ GRS +E+G++A TGIWGS+YG+ FN+LVF+AQFWVALAP    
Sbjct: 454 SGIMLSHVRFRQCMKLHGRSEEEIGFRAVTGIWGSMYGISFNMLVFIAQFWVALAPPSLH 513

Query: 530 GKCDAESFFQNYLAFPIWLAFYFGYMVYNRDFTLLNPLDKIDLDFHRRIYDPELMRQEDE 589
           GK DAESFFQ+YLA PIWL FYFGYM+Y RDFT L PLDKIDL+FHRRIYDPEL+RQEDE
Sbjct: 514 GKVDAESFFQSYLAAPIWLFFYFGYMLYKRDFTFLVPLDKIDLNFHRRIYDPELIRQEDE 573

Query: 590 ENKEKLRNMS 599
           ENKEK++N S
Sbjct: 574 ENKEKIKNSS 583

>CAGL0L07546g complement(831824..833728) highly similar to sp|P38084
           Saccharomyces cerevisiae YBR068c BAP2 or sp|P41815
           Saccharomyces cerevisiae YDR046c PAP1, start by
           similarity
          Length = 634

 Score =  891 bits (2303), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 435/619 (70%), Positives = 512/619 (82%), Gaps = 24/619 (3%)

Query: 5   EDFGSSGKKETSPDSISIRSFSAGNNFQSSSSEKTYSKQKSGSD--------KLIHRFAD 56
           +++GSS KKE++ +  +I  +S  +  + + +   YS++ S +         KL+HRF D
Sbjct: 6   KNYGSSSKKESTAEEFTIPEYSRDDGEKYAGNSNDYSQRDSDNTSIESEPRTKLVHRFVD 65

Query: 57  SFKRAEGSTT--RTKQI------------NENTSDLE-DGVESITSDSKLKKSMKSRHVV 101
           SFKRA+   T  ++K+I             E++ DLE    +SI +++ LKK+MKSRHV+
Sbjct: 66  SFKRAQDVPTGRKSKEIGNNGGSKTKGGFEEDSLDLEGSDHDSIITNTHLKKAMKSRHVM 125

Query: 102 MMSLGTGIGTGLLVANAKGLHYGGPAALIIGYILVSFETYFMIQAAGEMAVTYPTLPANF 161
           MMSLGTGIGTGLLVANAKGLH+GGPAAL+IGY+LVSF TYFMIQAAGEMAVTYPTLP NF
Sbjct: 126 MMSLGTGIGTGLLVANAKGLHFGGPAALVIGYVLVSFVTYFMIQAAGEMAVTYPTLPGNF 185

Query: 162 NAYSSIFISKSFGFATVWLYCFQWLTVLPLELITASMTIQFGNDKINPDIYILIFYVFLV 221
           NAYSSIF+S +FGFATVW++C QWLTVLPLELITAS+TI++ NDKIN D++I+IFYVFL+
Sbjct: 186 NAYSSIFVSNAFGFATVWIFCIQWLTVLPLELITASLTIKYWNDKINADVFIVIFYVFLL 245

Query: 222 FIHFFG-VKAYGETEFIFNCCKILMIAGFIILSIVINCGGAGNDGYIGATYWHNPGAFAG 280
            IH FG V AYGETEF+FN CKILM+ GFII+SIVIN GGAGN  YIG  +WH+PGAFAG
Sbjct: 246 CIHLFGGVIAYGETEFLFNLCKILMVIGFIIMSIVINAGGAGNREYIGGKFWHDPGAFAG 305

Query: 281 DTSIGRFKNVCYILVTAYFSFGGMELFALSVQEQSNPRKSTPVAAKRSIYRIVVIYLLTM 340
            T+  RFK +CY+LV+ YFS+GG ELFALSV EQSNPR+STP A+K S+YRI++IYLLTM
Sbjct: 306 KTAGSRFKGICYVLVSGYFSYGGTELFALSVNEQSNPRRSTPQASKSSLYRILIIYLLTM 365

Query: 341 ILIGFNVPYNDDQLMGAGGSATHASPYVLAASIHGVKIVPHIINAVILISVVSVANSSLY 400
           ILIGFNVPY+ D+LMG+GGSATHASPYVLAAS++GVKI PH INAVILISV+SVANSSLY
Sbjct: 366 ILIGFNVPYDSDELMGSGGSATHASPYVLAASLNGVKIAPHFINAVILISVISVANSSLY 425

Query: 401 AGPRLICSLAQQGYAPKFLDYVDREGRPLRALIVCCVFGVIAFVAASSKEEIVFTWLAAI 460
           A PRL+CSLAQQGYAPKFLDYVDR+GRPL ALI C + GVI FVAAS KEE VFTWLAAI
Sbjct: 426 AAPRLMCSLAQQGYAPKFLDYVDRQGRPLLALIACLLVGVIGFVAASPKEEEVFTWLAAI 485

Query: 461 AGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGYKATTGIWGSIYGVFFNILVFVAQFW 520
           AGLSELFTW+SIMLSH+RFR AMK+Q RSL+ELGYKATTGI+GSIYGV FN+LVF AQFW
Sbjct: 486 AGLSELFTWSSIMLSHVRFRMAMKLQNRSLEELGYKATTGIYGSIYGVCFNLLVFAAQFW 545

Query: 521 VALAPLGNGGKCDAESFFQNYLAFPIWLAFYFGYMVYNRDFTLLNPLDKIDLDFHRRIYD 580
            AL P G  GK +A SFF NYLA PIWL FYFGYM++ RDF LL PLDKIDLDFHRRIYD
Sbjct: 546 TALFPFGGDGKANANSFFANYLAMPIWLVFYFGYMLWTRDFQLLKPLDKIDLDFHRRIYD 605

Query: 581 PELMRQEDEENKEKLRNMS 599
           PELMRQEDEE+KE+LRN S
Sbjct: 606 PELMRQEDEESKERLRNGS 624

>Scas_718.42
          Length = 595

 Score =  877 bits (2267), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/589 (71%), Positives = 487/589 (82%), Gaps = 8/589 (1%)

Query: 9   SSGKKETSPDSISIRSFSAGNNFQSSSSEKTYSKQKSGSDKLIHRFADSFKRAEGSTTRT 68
           SS K ETSP+  SI S +      +   E              +RF DSFKRAE      
Sbjct: 3   SSKKNETSPEVNSITSSTLKTPNVTEKFEPYPDTTAVKHRTHFNRFVDSFKRAE------ 56

Query: 69  KQINENTSDLEDGVESITSDSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAA 128
             +N N  DLEDG  SI SD  LKK+MKSRHV+MMSLGTGIGTGLLVANAKGL+  GPA+
Sbjct: 57  --VNHNGIDLEDGTNSIQSDDNLKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAGPAS 114

Query: 129 LIIGYILVSFETYFMIQAAGEMAVTYPTLPANFNAYSSIFISKSFGFATVWLYCFQWLTV 188
           L+IGY +VSF TYF+IQAAGEMAVTYPTLP  FN Y+SIF+SK FGFATVWL+C QWLTV
Sbjct: 115 LVIGYFMVSFITYFVIQAAGEMAVTYPTLPGGFNNYASIFVSKPFGFATVWLFCIQWLTV 174

Query: 189 LPLELITASMTIQFGNDKINPDIYILIFYVFLVFIHFFGVKAYGETEFIFNCCKILMIAG 248
           LPLELITASMTI++ NDKIN D++++I YVFL+FIHFFGV+AYGE EFIFN CKILMI G
Sbjct: 175 LPLELITASMTIKYWNDKINADVFVVILYVFLLFIHFFGVRAYGEAEFIFNSCKILMIGG 234

Query: 249 FIILSIVINCGGAGNDGYIGATYWHNPGAFAGDTSIGRFKNVCYILVTAYFSFGGMELFA 308
           F+ILSIV+NCGGAG DGYIG  YW +PGAFA D +  RFK V ++LVTAYFS+GG+ELFA
Sbjct: 235 FVILSIVVNCGGAGVDGYIGGKYWRDPGAFASDNAASRFKGVAFVLVTAYFSYGGVELFA 294

Query: 309 LSVQEQSNPRKSTPVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLMGAGGSATHASPYV 368
           LSV EQ NPR+STP AAK+SIYRI++IYLLTMILIGFNVP+N DQLMGAGGSATHASPYV
Sbjct: 295 LSVNEQENPRRSTPAAAKQSIYRILIIYLLTMILIGFNVPHNSDQLMGAGGSATHASPYV 354

Query: 369 LAASIHGVKIVPHIINAVILISVVSVANSSLYAGPRLICSLAQQGYAPKFLDYVDREGRP 428
           LA SIHGVK+VPHIINAVILISV SVANS+LYA PRL+ SLA+QGYAPK+ +YVDREGRP
Sbjct: 355 LAVSIHGVKVVPHIINAVILISVTSVANSALYASPRLLRSLAEQGYAPKYFNYVDREGRP 414

Query: 429 LRALIVCCVFGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGR 488
           LRALI+C +FGVIAF A S +EE++FTWLAAIAGLSELFTW+SI+LSH+RFR AMK QG+
Sbjct: 415 LRALILCSIFGVIAFCACSDQEEVIFTWLAAIAGLSELFTWSSILLSHVRFRLAMKAQGK 474

Query: 489 SLDELGYKATTGIWGSIYGVFFNILVFVAQFWVALAPLGNGGKCDAESFFQNYLAFPIWL 548
           SL+ELGY + TGIWGS+YG FFN+LVF+AQFWVAL+P G+ G   AE+FF++YLAFP+WL
Sbjct: 475 SLNELGYISITGIWGSLYGCFFNVLVFIAQFWVALSPPGSKGVYSAEAFFESYLAFPVWL 534

Query: 549 AFYFGYMVYNRDFTLLNPLDKIDLDFHRRIYDPELMRQEDEENKEKLRN 597
            FY GYM+Y+RDFT L  L KIDLD HRR+YDPEL+RQEDEE KE++RN
Sbjct: 535 FFYLGYMLYSRDFTFLTDLKKIDLDNHRRLYDPELLRQEDEETKERIRN 583

>CAGL0H08393g 821998..823836 highly similar to sp|P41815
           Saccharomyces cerevisiae YDR046c PAP1, hypothetical
           start
          Length = 612

 Score =  811 bits (2095), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/553 (69%), Positives = 456/553 (82%), Gaps = 12/553 (2%)

Query: 48  DKLIHRFADSFKRAEGSTTRTKQINENTSDLEDGVESITSDSKLKKSMKSRHVVMMSLGT 107
           ++ +  F DSFKRA+ S         + +DLE   ++ T+  + KK+MKSRHV+MMSLGT
Sbjct: 61  NRHLQGFIDSFKRADDS--------PDHNDLE---KTTTAHQEQKKTMKSRHVIMMSLGT 109

Query: 108 GIGTGLLVANAKGLHYGGPAALIIGYILVSFETYFMIQAAGEMAVTYPTLPANFNAYSSI 167
           GIGTGLLV+N KGL   GPA+L+I Y LVSF TYFMIQAAGEMAVTYPTLP +FNAY+S 
Sbjct: 110 GIGTGLLVSNGKGLSLAGPASLVIAYGLVSFVTYFMIQAAGEMAVTYPTLPGSFNAYTSF 169

Query: 168 FISKSFGFATVWLYCFQWLTVLPLELITASMTIQFGNDKINPDIYILIFYVFLVFIHFFG 227
           FISK FGFAT WL+C QWLTVLPLELITA+MTI++ N  I+PD++++IFYVFL+FIHFFG
Sbjct: 170 FISKPFGFATTWLFCIQWLTVLPLELITAAMTIKYWNTSIDPDVFVIIFYVFLMFIHFFG 229

Query: 228 VKAYGETEFIFNCCKILMIAGFIILSIVINCGGAGNDGYIGATYWHNPGAFAGDTSIGRF 287
           V+AYGETEFIFN CKILMI GFII +IV+NCGGAG DGYIG  YWH+PGAFA      RF
Sbjct: 230 VQAYGETEFIFNACKILMIGGFIIFAIVVNCGGAGKDGYIGGKYWHDPGAFASSNGASRF 289

Query: 288 KNVCYILVTAYFSFGGMELFALSVQEQSNPRKSTPVAAKRSIYRIVVIYLLTMILIGFNV 347
           K +CY LV AYFS+GG ELF LSV +Q NPRKSTP AAK ++YRIVVIYLLTMILIGF V
Sbjct: 290 KGICYNLVNAYFSYGGNELFVLSVNDQKNPRKSTPAAAKSNVYRIVVIYLLTMILIGFVV 349

Query: 348 PYNDDQLMGA-GGSATHASPYVLAASIHGVKIVPHIINAVILISVVSVANSSLYAGPRLI 406
           P+N  +L+GA GG+  HASPYVLAASIHG+K+VPHIINAVILI+++SVANSSLYAGPRL+
Sbjct: 350 PHNSSELLGASGGNGLHASPYVLAASIHGIKVVPHIINAVILIALISVANSSLYAGPRLL 409

Query: 407 CSLAQQGYAPKFLDYVDREGRPLRALIVCCVFGVIAFVAASSKEEIVFTWLAAIAGLSEL 466
            SLAQQGYAP+FL YVDR GRPL AL++  + GVI F A S +EE VFTWLAAI+GLSEL
Sbjct: 410 SSLAQQGYAPRFLSYVDRRGRPLTALLLSALVGVIGFAATSPREEEVFTWLAAISGLSEL 469

Query: 467 FTWTSIMLSHLRFRQAMKVQGRSLDELGYKATTGIWGSIYGVFFNILVFVAQFWVALAPL 526
           FTWTSIM SH+RFR+AMK+Q +SLD LGYKA TG+WGS +GV FNILVF AQFWVAL+P 
Sbjct: 470 FTWTSIMFSHIRFRRAMKLQNKSLDTLGYKANTGLWGSYFGVGFNILVFAAQFWVALSPP 529

Query: 527 GNGGKCDAESFFQNYLAFPIWLAFYFGYMVYNRDFTLLNPLDKIDLDFHRRIYDPELMRQ 586
            +GGKCDA SFF +YLA PIWL FYFGYM + +DFT+L  L+++DLD HR++YDPE +RQ
Sbjct: 530 NSGGKCDANSFFASYLAMPIWLVFYFGYMCWYKDFTVLTDLNQVDLDNHRKVYDPEFLRQ 589

Query: 587 EDEENKEKLRNMS 599
           ED ENKE+LRN S
Sbjct: 590 EDLENKERLRNSS 602

>AGR038C [4348] [Homologous to ScYDR046C (BAP3) - SH; ScYBR068C
           (BAP2) - SH] (777535..779277) [1743 bp, 580 aa]
          Length = 580

 Score =  764 bits (1973), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/577 (61%), Positives = 450/577 (77%), Gaps = 13/577 (2%)

Query: 21  SIRSFSAGNNFQSSSSEKTYSKQKSGSDKLIHRFADSFKRAEGSTTRTKQINENTSDLED 80
           S+  F+     Q++ S    S + +G      RF DSF+R + S          + DLED
Sbjct: 5   SVNKFNEKTVVQTAYSPSYASPESTGP---FRRFVDSFRREDTS---------RSGDLED 52

Query: 81  GVESITSDSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALIIGYILVSFET 140
           G  + T  +KL++ M++RHVVMMSLGTGIGTGLLVANA  LHYGGPA L+IGY+LVS  +
Sbjct: 53  GEINSTDTTKLQQRMRTRHVVMMSLGTGIGTGLLVANAASLHYGGPAGLLIGYLLVSIVS 112

Query: 141 YFMIQAAGEMAVTYPTLPANFNAYSSIFISKSFGFATVWLYCFQWLTVLPLELITASMTI 200
           Y M+ AAGEMAV YPTLP NFNAYSSIFISK FGFATVWL+C QWLTV PLELITA++ I
Sbjct: 113 YIMMHAAGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCLQWLTVFPLELITATIVI 172

Query: 201 QFGNDKINPDIYILIFYVFLVFIHFFGVKAYGETEFIFNCCKILMIAGFIILSIVINCGG 260
           ++    +N +++++IFY+F++ IHFFG + YGETEFIFN CK+LMI GF+I+ I+IN G 
Sbjct: 173 KYWKVSVNANVFVVIFYLFIICIHFFGARGYGETEFIFNMCKVLMIVGFVIVGILINVGA 232

Query: 261 AGNDGYIGATYWHNPGAFAGDTSIGRFKNVCYILVTAYFSFGGMELFALSVQEQSNPRKS 320
            G+ GYIG  YW NPG+F   T + + K   Y+LVTAYFSFGGMEL+ALSV E  NP+ +
Sbjct: 233 IGDTGYIGDRYWRNPGSFVSGTPLDKLKGTAYVLVTAYFSFGGMELYALSVNELPNPKTA 292

Query: 321 TPVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLMGAGGSATHASPYVLAASIHGVKIVP 380
            P A K+ +YRI+++YLLTMI+IGF VP++ D+LMG+G +  H SPYVLA  +HGVK++P
Sbjct: 293 IPSACKKGVYRILLVYLLTMIMIGFLVPHDSDRLMGSGSNDVHPSPYVLAIEMHGVKVLP 352

Query: 381 HIINAVILISVVSVANSSLYAGPRLICSLAQQGYAPKFLDYVDREGRPLRALIVCCVFGV 440
           HI+NAVILISV+SV NS++Y+ PRL+C+LAQQGYAPK LDY+DREGRPL +LI+C +FG+
Sbjct: 353 HIVNAVILISVISVGNSAMYSAPRLLCALAQQGYAPKQLDYIDREGRPLISLILCAIFGL 412

Query: 441 IAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGYKATTG 500
           IAF AAS  +E +F WLAAIAGLSELFTWTSI LSH RFRQAMK+QGRSL+ LGY+A TG
Sbjct: 413 IAFSAASDNQEKIFIWLAAIAGLSELFTWTSICLSHFRFRQAMKLQGRSLETLGYRAITG 472

Query: 501 IWGSIYGVFFNILVFVAQFWVALAPLGNGGKCDAESFFQNYLAFPIWLAFYFGYMVYNRD 560
            WGS+Y VFFN+LVF+AQFWVAL P+    K D  SFFQNY+AFP+WL  + GYMVY+R+
Sbjct: 473 QWGSLYAVFFNLLVFIAQFWVALVPIAK-KKVDVLSFFQNYMAFPLWLIMFLGYMVYSRN 531

Query: 561 FTLLNPLDKIDLDFHRRIYDPELMRQEDEENKEKLRN 597
           +TLLNPLDK+DLD HRR+YD E+++QE+ E KE++RN
Sbjct: 532 WTLLNPLDKMDLDTHRRVYDVEVLKQEEYEFKERMRN 568

>Kwal_27.10538
          Length = 602

 Score =  735 bits (1897), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/549 (64%), Positives = 433/549 (78%), Gaps = 8/549 (1%)

Query: 53  RFADSFKRAEGSTTRTKQINENTSDLEDGV-ESITSDSKLKKSMKSRHVVMMSLGTGIGT 111
           RF +SFKRAE  +T       +  DLE     S+ S S LK+S+K RHV MMS+ TGIGT
Sbjct: 50  RFVNSFKRAEKHST------PSNGDLEHATTHSVASSSPLKRSIKPRHVAMMSICTGIGT 103

Query: 112 GLLVANAKGLHYGGPAALIIGYILVSFETYFMIQAAGEMAVTYPTLPANFNAYSSIFISK 171
           GLLVAN K L +GGPA LIIGY  VS   Y M+QAAGEMAV YP+LP NFNAYSS  IS+
Sbjct: 104 GLLVANGKSLRFGGPAGLIIGYAAVSVVAYIMMQAAGEMAVAYPSLPGNFNAYSSQLISR 163

Query: 172 SFGFATVWLYCFQWLTVLPLELITASMTIQFGNDKINPDIYILIFYVFLVFIHFFGVKAY 231
            FGFATVWLYC QWLTVLPLELITAS+TI++ ND IN D++I IFYVF++FIHFFG + Y
Sbjct: 164 PFGFATVWLYCIQWLTVLPLELITASLTIKYWNDSINADVFIAIFYVFILFIHFFGSRGY 223

Query: 232 GETEFIFNCCKILMIAGFIILSIVINCGGAGNDGYIGATYWHNPGAFAGDTSIGRFKNVC 291
           GE+EFIF  CK+LMI GF+ILSIVINCGGAG+  YIGA YW++PGAFA  +   +FK V 
Sbjct: 224 GESEFIFGICKVLMIIGFVILSIVINCGGAGDRKYIGAKYWYDPGAFAVGSGATKFKGVA 283

Query: 292 YILVTAYFSFGGMELFALSVQEQSNPRKSTPVAAKRSIYRIVVIYLLTMILIGFNVPYND 351
           Y+LVT YFS+GG EL+A++V EQSNPR++     K+ IYRI++IY+LTMILIGF VP+  
Sbjct: 284 YVLVTGYFSYGGTELYAMTVNEQSNPRRAIQSITKQCIYRILLIYMLTMILIGFLVPHTS 343

Query: 352 DQLMGAGG-SATHASPYVLAASIHGVKIVPHIINAVILISVVSVANSSLYAGPRLICSLA 410
            +LMG+ G SATHASPYVLA S+HGVKIVPHIINAVILI+V+SV NS++Y+GPR++ +LA
Sbjct: 344 SELMGSSGKSATHASPYVLAVSLHGVKIVPHIINAVILIAVISVGNSAMYSGPRILNTLA 403

Query: 411 QQGYAPKFLDYVDREGRPLRALIVCCVFGVIAFVAASSKEEIVFTWLAAIAGLSELFTWT 470
           +QGYAP+FL YVDR GRPL ALI C VFG++AFVAAS  EE VFTWLAAIAGLSELFTW+
Sbjct: 404 EQGYAPRFLAYVDRAGRPLVALIACSVFGLLAFVAASDCEEDVFTWLAAIAGLSELFTWS 463

Query: 471 SIMLSHLRFRQAMKVQGRSLDELGYKATTGIWGSIYGVFFNILVFVAQFWVALAPLGNGG 530
           +IMLSH+RFRQAM+   R L ELGYKA TG+ GS+ G+ FNILVF+AQFWV++AP G  G
Sbjct: 464 AIMLSHVRFRQAMRYNNRPLSELGYKANTGVLGSVLGLSFNILVFIAQFWVSIAPFGKDG 523

Query: 531 KCDAESFFQNYLAFPIWLAFYFGYMVYNRDFTLLNPLDKIDLDFHRRIYDPELMRQEDEE 590
           K D  SFFQ+YLAFP+W+  +FGYM+  R++ ++ PL  IDLD +R IYD + + QED E
Sbjct: 524 KLDVLSFFQSYLAFPLWVVLFFGYMIVFRNWEIIKPLKDIDLDHYRSIYDQDRLYQEDLE 583

Query: 591 NKEKLRNMS 599
           +K  ++N S
Sbjct: 584 HKILIQNSS 592

>CAGL0K05753g 564282..566264 highly similar to sp|P48813
           Saccharomyces cerevisiae YDR508c GNP1, start by
           similarity
          Length = 660

 Score =  681 bits (1758), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/617 (54%), Positives = 424/617 (68%), Gaps = 30/617 (4%)

Query: 5   EDFGSSGKKETSPDSISIRSFSAGNNFQSSSSEKTYSKQKSGSDKL----IHRFADSFKR 60
           ++ GS  +  T+    ++  F   N    +  EK  S  + G D++    I RF DSFKR
Sbjct: 38  DNLGSGSRGATTS---AVEYFDKENVDGVNIDEKLQSTTEFGGDEMPRGNIRRFIDSFKR 94

Query: 61  AEGSTTRTKQINENTSDLEDGVESITS--------------------DSKLKKSMKSRHV 100
           AE    +   + E   DLE+ + +  S                    +  LKKS+K RHV
Sbjct: 95  AEQQPNQQHNLAE---DLENDLTTAISMNSLDRVQNKPTGNGQMKFEEEALKKSIKPRHV 151

Query: 101 VMMSLGTGIGTGLLVANAKGLHYGGPAALIIGYILVSFETYFMIQAAGEMAVTYPTLPAN 160
           VM+SLGTGIGTGLLV NAK LH  GPA L+IGY ++    Y +IQAAGEMAV Y  L   
Sbjct: 152 VMISLGTGIGTGLLVGNAKALHNAGPAGLVIGYAIMGSCIYCIIQAAGEMAVVYSNLLGG 211

Query: 161 FNAYSSIFISKSFGFATVWLYCFQWLTVLPLELITASMTIQFGNDKINPDIYILIFYVFL 220
           FN Y S+ +   FGFA  W+YC QWL V PLEL+T S+TI++    +NPD +++IFYV +
Sbjct: 212 FNTYPSMLVDPGFGFAVAWVYCLQWLCVCPLELVTTSLTIKYWTTTVNPDAFVVIFYVVI 271

Query: 221 VFIHFFGVKAYGETEFIFNCCKILMIAGFIILSIVINCGGAGNDGYIGATYWHNPGAFAG 280
           +FI  FG + Y E EF FNCCKILMI GF IL I+IN GGAGNDGY+GA YWH+PGAF G
Sbjct: 272 IFIQIFGARGYAEAEFFFNCCKILMIIGFYILGIIINAGGAGNDGYLGAKYWHDPGAFRG 331

Query: 281 DTSIGRFKNVCYILVTAYFSFGGMELFALSVQEQSNPRKSTPVAAKRSIYRIVVIYLLTM 340
              I RFK +    V+A F+FG  E  AL+  EQSNPRK+ P AAK+ +YR++ I++ T+
Sbjct: 332 TNGIQRFKGIMATFVSAAFAFGATEFIALTAAEQSNPRKAIPSAAKKVLYRVICIFVGTI 391

Query: 341 ILIGFNVPYNDDQLMGAGGSATHASPYVLAASIHGVKIVPHIINAVILISVVSVANSSLY 400
            L+GF VP++ DQLMGAGGSAT ASPYVLA SIHGV++VPH INAVILISV SVANS+ Y
Sbjct: 392 ALLGFLVPWDSDQLMGAGGSATKASPYVLAISIHGVRVVPHFINAVILISVFSVANSAFY 451

Query: 401 AGPRLICSLAQQGYAPKFLDYVDREGRPLRALIVCCVFGVIAFVAASSKEEIVFTWLAAI 460
           +  RL+  LAQQGYAPKF DYVDR+GRP RA+    +FGVIAF AAS KE+ VFTWL AI
Sbjct: 452 SSSRLLLGLAQQGYAPKFFDYVDRQGRPFRAMCCAALFGVIAFCAASPKEDQVFTWLLAI 511

Query: 461 AGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGYKATTGIWGSIYGVFFNILVFVAQFW 520
           +GLS+LFTW +I +SH+RFR+AM VQGRSL E+G+KA  G++GS Y     +L  +AQFW
Sbjct: 512 SGLSQLFTWIAICVSHIRFRRAMTVQGRSLGEIGFKAQLGVYGSYYATIMMVLALIAQFW 571

Query: 521 VALAPLGNGGKCDAESFFQNYLAFPIWLAFYFGYMVYNRDFTLLNPLDKIDLDFHRRIYD 580
           VA+AP+GN G  DAE FF+NYLA PI +AFYFGY ++ RD+ L      IDLD +R+++D
Sbjct: 572 VAIAPIGNNGDLDAEGFFENYLAMPILIAFYFGYKLWKRDWRLFIRAKDIDLDSYRQVFD 631

Query: 581 PELMRQEDEENKEKLRN 597
            EL++QEDEE KEKL+N
Sbjct: 632 EELLKQEDEEYKEKLKN 648

>YDR508C (GNP1) [1322] chr4 complement(1466441..1468432) High
           affinity glutamine permease, may also transports
           leucine, cysteine, methionine, serine, threonine and
           asparagine, member of the amino acid-polyamine-choline
           (APC) family of membrane transporters [1992 bp, 663 aa]
          Length = 663

 Score =  670 bits (1728), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/626 (52%), Positives = 419/626 (66%), Gaps = 33/626 (5%)

Query: 5   EDFGSSGKKETSPDSISIRSFSAGNNFQ--SSSSEKTYSKQKSGSD---KLIHRFADSFK 59
           +D      KE  P    I S    N  +    + EKT    +   +     + RF DSF+
Sbjct: 26  DDVSHYEMKEIQPKEKQIGSIEPENEVEYFEKTVEKTIENMEYEGEHHASYLRRFIDSFR 85

Query: 60  RAEGSTTRT----------------------KQINENTSDLE-DGV-----ESITSDSKL 91
           RAEGS   +                       ++N  +S +  DG+     E       L
Sbjct: 86  RAEGSHANSPDSSNSNGTTPISTKDSSSQLDNELNRKSSYITVDGIKQSPQEQEQKQENL 145

Query: 92  KKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALIIGYILVSFETYFMIQAAGEMA 151
           KKS+K RH VMMSLGTGIGTGLLV N+K L+  GP  LIIGY ++    Y +IQA GE+A
Sbjct: 146 KKSIKPRHTVMMSLGTGIGTGLLVGNSKVLNNAGPGGLIIGYAIMGSCVYCIIQACGELA 205

Query: 152 VTYPTLPANFNAYSSIFISKSFGFATVWLYCFQWLTVLPLELITASMTIQFGNDKINPDI 211
           V Y  L   FN Y    +  + GF+  WL+C QWL V PLEL+TASMTI++    +NPD+
Sbjct: 206 VIYSDLIGGFNTYPLFLVDPALGFSVAWLFCLQWLCVCPLELVTASMTIKYWTTSVNPDV 265

Query: 212 YILIFYVFLVFIHFFGVKAYGETEFIFNCCKILMIAGFIILSIVINCGGAGNDGYIGATY 271
           +++IFYV +V I+ FG K Y E +F FNCCKILMI GF IL+I+I+CGGAG DGYIG+ Y
Sbjct: 266 FVVIFYVLIVVINVFGAKGYAEADFFFNCCKILMIVGFFILAIIIDCGGAGTDGYIGSKY 325

Query: 272 WHNPGAFAGDTSIGRFKNVCYILVTAYFSFGGMELFALSVQEQSNPRKSTPVAAKRSIYR 331
           W +PGAF GDT I RFK V    VTA F+FG  E  A++  EQSNPRK+ P AAK+ IYR
Sbjct: 326 WRDPGAFRGDTPIQRFKGVVATFVTAAFAFGMSEQLAMTASEQSNPRKAIPSAAKKMIYR 385

Query: 332 IVVIYLLTMILIGFNVPYNDDQLMGAGGSATHASPYVLAASIHGVKIVPHIINAVILISV 391
           I+ ++L ++ L+GF VPY  DQL+GA GSAT ASPYV+A S HGV++VPH INAVIL+SV
Sbjct: 386 ILFVFLASLTLVGFLVPYTSDQLLGAAGSATKASPYVIAVSSHGVRVVPHFINAVILLSV 445

Query: 392 VSVANSSLYAGPRLICSLAQQGYAPKFLDYVDREGRPLRALIVCCVFGVIAFVAASSKEE 451
           +SVAN + Y   R++ SLA+QG APK  DY+DREGRP  A++V  +FGVIAF A+S KEE
Sbjct: 446 LSVANGAFYTSSRILMSLAKQGNAPKCFDYIDREGRPAAAMLVSALFGVIAFCASSKKEE 505

Query: 452 IVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGYKATTGIWGSIYGVFFN 511
            VFTWL AI+GLS+LFTW +I LSH+RFR+AMKVQGRSL E+GYK+  G+WGS Y V   
Sbjct: 506 DVFTWLLAISGLSQLFTWITICLSHIRFRRAMKVQGRSLGEVGYKSQVGVWGSAYAVLMM 565

Query: 512 ILVFVAQFWVALAPLGNGGKCDAESFFQNYLAFPIWLAFYFGYMVYNRDFTLLNPLDKID 571
           +L  +AQFWVA+AP+G GGK  A+SFF+NYLA PIW+A Y  Y V+ +D++L  P DK+D
Sbjct: 566 VLALIAQFWVAIAPIGGGGKLSAQSFFENYLAMPIWIALYIFYKVWKKDWSLFIPADKVD 625

Query: 572 LDFHRRIYDPELMRQEDEENKEKLRN 597
           L  HR I+D EL++QEDEE KE+LRN
Sbjct: 626 LVSHRNIFDEELLKQEDEEYKERLRN 651

>CAGL0B01012g 91330..93201 similar to sp|P25376 Saccharomyces
           cerevisiae YCL025c AGP1 Asparagine/glutamine permease or
           sp|P48813 Saccharomyces cerevisiae YDR508c GNP1,
           hypothetical start
          Length = 623

 Score =  665 bits (1715), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/600 (53%), Positives = 421/600 (70%), Gaps = 21/600 (3%)

Query: 18  DSISIRSFSAGNNFQSSSSEKTYSKQKSGSDKLIHRFADSFKRAE--------------G 63
           D +S +     +  + S + +T +   + +     RF DSFKRAE              G
Sbjct: 13  DKVSDKEVEYMSPREVSVTPETSATPNTPAPSQFRRFVDSFKRAEQQNNSEITSAASCDG 72

Query: 64  STTRTKQINENTSDLEDGVESITSDS------KLKKSMKSRHVVMMSLGTGIGTGLLVAN 117
           S+    +  +  +DLE     + ++       +LK+++K RHV+++SLGTGIGTGLLV N
Sbjct: 73  SSENLDKDGKEVADLEVQENQVLTEKSNQKNKELKQTIKPRHVILISLGTGIGTGLLVGN 132

Query: 118 AKGLHYGGPAALIIGYILVSFETYFMIQAAGEMAVTYPTLPANFNAYSSIFISKSFGFAT 177
           AK LH  GPA L+IGY ++    Y +IQAAGE+AV+Y +L   FN Y S  +  +FGF+ 
Sbjct: 133 AKALHNAGPAGLLIGYSIMGTCLYCIIQAAGELAVSYSSLSGGFNVYPSFLVDPAFGFSV 192

Query: 178 VWLYCFQWLTVLPLELITASMTIQFGNDKINPDIYILIFYVFLVFIHFFGVKAYGETEFI 237
            W+YC QWL V PLEL+TASMTI++    +N DI++ IFYV ++ I+ FG + Y E EF 
Sbjct: 193 AWVYCIQWLCVCPLELVTASMTIKYWTTTVNADIFVGIFYVLIIVINTFGARGYAEAEFF 252

Query: 238 FNCCKILMIAGFIILSIVINCGGAGNDGYIGATYWHNPGAFAGDTSIGRFKNVCYILVTA 297
           FNCCKILM+ GF IL IVIN GGAGNDGYIG  YWH PGAFAGD  I  FK +   +VTA
Sbjct: 253 FNCCKILMMIGFFILGIVINTGGAGNDGYIGDRYWHTPGAFAGDRPIDHFKGIMATMVTA 312

Query: 298 YFSFGGMELFALSVQEQSNPRKSTPVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLMGA 357
            F+FG  E  AL+  EQSNPRK+ P AAK+ +YRI+ I+L ++ L+GF VPY+ DQLMG+
Sbjct: 313 AFAFGATEFIALTAAEQSNPRKAIPSAAKKVLYRILFIFLGSITLVGFLVPYDSDQLMGS 372

Query: 358 GGSATHASPYVLAASIHGVKIVPHIINAVILISVVSVANSSLYAGPRLICSLAQQGYAPK 417
           GGSAT ASPYVLA S HGVK+VPH INAVIL+SV+SV NS+ Y+  RL+ SLAQQG APK
Sbjct: 373 GGSATKASPYVLAVSTHGVKVVPHFINAVILLSVLSVGNSAFYSSSRLLYSLAQQGNAPK 432

Query: 418 FLDYVDREGRPLRALIVCCVFGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHL 477
           F DYVDREGRP RA++   VF +I+F AAS KEE VFTWL AI+GLS++FTW +I LSH+
Sbjct: 433 FFDYVDREGRPFRAMVCAGVFAIISFCAASPKEEQVFTWLLAISGLSQVFTWFAICLSHI 492

Query: 478 RFRQAMKVQGRSLDELGYKATTGIWGSIYGVFFNILVFVAQFWVALAPLGNGGKCDAESF 537
           RFR+AM VQ RSL E+G+KA TG+WGS Y  F  +++ +AQFWVA+AP+G  GK DA+ F
Sbjct: 493 RFRKAMFVQKRSLGEIGFKAQTGVWGSYYVCFMLVMILIAQFWVAIAPIGE-GKLDAQGF 551

Query: 538 FQNYLAFPIWLAFYFGYMVYNRDFTLLNPLDKIDLDFHRRIYDPELMRQEDEENKEKLRN 597
           F+NYLA PI + FY GY ++ +D++L    + IDLD HR+I+D EL++QEDEE +EKL+N
Sbjct: 552 FENYLAMPILILFYVGYKIWKKDWSLFIRANNIDLDKHRQIFDEELLKQEDEEYREKLKN 611

>AGR039C [4349] [Homologous to ScYDR046C (BAP3) - SH; ScYBR068C
           (BAP2) - SH] (779726..781486) [1761 bp, 586 aa]
          Length = 586

 Score =  655 bits (1690), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/556 (54%), Positives = 412/556 (74%), Gaps = 8/556 (1%)

Query: 43  QKSGSDKLIHRFADSFKRAEGSTTRTKQINENTSDLEDGVESITSDSKLKKSMKSRHVVM 102
           + +G+     RF DSFKRA+  T     ++    D ++G+    +   LK ++K+RH+ M
Sbjct: 26  EYAGNRNAWTRFTDSFKRAQVDTA----VDLEGKDADNGLNK--TQQTLKHNIKTRHLTM 79

Query: 103 MSLGTGIGTGLLVANAKGLHYGGPAALIIGYILVSFETYFMIQAAGEMAVTYPTLPANFN 162
           +SLGTGIGTGLLVA+ K LH+GGPA L+IGY+  S   Y ++QA  E+ V Y TLP N+N
Sbjct: 80  ISLGTGIGTGLLVASGKALHFGGPAGLVIGYVTTSTMLYCVVQACCELGVAYATLPGNYN 139

Query: 163 AYSSIFISKSFGFATVWLYCFQWLTVLPLELITASMTIQFGNDKINPDIYILIFYVFLVF 222
           AY +  + K FGFA   +Y  QW TVLPLEL+TASMT+++    +NPD+++ IFYVFL+F
Sbjct: 140 AYPTFLVDKGFGFAVALVYGLQWATVLPLELVTASMTVKYWTSSVNPDVFVAIFYVFLLF 199

Query: 223 IHFFGVKAYGETEFIFNCCKILMIAGFIILSIVINCGGAGNDGYIGATYWHNPGAFAGDT 282
           IHFFG + Y E EFIFN  K+L++AGFII++I +  G A   GYIG  YWH+PGAF GD 
Sbjct: 200 IHFFGSRGYAEAEFIFNSLKVLLMAGFIIMAISLTAG-ASEQGYIGGQYWHDPGAFGGDR 258

Query: 283 SIGRFKNVCYILVTAYFSFGGMELFALSVQEQSNPRKSTPVAAKRSIYRIVVIYLLTMIL 342
           +I RFK +C + V A F++GG E  AL+  EQ+NPR+S P A KR +YR+VV++LL +IL
Sbjct: 259 AIDRFKGICSVWVQAAFAYGGSEFIALTAAEQANPRESVPKATKRWLYRVVVVFLLPVIL 318

Query: 343 IGFNVPYNDDQLMGA-GGSATHASPYVLAASIHGVKIVPHIINAVILISVVSVANSSLYA 401
           IGF VP+N DQL+ A GGS + ASP+V+AA++HGV++VPHIIN +IL SV+SV NS++Y+
Sbjct: 319 IGFLVPHNSDQLLSAEGGSGSRASPFVIAAALHGVRVVPHIINFIILTSVISVGNSAMYS 378

Query: 402 GPRLICSLAQQGYAPKFLDYVDREGRPLRALIVCCVFGVIAFVAASSKEEIVFTWLAAIA 461
            PR++ SLA+ G  PK   YVDR+GRPL  LI   +FG+IAFVAAS++EE VFTWL+AIA
Sbjct: 379 APRILLSLAEHGMCPKIFTYVDRQGRPLVTLIFVSLFGLIAFVAASNQEENVFTWLSAIA 438

Query: 462 GLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGYKATTGIWGSIYGVFFNILVFVAQFWV 521
           GLS+LFTWT+I +SH+RFR+AM+VQGRSL ELGY+A TG  GS Y +FFN++V +AQFW+
Sbjct: 439 GLSQLFTWTAIAVSHVRFRRAMRVQGRSLGELGYRANTGALGSYYAIFFNVIVLIAQFWI 498

Query: 522 ALAPLGNGGKCDAESFFQNYLAFPIWLAFYFGYMVYNRDFTLLNPLDKIDLDFHRRIYDP 581
           A+AP+   G+ D E FFQNYLAFP+ + FY GY ++ RDF L+ P  ++DL  HR+I+D 
Sbjct: 499 AIAPIPKHGELDVEFFFQNYLAFPVLVVFYLGYKLWKRDFRLVIPSSEVDLLSHRQIFDE 558

Query: 582 ELMRQEDEENKEKLRN 597
           E++ QE+ E KE+LRN
Sbjct: 559 EVLLQEEAERKERLRN 574

>Kwal_33.13204
          Length = 607

 Score =  642 bits (1657), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/559 (54%), Positives = 412/559 (73%), Gaps = 7/559 (1%)

Query: 40  YSKQKSGSDKLIHRFADSFKRAEGSTTRTKQINENTSDLEDGVE-SITSDSKLKKSMKSR 98
           Y   +  S     RFA +F RA+G          + +D+E G E +  +++KLK+++  R
Sbjct: 43  YKFHEDDSKSRFRRFARTFHRADGLGD-----GASGNDVEFGAEVARQTETKLKQTITFR 97

Query: 99  HVVMMSLGTGIGTGLLVANAKGLHYGGPAALIIGYILVSFETYFMIQAAGEMAVTYPTLP 158
           HV MMSLGTGIGTG+LV N K LH GGPA L+IGY ++    Y +IQAAGE+AV+Y +L 
Sbjct: 98  HVFMMSLGTGIGTGMLVGNGKALHNGGPAGLVIGYAIMGSCLYCIIQAAGELAVSYSSLS 157

Query: 159 ANFNAYSSIFISKSFGFATVWLYCFQWLTVLPLELITASMTIQFGNDKINPDIYILIFYV 218
            NFNAY S+ I ++FGF+  W+YC QWL VLPLEL+TAS+TI++    +NPDI++ IFYV
Sbjct: 158 GNFNAYPSMLIEQAFGFSVAWIYCLQWLCVLPLELVTASITIKYWTTSVNPDIFVAIFYV 217

Query: 219 FLVFIHFFGVKAYGETEFIFNCCKILMIAGFIILSIVINCGGAGNDGYIGATYWHNPGAF 278
            ++ ++ FG + Y E EF FNCCK+LMI GF IL I++NCGGAGNDGYIG  YW+NPGAF
Sbjct: 218 LIILVNMFGARGYAEAEFFFNCCKVLMIIGFFILGIIVNCGGAGNDGYIGGRYWNNPGAF 277

Query: 279 AGDTSIGRFKNVCYILVTAYFSFGGMELFALSVQEQSNPRKSTPVAAKRSIYRIVVIYLL 338
            G   I  FK +   +VTA F+FG  E  AL+  EQ+NPR++ P AAK+ +YRI++I+L 
Sbjct: 278 YGTKPIHHFKGIISTMVTAAFAFGATEFIALTAAEQANPRRAIPSAAKKVVYRILLIFLA 337

Query: 339 TMILIGFNVPYNDDQLMGAGGSATHASPYVLAASIHGVKIVPHIINAVILISVVSVANSS 398
            ++LIGF VP+N  +LMG+G SATHASPYV+A + HGV++VPH INAVIL+SV+SV NS+
Sbjct: 338 PIVLIGFLVPHNSPELMGSGSSATHASPYVIAVASHGVRVVPHFINAVILLSVLSVGNSA 397

Query: 399 LYAGPRLICSLAQQGYAPKFLDYVDREGRPLRALIVCCVFGVIAFVAASSKEEIVFTWLA 458
            Y+  RL+ +LA Q YAP +L ++DR GRP+RA++V CVFG+I+FVAAS KEE VFTWL 
Sbjct: 398 FYSSSRLLLALADQHYAPAWLKFIDRSGRPMRAMLVSCVFGLISFVAASPKEETVFTWLL 457

Query: 459 AIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGYKATTGIWGSIYGVFFNILVFVAQ 518
           AI+GLS+LFTW SI +SH+RFR+A+ VQG+ + ELGYK+ TG+ GS Y  F    + + Q
Sbjct: 458 AISGLSQLFTWISICVSHIRFRKALIVQGKPIGELGYKSQTGVAGSYYATFIMGCILIGQ 517

Query: 519 FWVALAPLGNGGKCDAESFFQNYLAFPIWLAFYFGYMVYNRDFTLLNPLDKIDLDFHRRI 578
           FWVA+AP+G+  K DA SFF+NYLA P+++  YFG+ ++ RD+ L  PL++IDLD HR+ 
Sbjct: 518 FWVAIAPMGS-AKLDANSFFENYLALPLFVVLYFGFKIWKRDWRLYIPLEQIDLDSHRKT 576

Query: 579 YDPELMRQEDEENKEKLRN 597
           +D EL++QED E +E +RN
Sbjct: 577 FDEELLKQEDAEYEENIRN 595

>Kwal_33.13215
          Length = 598

 Score =  638 bits (1646), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/582 (54%), Positives = 422/582 (72%), Gaps = 6/582 (1%)

Query: 16  SPDSISIRSFSAGNNFQSSSSEKTYSKQKSGSDKLIHRFADSFKRAEGSTTRTKQINENT 75
           SPD+  + SF +    +  S      +  S SD L  RFADSF+R E         ++  
Sbjct: 11  SPDNGVVESFDSVEVLKEESP-----RSDSRSDGLFRRFADSFRRHEAHNGGGGDGDDED 65

Query: 76  SDLEDGVESITSDSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALIIGYIL 135
            +    +ES +    LK++++ RHV+M+SL TGIGTG+LV N K LH GGPA+L+IGY +
Sbjct: 66  HEGLTPIESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAI 125

Query: 136 VSFETYFMIQAAGEMAVTYPTLPANFNAYSSIFISKSFGFATVWLYCFQWLTVLPLELIT 195
           VS   Y +IQ+A E+A+ Y +L   FNAY S+ + K+FGF+  W+YC QWL VLPLEL+T
Sbjct: 126 VSSMLYCVIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVT 185

Query: 196 ASMTIQFGNDKINPDIYILIFYVFLVFIHFFGVKAYGETEFIFNCCKILMIAGFIILSIV 255
           ASMTI++ N  INPD ++ IFYV LV I+F G   Y E EF FNCCK+LMI GF IL I+
Sbjct: 186 ASMTIKYWNQTINPDAFVTIFYVVLVAINFVGAAGYAEAEFFFNCCKVLMIIGFFILGII 245

Query: 256 INCGGAGNDGYIGATYWHNPGAFAGDTSIGRFKNVCYILVTAYFSFGGMELFALSVQEQS 315
           INCGGAGNDGY+GA YWH+PGAF G  SI RFK +  +LV A F++GG E   L+  EQ 
Sbjct: 246 INCGGAGNDGYLGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQ 305

Query: 316 NPRKSTPVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLMGAGGSATHASPYVLAASIHG 375
           NP+KS   A+K+ +YRI+ IY++T IL+GF VP+N D+L+G+GGSATHASP+V+A + HG
Sbjct: 306 NPQKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHG 365

Query: 376 VKIVPHIINAVILISVVSVANSSLYAGPRLICSLAQQGYAPKFLDYVDREGRPLRALIVC 435
           V++VPH INAVIL+SV+SVANS+LY+  R++ SL++QG+AP+FL+YVDR GRP+  L+V 
Sbjct: 366 VRVVPHFINAVILLSVLSVANSALYSSSRILLSLSEQGFAPRFLNYVDRCGRPVLCLLVS 425

Query: 436 CVFGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGY 495
           CVFG+++FVAAS KEE VFTWL AI+GLSELFTW SI LSH+R R+AM VQGRS DELGY
Sbjct: 426 CVFGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGY 485

Query: 496 KATTGIWGSIYGVFFNILVFVAQFWVALAPLGNGGKCDAESFFQNYLAFPIWLAFYFGYM 555
            A TG+WG+ Y +   + + V QFWVA++P+G+  K DA +FF+NYLA PI +  Y GY 
Sbjct: 486 VAWTGVWGAYYAMAMIVAILVGQFWVAISPVGS-NKLDANNFFENYLAMPILIFLYLGYK 544

Query: 556 VYNRDFTLLNPLDKIDLDFHRRIYDPELMRQEDEENKEKLRN 597
           ++ RD+ LL P  ++DL  HR+I+D E++R E  E KE+LR+
Sbjct: 545 IWTRDWRLLIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRH 586

>YCL025C (AGP1) [519] chr3 complement(76131..77918) Broad substrate
           range amino acid permease with high affinity for
           asparagine and glutamine [1788 bp, 595 aa]
          Length = 595

 Score =  617 bits (1591), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/575 (52%), Positives = 395/575 (68%), Gaps = 23/575 (4%)

Query: 9   SSGKKETSPDSISIRSFSAGNNFQSSSSEKTYSKQKSGSDKLIHRFADSFKRAEG----- 63
           SS +   +     I  F  G+N + SS      +Q + S   + RF DSFKRA+      
Sbjct: 16  SSTEIHATGQDNEIEYFETGSNDRPSSQPHLGYEQHNTSA--VRRFFDSFKRADQGPQDE 73

Query: 64  ---------------STTRTKQINENTSDLEDGVESITSDSKLKKSMKSRHVVMMSLGTG 108
                          S+ + +++ +N S    G  +      LKK+++ RHV+M++LGTG
Sbjct: 74  VEATQMNDLTSAISPSSRQAQELEKNESSDNIGANTGHKSDSLKKTIQPRHVLMIALGTG 133

Query: 109 IGTGLLVANAKGLHYGGPAALIIGYILVSFETYFMIQAAGEMAVTYPTLPANFNAYSSIF 168
           IGTGLLV N   L + GPA L+IGY ++    Y +IQA GEMA+ Y  L   +NAY S  
Sbjct: 134 IGTGLLVGNGTALVHAGPAGLLIGYAIMGSILYCIIQACGEMALVYSNLTGGYNAYPSFL 193

Query: 169 ISKSFGFATVWLYCFQWLTVLPLELITASMTIQFGNDKINPDIYILIFYVFLVFIHFFGV 228
           +   FGFA  W+YC QWL V PLEL+TASMTI++    +NPD++++IFYV ++ I+ FG 
Sbjct: 194 VDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTTSVNPDVFVIIFYVLVITINIFGA 253

Query: 229 KAYGETEFIFNCCKILMIAGFIILSIVINCGGAGNDGYIGATYWHNPGAFAGDTSIGRFK 288
           + Y E EF FNCCKILM+ GF IL I+I+ GGAGNDG+IG  YWH+PGAF G  +I RFK
Sbjct: 254 RGYAEAEFFFNCCKILMMTGFFILGIIIDVGGAGNDGFIGGKYWHDPGAFNGKHAIDRFK 313

Query: 289 NVCYILVTAYFSFGGMELFALSVQEQSNPRKSTPVAAKRSIYRIVVIYLLTMILIGFNVP 348
            V   LVTA F+FGG E  A++  EQSNPRK+ P AAK+ IYRI+ ++L T+IL+GF VP
Sbjct: 314 GVAATLVTAAFAFGGSEFIAITTAEQSNPRKAIPGAAKQMIYRILFLFLATIILLGFLVP 373

Query: 349 YNDDQLMGAGGSATHASPYVLAASIHGVKIVPHIINAVILISVVSVANSSLYAGPRLICS 408
           YN DQL+G+ G  T ASPYV+A + HGV++VPH INAVIL+SV+S+ANSS Y+  RL  +
Sbjct: 374 YNSDQLLGSTGGGTKASPYVIAVASHGVRVVPHFINAVILLSVLSMANSSFYSSARLFLT 433

Query: 409 LAQQGYAPKFLDYVDREGRPLRALIVCCVFGVIAFVAASSKEEIVFTWLAAIAGLSELFT 468
           L++QGYAPK   Y+DR GRPL A+ V  +F VIAF AAS KEE VFTWL AI+GLS+LFT
Sbjct: 434 LSEQGYAPKVFSYIDRAGRPLIAMGVSALFAVIAFCAASPKEEQVFTWLLAISGLSQLFT 493

Query: 469 WTSIMLSHLRFRQAMKVQGRSLDELGYKATTGIWGSIYGVFFNILVFVAQFWVALAPLGN 528
           WT+I LSHLRFR+AMKVQGRSL ELG+K+ TG+WGS Y     IL+ +AQFWVA+AP+G 
Sbjct: 494 WTAICLSHLRFRRAMKVQGRSLGELGFKSQTGVWGSAYACIMMILILIAQFWVAIAPIGE 553

Query: 529 GGKCDAESFFQNYLAFPIWLAFYFGYMVYNRDFTL 563
            GK DA++FF+NYLA PI +A Y GY V+++D+ L
Sbjct: 554 -GKLDAQAFFENYLAMPILIALYVGYKVWHKDWKL 587

>KLLA0C01606g complement(123485..125347) similar to sp|P48813
           Saccharomyces cerevisiae YDR508c GNP1 high-affinity
           glutamine permease, start by similarity
          Length = 620

 Score =  617 bits (1591), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/571 (53%), Positives = 405/571 (70%), Gaps = 14/571 (2%)

Query: 37  EKTYSK---QKSGSDKLIHRFADSFKRAEGSTTRTK-----QINENTSDLEDGVESITSD 88
           EKT+S+   + +    + HRF DSFKRA+   T        ++N + S L +        
Sbjct: 46  EKTFSQSDEEYAAKSSVWHRFKDSFKRADHINTNIHGNAELELNPSQSLLPE------KG 99

Query: 89  SKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALIIGYILVSFETYFMIQAAG 148
           + LK+ +K RHVVMMSL TGIGTGLLV N K L  GGPA L IGY ++    Y +IQAAG
Sbjct: 100 ASLKRDIKPRHVVMMSLATGIGTGLLVGNGKALATGGPAGLTIGYAIMGSCLYSIIQAAG 159

Query: 149 EMAVTYPTLPANFNAYSSIFISKSFGFATVWLYCFQWLTVLPLELITASMTIQFGNDKIN 208
           E+AV YPTL  NFN Y S  +  +  FAT  LYC QWL V PLE+I+A++TI++ N  IN
Sbjct: 160 ELAVAYPTLTGNFNNYPSFLVDPAMCFATAALYCIQWLCVFPLEVISAAITIKYWNTSIN 219

Query: 209 PDIYILIFYVFLVFIHFFGVKAYGETEFIFNCCKILMIAGFIILSIVINCGGAGNDGYIG 268
           P+++ +IFYV ++ I+  G   Y E +F FN CKILM AGF IL I+INCGGAG+  YIG
Sbjct: 220 PNVWCVIFYVMIIGINMCGSAGYAEADFFFNTCKILMFAGFFILGIIINCGGAGDSVYIG 279

Query: 269 ATYWHNPGAFAGDTSIGRFKNVCYILVTAYFSFGGMELFALSVQEQSNPRKSTPVAAKRS 328
             YW++PGAF GDT I RFK +   LVTA F+FG  E  AL+  EQ+NPRK+ P AAK+ 
Sbjct: 280 GKYWNDPGAFNGDTGISRFKAIVSTLVTAAFAFGASEAVALTASEQANPRKAIPSAAKQV 339

Query: 329 IYRIVVIYLLTMILIGFNVPYNDDQLMGAGGSATHASPYVLAASIHGVKIVPHIINAVIL 388
           +YRI+ IYL ++IL+GF VPYN  +LMG+G S+ H+SPYV+A + HGVK+VP  INAVIL
Sbjct: 340 LYRIIAIYLASIILVGFLVPYNSPELMGSGSSSVHSSPYVIAVASHGVKVVPSFINAVIL 399

Query: 389 ISVVSVANSSLYAGPRLICSLAQQGYAPKFLDYVDREGRPLRALIVCCVFGVIAFVAASS 448
           ISV+SV N S Y+  R++  L++ GYAPKF  YVDR+GRPL A+IV  + G I FV+ASS
Sbjct: 400 ISVLSVGNFSFYSSSRILLCLSEIGYAPKFFQYVDRQGRPLYAMIVGALVGCICFVSASS 459

Query: 449 KEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGYKATTGIWGSIYGV 508
            EE VFTWL A++GLS+LFTWT+I +SH+RFR+AM+VQ RS+ ELG+++  G+WGS YG+
Sbjct: 460 AEESVFTWLMAVSGLSQLFTWTNICISHVRFRKAMQVQNRSIGELGFRSQVGVWGSYYGI 519

Query: 509 FFNILVFVAQFWVALAPLGNGGKCDAESFFQNYLAFPIWLAFYFGYMVYNRDFTLLNPLD 568
           F  ILVF+ QFWVAL P+G     DAE+FF NYLA P++LA YFG+ ++ +D+ L  P  
Sbjct: 520 FMMILVFIGQFWVALFPVGGTDGADAENFFANYLAMPVFLALYFGFKIWKKDWRLYIPAS 579

Query: 569 KIDLDFHRRIYDPELMRQEDEENKEKLRNMS 599
           +IDL  HR+I+D E+++QEDEE K K+++ S
Sbjct: 580 EIDLISHRKIFDEEILKQEDEEYKIKMKHAS 610

>AFR698C [3891] [Homologous to ScYDR508C (GNP1) - SH; ScYCL025C
           (AGP1) - SH] (1725946..1727775) [1830 bp, 609 aa]
          Length = 609

 Score =  593 bits (1530), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/571 (51%), Positives = 385/571 (67%), Gaps = 12/571 (2%)

Query: 31  FQSSSSEKTYSKQKSGSDKLIHRFADSFKRAEGSTTRTKQINENTSDLEDGVESITSDSK 90
           F+ +S++K+  +   G D    RF  SFKRA GS     +     +              
Sbjct: 39  FEKTSAQKSDFEYLEGDDTRFKRFLSSFKRAHGSGGTDTEGGGGQN---------AKHEN 89

Query: 91  LKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALIIGYILVSFETYFMIQAAGEM 150
           LK+++KSRH++M+SLGTGIGTGLLV +   LH GGPA   IG++++    Y +IQAAGE+
Sbjct: 90  LKQTIKSRHMIMISLGTGIGTGLLVGSGTALHDGGPAGSAIGFLIMGLCVYCVIQAAGEL 149

Query: 151 AVTYPTLPANFNAYSSIFISKSFGFATVWLYCFQWLTVLPLELITASMTIQF--GNDKIN 208
           AV Y +L   FNAY S  I  + GFAT W+YC QWL V PLEL+TAS+TI+F  G+  +N
Sbjct: 150 AVCYTSLAGGFNAYPSFLIDPALGFATAWVYCLQWLCVFPLELVTASITIKFWPGSRSVN 209

Query: 209 PDIYILIFYVFLVFIHFFGVKAYGETEFIFNCCKILMIAGFIILSIVINCGGAGNDGYIG 268
           PDIY+ IFYV ++ I+FFG + Y E EF FN CK+LM+ GF I+ I+IN G  G  GYIG
Sbjct: 210 PDIYVAIFYVLIIVINFFGARGYAEAEFFFNSCKVLMMIGFFIVGILINTGAVGTSGYIG 269

Query: 269 ATYWHNPGAFAGDTSIGRFKNVCYILVTAYFSFGGMELFALSVQEQSNPRKSTPVAAKRS 328
             YW +PG+  G T    FK +   LV A FS G  E  AL+  EQ+NPRKS P AAK+ 
Sbjct: 270 GKYWRDPGSLGGRTHFDHFKGIVATLVNAAFSLGCSEFVALTAAEQANPRKSIPAAAKKM 329

Query: 329 IYRIVVIYLLTMILIGFNVPYNDDQLMGAGGSATHASPYVLAASIHGVKIVPHIINAVIL 388
           IY+I V++L ++ILIGF VP +  +LMG+  S  H SPYV+A  +HGV +VP  INAVIL
Sbjct: 330 IYKIFVVFLGSVILIGFLVPKDSHELMGSNDSDLHVSPYVIAVRMHGVNVVPSFINAVIL 389

Query: 389 ISVVSVANSSLYAGPRLICSLAQQGYAPKFLDYVDREGRPLRALIVCCVFGVIAFVAASS 448
           +SV+SV NS+ Y+  RL+ SLA+Q YAPK   Y+DR GRPL A+I+  +FG I FVAAS 
Sbjct: 390 LSVLSVGNSAFYSSSRLLHSLAEQNYAPKIFKYIDRAGRPLMAMIISILFGTICFVAASP 449

Query: 449 KEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGYKATTGIWGSIYGV 508
           KEE VF WL AI+GLS+LFTW++I LSH+RFR+A+ VQG S DELG+KA TGI GS    
Sbjct: 450 KEEEVFKWLLAISGLSQLFTWSTICLSHIRFRRALAVQGYSTDELGFKAQTGIIGSYVSA 509

Query: 509 FFNILVFVAQFWVALAPLGNGGKCDAESFFQNYLAFPIWLAFYFGYMVYNRDFTLLNPLD 568
              +L  + QFWV+L P+G   + DAESFF  YLA P++L FYFGY ++N+D+ L    D
Sbjct: 510 IMMVLALIGQFWVSLVPMG-ATEPDAESFFTGYLAMPMFLLFYFGYKIWNKDWRLFIRAD 568

Query: 569 KIDLDFHRRIYDPELMRQEDEENKEKLRNMS 599
           +IDL  HRRI+D ++++QED E + KLRN S
Sbjct: 569 QIDLVSHRRIFDADVLKQEDIEYRAKLRNSS 599

>Scas_517.2
          Length = 679

 Score =  592 bits (1525), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/615 (50%), Positives = 406/615 (66%), Gaps = 34/615 (5%)

Query: 5   EDFGSSGKKETSPDSISIRSFSAGNNFQSSSSEKTYSKQKSGSDKLIHRFADSFKRAEGS 64
           E FG     +TS   ++ R + +G +F+  +++ +           I  F DSFKRAE  
Sbjct: 63  EYFGEKSNDDTSSSPVT-RQYVSGADFEEHTTKPSR----------IRNFMDSFKRAEQH 111

Query: 65  TTRTKQINENT-SDLE-------DGVE---------SITSDSK---LKKSMKSRHVVMMS 104
            T       N+ SDLE       DG            I  +SK   LKK++K RHV+M+S
Sbjct: 112 PTNVNNNGANSESDLENMILYNEDGTPKPLPHHHDAQINDNSKSDELKKTIKPRHVLMIS 171

Query: 105 LGTGIGTGLLVANAKGLHYGGPAALIIGYILVSFETYFMIQAAGEMAVTYPTLPANFNAY 164
           LGTGIGTGLLV     L   GPA LIIG+ ++    Y +IQA GE+AV Y  L   FNAY
Sbjct: 172 LGTGIGTGLLVGLGSSLVQAGPAGLIIGFGIMGSCLYCIIQAVGELAVAYSDLVGGFNAY 231

Query: 165 SSIFISKSFGFATVWLYCFQWLTVLPLELITASMTIQFGNDKINPDIYILIFYVFLVFIH 224
            S  + ++F FA  WLY  QWL V PLEL+TASMTI++   K++PDI+++IFY+ ++ I+
Sbjct: 232 PSFLVDEAFCFAVAWLYAIQWLCVCPLELVTASMTIKYWTTKVDPDIFVIIFYILIIGIN 291

Query: 225 FFGVKA-YGETEFIFNCCKILMIAGFIILSIVINCGGAGNDGYIGATYWHNPGAFAGDTS 283
             G  A Y E EFIFN CKI+M+ GF IL I + CGGAG DGYIGA YWH+PGA  GDTS
Sbjct: 292 LLGGAAGYAEAEFIFNSCKIMMMIGFFILGITVICGGAGTDGYIGAKYWHDPGALRGDTS 351

Query: 284 IGRFKNVCYILVTAYFSFGGMELFALSVQEQSNPRKSTPVAAKRSIYRIVVIYLLTMILI 343
           I RFK     LV A F+FG  E   ++  EQSNPRK+ P AAK+ IYRI+ ++L ++ ++
Sbjct: 352 IQRFKGCMATLVNAAFAFGMSEFIGVTASEQSNPRKAIPSAAKKMIYRILCMFLSSITIV 411

Query: 344 GFNVPYNDDQLMGAGGSATHASPYVLAASIHGVKIVPHIINAVILISVVSVANSSLYAGP 403
           GF VPYN DQL+G+ GS   ASPYVLA S HGV++VPH INAVILISV+SVANS+ Y+  
Sbjct: 412 GFLVPYNSDQLLGSTGSGVKASPYVLAISTHGVRVVPHFINAVILISVLSVANSAYYSSS 471

Query: 404 RLICSLAQQGYAPKFLDYVDREGRPLRALIVCCVFGVIAFVAASSKEEIVFTWLAAIAGL 463
           R++ SLA+QGYAPK   Y+DREGRPL  +    +FGVIAF A S KE+ VF WL AI+GL
Sbjct: 472 RMLLSLAEQGYAPKIYSYIDREGRPLVGMATAAIFGVIAFCATSPKEDEVFVWLLAISGL 531

Query: 464 SELFTWTSIMLSHLRFRQAMKVQGRSLDELGYKATTGIWGSIYGVFFNILVFVAQFWVAL 523
           S+LFTW +I +SH+RFR+AM VQGRS+ ELG+++  G +GS Y      ++ +AQFWVAL
Sbjct: 532 SQLFTWMAICISHIRFRRAMHVQGRSIGELGFRSQVGWYGSAYAAIMMFMILIAQFWVAL 591

Query: 524 APLGNGG--KCDAESFFQNYLAFPIWLAFYFGYMVYNRDFTLLNPLDKIDLDFHRRIYDP 581
            P+      K DA++FF+NYLA PI LAFYFGY ++ +D+ L      IDL  HR I+D 
Sbjct: 592 VPINADLTIKLDAKNFFENYLAMPILLAFYFGYKIWKKDWKLFIRAKNIDLISHRNIFDE 651

Query: 582 ELMRQEDEENKEKLR 596
           EL++QE++E +E+LR
Sbjct: 652 ELIKQEEDEYRERLR 666

>AGR040C [4350] [Homologous to ScYBR069C (TAT1) - SH]
           (782289..784010) [1722 bp, 573 aa]
          Length = 573

 Score =  585 bits (1508), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/577 (50%), Positives = 392/577 (67%), Gaps = 29/577 (5%)

Query: 29  NNFQSSSSEKTYSKQK-----SGSDK---LIHRFADSFKRAEGSTTRTKQINENTSDLED 80
           ++  SS  +++Y K       SG ++   ++  F DSF+R        K      +D ED
Sbjct: 6   SSISSSKKDESYVKVSPNTVGSGDERRTGIMRGFIDSFRRGRDVDLMCK------ADAED 59

Query: 81  GVESITSDSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALIIGYILVSFET 140
           G     + +K+KK++K+RH++M++LGTGIGTGLLV N   L   GPA LI+GY++ S   
Sbjct: 60  G-----TTAKMKKTIKTRHLLMITLGTGIGTGLLVGNGSALAKAGPAGLILGYVVSSAML 114

Query: 141 YFMIQAAGEMAVTYPTLPANFNAYSSIFISKSFGFATVWLYCFQWLTVLPLELITASMTI 200
           Y +++AAGE+ + Y  +  N+ AYSS+ +  + GF+  W+YC QW+TV PL+L+TA+M I
Sbjct: 115 YLIVEAAGELGICYSGMTGNYTAYSSLLVDPAMGFSVSWVYCIQWMTVFPLQLVTAAMII 174

Query: 201 QFGNDKINPDIYILIFYVFLVFIHFFGVKAYGETEFIFNCCKILMIAGFIILSIVINCGG 260
           Q+  D INPDI++ I Y  +VFI+ FG K Y E EF FN CK+LMI GF+IL +VINCGG
Sbjct: 175 QYWTD-INPDIFVAIIYAVIVFINLFGAKGYAEAEFFFNLCKVLMIIGFVILGVVINCGG 233

Query: 261 AGNDGYIGATYWHNPGAFAGDTSIGRFKNVCYILVTAYFSFGGMELFALSVQEQSNPRKS 320
           AG  GYIG  YWH P  F     +  FK +C++   A F++GG+E+  LS  EQ NPRKS
Sbjct: 234 AGTSGYIGDKYWHEPRPF-----MNGFKGLCFVFCYAAFAYGGIEVMVLSASEQENPRKS 288

Query: 321 TPVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLMGAGGSATHASPYVLAASIHGVKIVP 380
              A K+ IYRIV+IYLLT +++ F VP +   L   G   + ASP V+A S HGVKIVP
Sbjct: 289 ISSACKKVIYRIVLIYLLTTVIVCFLVPADHPSLASEG---SRASPLVIAVSFHGVKIVP 345

Query: 381 HIINAVILISVVSVANSSLYAGPRLICSLAQQGYAPKFLDYVDREGRPLRALIVCCVFGV 440
           HIINAVILI+VVSV NSSLY+ PRL+ SLA+QGYAPK   Y+DR+GRPL A  V  VFG+
Sbjct: 346 HIINAVILIAVVSVGNSSLYSAPRLLLSLAEQGYAPKIFTYIDRQGRPLPAFFVAMVFGL 405

Query: 441 IAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGYKATTG 500
           +AF+AAS  ++ VF WL AI+GLS++F W SI +SH+RFR AMK QGRS+ E+GYKA TG
Sbjct: 406 LAFLAASPAQDDVFGWLLAISGLSQMFIWMSICISHIRFRDAMKAQGRSMGEVGYKARTG 465

Query: 501 IWGSIYGVFFNILVFVAQFWVALAPLGNGGKCDAESFFQNYLAFPIWLAFYFGYMVYNRD 560
            WGS   V    L+ +AQFWVA++P+   G  DA SFFQ+YLAFPI L  YFGY +Y++D
Sbjct: 466 YWGSWIAVVTAFLILIAQFWVAISPVETKG-VDARSFFQSYLAFPILLLAYFGYKIYHKD 524

Query: 561 FTLLNPLDKIDLDFHRRIYDPELMRQEDEENKEKLRN 597
           + +  P  ++DL  HR+++D + ++QED E K KL++
Sbjct: 525 WRICIPASEVDLISHRQVFDEDELKQEDLEWKLKLKS 561

>YBR069C (TAT1) [259] chr2 complement(376534..378393) Amino acid
           permease that transports valine, leucine, isoleucine,
           tyrosine, tryptophan, and threonine, member of the amino
           acid-polyamine-choline (APC) family of membrane
           transporters [1860 bp, 619 aa]
          Length = 619

 Score =  543 bits (1400), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/572 (50%), Positives = 378/572 (66%), Gaps = 25/572 (4%)

Query: 32  QSSSSEKTYSKQKSGSDKLIHR----FADSFKRAEGSTTRTKQINENTSDLEDGVESITS 87
           Q   S +T   +++ S  ++ R    F DSFKR        +   +  S+LE        
Sbjct: 40  QDEVSGQTAEPRRTDSKSILQRKCKEFFDSFKR--------QLPPDRNSELES-----QE 86

Query: 88  DSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALIIGYILVSFETYFMIQAA 147
            + L KS+KSRH+VM+SLGTGIGTGLLV N + L   GPA L++GY + S   Y +IQAA
Sbjct: 87  KNNLTKSIKSRHLVMISLGTGIGTGLLVGNGQVLGTAGPAGLVLGYGIASIMLYCIIQAA 146

Query: 148 GEMAVTYPTLPANFNAYSSIFISKSFGFATVWLYCFQWLTVLPLELITASMTIQFGNDKI 207
           GE+ + Y  L  N+  Y SI +  S GFA   +Y  QWLTVLPL+L+TA+MT+++    +
Sbjct: 147 GELGLCYAGLTGNYTRYPSILVDPSLGFAVSVVYTIQWLTVLPLQLVTAAMTVKYWTS-V 205

Query: 208 NPDIYILIFYVFLVFIHFFGVKAYGETEFIFNCCKILMIAGFIILSIVINCGGAGNDGYI 267
           N DI++ + +VF++ I+ FG + Y E EFIFN CKILM+ GF+IL+I+INCGGAG+  YI
Sbjct: 206 NADIFVAVVFVFVIIINLFGSRGYAEAEFIFNSCKILMVIGFVILAIIINCGGAGDRRYI 265

Query: 268 GATYWHNPGAFAGDTSIGRFKNVCYILVTAYFSFGGMELFALSVQEQSNPRKSTPVAAKR 327
           GA YWHNPG FA       FK VC +   A FS+GG+E+  LS  EQ NP KS P A K+
Sbjct: 266 GAEYWHNPGPFAHG-----FKGVCTVFCYAAFSYGGIEVLLLSAAEQENPTKSIPNACKK 320

Query: 328 SIYRIVVIYLLTMILIGFNVPYNDDQLMGAGGSATHAS-PYVLAASIHGVKIVPHIINAV 386
            +YRI++IY+LT IL+ F VPYN D+L+G+  S+   + P+V+A + HGVK+VPH INAV
Sbjct: 321 VVYRILLIYMLTTILVCFLVPYNSDELLGSSDSSGSHASPFVIAVASHGVKVVPHFINAV 380

Query: 387 ILISVVSVANSSLYAGPRLICSLAQQGYAPKFLDYVDREGRPLRALIVCCVFGVIAFVAA 446
           ILISV+SVANSSLY+GPRL+ SLA+QG  PK L YVDR GRPL    V  VFG I FVA 
Sbjct: 381 ILISVISVANSSLYSGPRLLLSLAEQGVLPKCLAYVDRNGRPLLCFFVSLVFGCIGFVAT 440

Query: 447 SSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGYKATTGIWGSIY 506
           S  EE VFTWL AI+ LS+LF W S+ LSH+RFR AM  QGRS++E+GYKA TG WGS  
Sbjct: 441 SDAEEQVFTWLLAISSLSQLFIWMSMSLSHIRFRDAMAKQGRSMNEVGYKAQTGYWGSWL 500

Query: 507 GVFFNILVFVAQFWVALAPLGNGGKCDAESFFQNYLAFPIWLAFYFGYMVYNRDFTLLNP 566
            V   I   V QFWVA+AP+   GK + + FFQNYLA PI L  YFG+ +Y + ++   P
Sbjct: 501 AVLIAIFFLVCQFWVAIAPVNEHGKLNVKVFFQNYLAMPIVLFAYFGHKIYFKSWSFWIP 560

Query: 567 LDKIDLDFHRRIY-DPELMRQEDEENKEKLRN 597
            +KIDLD HR I+  P L   +  ++ + L+ 
Sbjct: 561 AEKIDLDSHRNIFVSPSLTEIDKVDDNDDLKE 592

>Scas_718.41
          Length = 614

 Score =  524 bits (1350), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/546 (52%), Positives = 371/546 (67%), Gaps = 21/546 (3%)

Query: 34  SSSEKTYSKQKSGSDKLIHRFADSFKRAEGSTTRTKQINENTSDLEDGVESITSDSKLKK 93
           +S++ T S  K  +      F  SFKR +             SDL+  VE+   D++L K
Sbjct: 59  ASADTTVSTSKCNAKTYFQDFCHSFKRKD-------------SDLDSDVEA--QDTQLSK 103

Query: 94  SMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALIIGYILVSFETYFMIQAAGEMAVT 153
           ++KSRH++M+SLGTGI TGLLV N + L   GPA LIIGY + S   Y +I AAGE+ + 
Sbjct: 104 TIKSRHLLMISLGTGIATGLLVGNGQVLAKAGPAGLIIGYTVSSIMIYCIIHAAGELGIC 163

Query: 154 YPTLPANFNAYSSIFISKSFGFATVWLYCFQWLTVLPLELITASMTIQFGNDKINPDIYI 213
           Y  L  NF  Y SI I  S GFA   LY  QWLTVLPL+L+TA++TI F  D +NPDI++
Sbjct: 164 YRGLVGNFTRYPSILIDPSLGFAISLLYTLQWLTVLPLQLVTAAITISFWTD-VNPDIFV 222

Query: 214 LIFYVFLVFIHFFGVKAYGETEFIFNCCKILMIAGFIILSIVINCGGAGNDGYIGATYWH 273
           L  ++ ++ ++ FG + Y ETEF  NCCKILMI GFIILSIVI  GGAG DGYIGA YW 
Sbjct: 223 LCVFIVVIIVNLFGARGYAETEFFCNCCKILMITGFIILSIVIITGGAGKDGYIGAKYWI 282

Query: 274 NPGAFAGDTSIGRFKNVCYILVTAYFSFGGMELFALSVQEQSNPRKSTPVAAKRSIYRIV 333
           +PG FA       FK VC +   A FS+GG+E+  LS+ EQ +P  + P A K+ +YRI+
Sbjct: 283 HPGPFAHG-----FKGVCTVFTYAAFSYGGIEVVVLSIDEQEDPVSAVPNACKKVVYRIL 337

Query: 334 VIYLLTMILIGFNVPYNDDQLMGAGGSATHASPYVLAASIHGVKIVPHIINAVILISVVS 393
           +IYLLT IL+ F VPY+   L+G+  S +HASP+V+A   HGVK+VPH INAVILISV+S
Sbjct: 338 LIYLLTTILVCFLVPYDSPNLLGSSHSGSHASPFVIAIESHGVKVVPHFINAVILISVIS 397

Query: 394 VANSSLYAGPRLICSLAQQGYAPKFLDYVDREGRPLRALIVCCVFGVIAFVAASSKEEIV 453
           VANSSLY+  RL+ SL++QG  P++L+++D  GRP+R  I+  +FG+I FVAAS K E V
Sbjct: 398 VANSSLYSSSRLLLSLSEQGSLPQWLNFIDMNGRPIRCFIISILFGMIGFVAASDKREDV 457

Query: 454 FTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGYKATTGIWGSIYGVFFNIL 513
           FTWL AI+GLS+LF W S+ LSH+R R AMK QG+SLDE+GYKA TG WGS   VF    
Sbjct: 458 FTWLLAISGLSQLFIWMSMSLSHIRLRDAMKSQGKSLDEIGYKAQTGYWGSWLAVFIGFF 517

Query: 514 VFVAQFWVALAPLGNGGKCDAESFFQNYLAFPIWLAFYFGYMVYNRDFTLLNPLDKIDLD 573
             V QFWVA+AP+   G+ D  +FFQNYLAFPI L  Y G+ +Y +++ L  P DKIDLD
Sbjct: 518 SLVTQFWVAIAPVEKHGELDVVNFFQNYLAFPIVLVAYLGHKIYYKNWRLWIPADKIDLD 577

Query: 574 FHRRIY 579
            HRRIY
Sbjct: 578 SHRRIY 583

>Sklu_2029.2 , Contig c2029 2095-3891
          Length = 598

 Score =  496 bits (1276), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 253/554 (45%), Positives = 353/554 (63%), Gaps = 25/554 (4%)

Query: 46  GSDKLIHRFADSFKRAEGSTTRTKQINENTSDLEDGVESITSDS---------------K 90
           G+DK +++    F    G+    K ++++T  + D  E IT+DS               K
Sbjct: 15  GNDKNMYKPETMF----GTMNWPKLMSKDTL-ISDSSEDITNDSTTGKTEKGHTGSENEK 69

Query: 91  LKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALIIGYILVSFETYFMIQAAGEM 150
           LK+S+K  HV M+++ TGIGTGLLV N K +   G    ++GY ++       +Q+ GE+
Sbjct: 70  LKQSIKPYHVFMITMATGIGTGLLVGNGKSISDAGVGGTLVGYFIIGSMLVCCMQSVGEL 129

Query: 151 AVTYPTLPANFNAYSSIFISKSFGFATVWLYCFQWLTVLPLELITASMTIQFGNDKINPD 210
            V +P+L   FN+Y   F+  SFGF   WL+C QW  VLPLEL+TASMTI++ N+ +NP 
Sbjct: 130 VVAFPSLAGGFNSYGKRFVDPSFGFTVAWLFCLQWQIVLPLELVTASMTIKYWNNSLNPS 189

Query: 211 IYILIFYVFLVFIHFFGVKAYGETEFIFNCCKILMIAGFIILSIVINCGGAGNDGYIGAT 270
           I++ IFY  ++ I FFG + Y + EF+FN  K+LMI GFIIL I+I+ G AG  GYIG  
Sbjct: 190 IFVAIFYSLILGISFFGARGYADAEFLFNLSKVLMITGFIILGIIISFGAAGTSGYIGIK 249

Query: 271 YWHNPGAFAGDTSIGRFKNVCYILVTAYFSFGGMELFALSVQEQS--NPRKSTPVAAKRS 328
           Y   PGAF    +   FK++C  LV A FS GG+E  ALS  EQ+  N  KS   A  + 
Sbjct: 250 YLKTPGAF---NTRNTFKSICSTLVNACFSCGGVEFLALSAAEQARGNISKSIKRACGQV 306

Query: 329 IYRIVVIYLLTMILIGFNVPYNDDQLMGAGGSATHASPYVLAASIHGVKIVPHIINAVIL 388
           + R+ V Y+L++ +IG  VPYN  +LMG+     H+SPYV+A + HGVK+VPH+INAVIL
Sbjct: 307 LVRMCVFYILSIFVIGLLVPYNSPELMGSSSEIIHSSPYVIAVASHGVKVVPHLINAVIL 366

Query: 389 ISVVSVANSSLYAGPRLICSLAQQGYAPKFLDYVDREGRPLRALIVCCVFGVIAFVAASS 448
           I+VVSVANS++Y+  R + +LA+QG+AP +   +D +GRP R L+V  VFG+++F+A   
Sbjct: 367 IAVVSVANSAMYSSSRTLHALAEQGFAPSYFAKLDSKGRPFRCLVVSGVFGLLSFIAEYK 426

Query: 449 KEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGYKATTGIWGSIYGV 508
            +E VF WL +I+GLS +FTWT I ++HLRFR AMK Q  SL+ELG++A +GI+GS Y +
Sbjct: 427 DQESVFVWLLSISGLSTIFTWTMICVAHLRFRAAMKDQNHSLEELGHRAWSGIYGSYYVI 486

Query: 509 FFNILVFVAQFWVALAPLGNGGKCDAESFFQNYLAFPIWLAFYFGYMVYNRDFTLLNPLD 568
             N L  V QFWV+L PL   G+ D  +FFQNY+A P  L  Y G+ +Y R +  + P D
Sbjct: 487 AINSLTLVVQFWVSLFPLDGDGRPDFVNFFQNYMAVPFALCLYVGHKIYTRSWQFIIPAD 546

Query: 569 KIDLDFHRRIYDPE 582
           KID+D  R IY  E
Sbjct: 547 KIDVDTSRDIYGVE 560

>YKR039W (GAP1) [3292] chr11 (514705..516513) General amino acid
           permease, proton symport transporter for all
           naturally-occurring L-amino acids, 4-aminobutyric acid
           (GABA), ornithine, citrulline, some D-amino acids, and
           some toxic analogs [1809 bp, 602 aa]
          Length = 602

 Score =  494 bits (1273), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 263/591 (44%), Positives = 383/591 (64%), Gaps = 16/591 (2%)

Query: 9   SSGKKETSPDSISIRSFSAGNNFQSS------SSEKTYSKQKSGSDKLIHRFADSFKRAE 62
           +S  ++ +PD++     +  + F +       S+    S  ++GS      F DSFKR  
Sbjct: 4   TSSYEKNNPDNLKHNGITIDSEFLTQEPITIPSNGSAVSIDETGSGSKWQDFKDSFKR-- 61

Query: 63  GSTTRTKQINENTSDLEDGVESITSDSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLH 122
               +  +++ N S+ E  V  IT+ + LK  +K+RH+ M+++G  IGTGLLV +   L 
Sbjct: 62  ---VKPIEVDPNLSEAEK-VAIITAQTPLKHHLKNRHLQMIAIGGAIGTGLLVGSGTALR 117

Query: 123 YGGPAALIIGYILVSFETYFMIQAAGEMAVTYPTLPANFNAYSSIFISKSFGFATVWLYC 182
            GGPA+L+IG+       Y M+ A GE+AV +P +   F  Y++ FI +SFG+A  + Y 
Sbjct: 118 TGGPASLLIGWGSTGTMIYAMVMALGELAVIFP-ISGGFTTYATRFIDESFGYANNFNYM 176

Query: 183 FQWLTVLPLELITASMTIQF-GNDKINPDIYILIFYVFLVFIHFFGVKAYGETEFIFNCC 241
            QWL VLPLE+++AS+T+ F G D    D ++ +F++ +V I+ FGVK YGE EF+F+  
Sbjct: 177 LQWLVVLPLEIVSASITVNFWGTDPKYRDGFVALFWLAIVIINMFGVKGYGEAEFVFSFI 236

Query: 242 KILMIAGFIILSIVINCGGAGNDGYIGATYWHNPGAFAGDTSIGRFKNVCYILVTAYFSF 301
           K++ + GFIIL I++NCGG    GYIG  YWH+PGAFAGDT   +FK VC + VTA FSF
Sbjct: 237 KVITVVGFIILGIILNCGGGPTGGYIGGKYWHDPGAFAGDTPGAKFKGVCSVFVTAAFSF 296

Query: 302 GGMELFALSVQEQSNPRKSTPVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLMGAGGSA 361
            G EL  L+  E   PRKS P AAK+  +RI + Y+L++++IG  VPYND  L+GA    
Sbjct: 297 AGSELVGLAASESVEPRKSVPKAAKQVFWRITLFYILSLLMIGLLVPYNDKSLIGASSVD 356

Query: 362 THASPYVLAASIHGVKIVPHIINAVILISVVSVANSSLYAGPRLICSLAQQGYAPKFLDY 421
             ASP+V+A   HG+K +P ++N VILI+V+SV NS++YA  R + +LA+Q + P+   Y
Sbjct: 357 AAASPFVIAIKTHGIKGLPSVVNVVILIAVLSVGNSAIYACSRTMVALAEQRFLPEIFSY 416

Query: 422 VDREGRPLRALIVCCVFGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQ 481
           VDR+GRPL  + V   FG+IAFVAAS KE  VF WL A++GLS LFTW  I + H+RFR+
Sbjct: 417 VDRKGRPLVGIAVTSAFGLIAFVAASKKEGEVFNWLLALSGLSSLFTWGGICICHIRFRK 476

Query: 482 AMKVQGRSLDELGYKATTGIWGSIYGVFFNILVFVAQFWVALAPLGNGGKCDAESFFQNY 541
           A+  QGR LDEL +K+ TG+WGS +G+F  I++F+AQF+VA+ P+G+     AE FF+ Y
Sbjct: 477 ALAAQGRGLDELSFKSPTGVWGSYWGLFMVIIMFIAQFYVAVFPVGD--SPSAEGFFEAY 534

Query: 542 LAFPIWLAFYFGYMVYNRDFTLLNPLDKIDLDFHRRIYDPELMRQEDEENK 592
           L+FP+ +  Y G+ +Y R++ L  P +K+D+D  RR  D +L++QE  E K
Sbjct: 535 LSFPLVMVMYIGHKIYKRNWKLFIPAEKMDIDTGRREVDLDLLKQEIAEEK 585

>Kwal_27.12681
          Length = 593

 Score =  493 bits (1269), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 255/565 (45%), Positives = 365/565 (64%), Gaps = 10/565 (1%)

Query: 32  QSSSSEKTYSKQKSGSDKLIHRFADSFKRAEGSTTRTKQINENTSDLEDGVESITSDSKL 91
            SS    +   Q   S      F D FKR E      ++++ N ++ E  +  IT+ S L
Sbjct: 24  HSSYETGSSPGQTQASKSRWQDFKDGFKRVE-----LEELDPNLTEAEK-IAIITAQSPL 77

Query: 92  KKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALIIGYILVSFETYFMIQAAGEMA 151
           ++ +K+RH+ M+++G  IGTGL V + K L  GGPA ++IG+ L+    Y ++ + GE+A
Sbjct: 78  QRHLKNRHLQMIAIGGAIGTGLFVGSGKALRTGGPAGVLIGWGLIGLMIYCVVMSMGELA 137

Query: 152 VTYPTLPANFNAYSSIFISKSFGFATVWLYCFQWLTVLPLELITASMTIQF-GNDKINPD 210
           VT+P +   F  Y++ F+ +SFGFA  + Y  QWL VLPLE++ AS+T+ F G      D
Sbjct: 138 VTFP-VSGGFTTYATRFVDESFGFAINYNYMLQWLVVLPLEIVAASITVNFWGTPPKYRD 196

Query: 211 IYILIFYVFLVFIHFFGVKAYGETEFIFNCCKILMIAGFIILSIVINCGGAGNDGYIGAT 270
            ++ +FY+ +V I+FFGV+ YGE EF+F+  K++ + GFIIL IV+ CGG    GYIG  
Sbjct: 197 GFVALFYIVIVIINFFGVRGYGEAEFVFSFIKVITVIGFIILGIVLVCGGGPVGGYIGGK 256

Query: 271 YWHNPGAFAGDTSIGRFKNVCYILVTAYFSFGGMELFALSVQEQSNPRKSTPVAAKRSIY 330
           YWHNPGAF+GD +  RFK VC + VTA FSF G EL  L+  E +NPRK+ P AAK+  +
Sbjct: 257 YWHNPGAFSGDDAGSRFKGVCSVFVTAAFSFAGTELVGLASAETANPRKALPRAAKQVFW 316

Query: 331 RIVVIYLLTMILIGFNVPYNDDQLMGAGGSATHASPYVLAASIHGVKIVPHIINAVILIS 390
           RI++ Y++++ LIG  VP+  ++L+G       ASP+VLA   HG+K +P +IN VILIS
Sbjct: 317 RILLFYIISLCLIGLLVPHTSERLIGTSSVDAAASPFVLAIQTHGIKGLPSVINVVILIS 376

Query: 391 VVSVANSSLYAGPRLICSLAQQGYAPKFLDYVDREGRPLRALIVCCVFGVIAFVAASSKE 450
           V+SV NS++YA  R + +LA+QG  P    Y+DR+GRPL A+I  CVFG+++F+A S KE
Sbjct: 377 VLSVGNSAVYACSRSMVALAEQGSLPHIFAYIDRKGRPLVAIITTCVFGLLSFIAQSEKE 436

Query: 451 EIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGYKATTGIWGSIYGVFF 510
             VF WL A++GLS LF+W +I + H+RFR+A+  QGRS DEL + +  GI GS +GV  
Sbjct: 437 GDVFNWLLALSGLSTLFSWGAICICHIRFRRALSAQGRSTDELAFVSYAGIAGSYFGVIL 496

Query: 511 NILVFVAQFWVALAPLGNGGKCDAESFFQNYLAFPIWLAFYFGYMVYNRDFTLLNPLDKI 570
            +LV +AQFWVA+ P+  GG  +AE FF  YL+FP+ LAFY  + ++ R++ L      I
Sbjct: 497 VLLVLIAQFWVAVWPI--GGSPNAEDFFSAYLSFPVLLAFYIFHKIWKRNWKLFTRAKDI 554

Query: 571 DLDFHRRIYDPELMRQEDEENKEKL 595
           D+D  RR  D E +RQE  E K  L
Sbjct: 555 DIDTGRREMDTEALRQEIAEEKMLL 579

>ADL272W [1469] [Homologous to ScYDR508C (GNP1) - NSH]
           complement(227416..229110) [1695 bp, 564 aa]
          Length = 564

 Score =  487 bits (1253), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 234/512 (45%), Positives = 335/512 (65%), Gaps = 4/512 (0%)

Query: 73  ENTSDLEDGVESITSDSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALIIG 132
           E+ SD E      +  + L++S+K RHV M+S+ TGIGTGLLV N K +   G    +IG
Sbjct: 7   EDCSDAEKLSSEGSEPASLRQSIKPRHVFMISMATGIGTGLLVGNGKSIATAGVGGTLIG 66

Query: 133 YILVSFETYFMIQAAGEMAVTYPTLPANFNAYSSIFISKSFGFATVWLYCFQWLTVLPLE 192
           Y+++       +Q+ GE+ V +P+L   FN+Y   FI  S GF   WL+C QW+ VLPLE
Sbjct: 67  YLIIGVMVVCCMQSVGELVVAFPSLAGGFNSYGKKFIDPSLGFCVSWLFCLQWMVVLPLE 126

Query: 193 LITASMTIQFGNDKINPDIYILIFYVFLVFIHFFGVKAYGETEFIFNCCKILMIAGFIIL 252
           L+TASMTI++ N  ++P +++  FY+ +  ++FFG   Y E EFIFNC K++++A FI+L
Sbjct: 127 LVTASMTIKYWNSNLSPSLFVSAFYILICIVNFFGSGGYAEAEFIFNCVKVMVLASFIVL 186

Query: 253 SIVINCGGAGNDGYIGATYWHNPGAFAGDTSIGRFKNVCYILVTAYFSFGGMELFALSVQ 312
            IVI  GG GN G IG  Y   PGAF  +T+   FK     LV A FS GG+E  ALS  
Sbjct: 187 GIVIITGGLGNSGPIGFQYLKTPGAF--NTNYNVFKATAGTLVNAAFSCGGVEFLALSAA 244

Query: 313 EQS--NPRKSTPVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLMGAGGSATHASPYVLA 370
           EQ+  N  KS   A ++   R+ V YLL++ ++G  VPY+   LMG+G   TH SPYV A
Sbjct: 245 EQNRDNMPKSIRRACRQVSIRMFVFYLLSISVVGLLVPYDSPMLMGSGSDTTHTSPYVAA 304

Query: 371 ASIHGVKIVPHIINAVILISVVSVANSSLYAGPRLICSLAQQGYAPKFLDYVDREGRPLR 430
            ++HGV+IVPHIINAVILI+VVSVANS++Y+  R + SLA+Q +AP++   +++ G+P+R
Sbjct: 305 IALHGVRIVPHIINAVILIAVVSVANSAMYSSSRTLHSLAEQNFAPRYFALLNKHGQPMR 364

Query: 431 ALIVCCVFGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSL 490
            L+V  + G+I+F+A    +E VF WL +I+GLS +FTWT+I ++H+RFR A+K+QG+SL
Sbjct: 365 CLVVSAIVGLISFIAEYRDQEAVFVWLLSISGLSTIFTWTTICIAHIRFRNALKLQGQSL 424

Query: 491 DELGYKATTGIWGSIYGVFFNILVFVAQFWVALAPLGNGGKCDAESFFQNYLAFPIWLAF 550
           D LGY++ TG+ GS      N++V + QFWV+L PL N GK DA  FFQNY+A P+ +  
Sbjct: 425 DTLGYRSNTGVIGSYIATAINVVVIIVQFWVSLFPLENNGKPDAVKFFQNYMAVPVAVLL 484

Query: 551 YFGYMVYNRDFTLLNPLDKIDLDFHRRIYDPE 582
           Y G+ +Y  D+T       +D++  R +Y P 
Sbjct: 485 YLGHKLYTNDWTPWIRTHCVDINTDRDVYAPS 516

>CAGL0L03267g 372787..374580 highly similar to sp|P19145
           Saccharomyces cerevisiae YKR039w GAP1 general amino acid
           permease, hypothetical start
          Length = 597

 Score =  485 bits (1249), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 253/545 (46%), Positives = 365/545 (66%), Gaps = 10/545 (1%)

Query: 52  HRFADSFKRAEGSTTRTKQINENTSDLEDGVESITSDSKLKKSMKSRHVVMMSLGTGIGT 111
            +F DSFK  + +      + ++ SD+E  +   T+ + LK  +K+RH+ M+++G  IGT
Sbjct: 48  RKFKDSFKPLDEAV-----VTDDMSDIEK-IAHRTAHAPLKHHLKNRHLQMIAIGGAIGT 101

Query: 112 GLLVANAKGLHYGGPAALIIGYILVSFETYFMIQAAGEMAVTYPTLPANFNAYSSIFISK 171
           GL V +   L   GPA ++IG+ L     Y M+ A GE++V +P +   F  Y++ FI +
Sbjct: 102 GLFVGSGTALRTAGPAGILIGWGLTGTMIYCMVMAMGELSVVFP-ISGGFTTYATRFIDE 160

Query: 172 SFGFATVWLYCFQWLTVLPLELITASMTIQF-GNDKINPDIYILIFYVFLVFIHFFGVKA 230
           SFGFA  + Y  QWL VLPLE++ AS+T+ + G D    D ++ +F+V +V I+ FGVK 
Sbjct: 161 SFGFANNFNYMLQWLCVLPLEIVAASITVNYWGTDPKYRDGFVALFWVVIVIINLFGVKG 220

Query: 231 YGETEFIFNCCKILMIAGFIILSIVINCGGAGNDGYIGATYWHNPGAFAGDTSIGRFKNV 290
           YGE EF+F+  K+L + GFII+ IV+NCGG    GYIG  Y+H+PGAF GDT+  RF+ V
Sbjct: 221 YGEAEFVFSIIKVLTVIGFIIMGIVLNCGGGPEGGYIGGKYFHDPGAFVGDTAGARFQGV 280

Query: 291 CYILVTAYFSFGGMELFALSVQEQSNPRKSTPVAAKRSIYRIVVIYLLTMILIGFNVPYN 350
           C + VTA FSF G EL  ++  E + PRKS P AAK+  +RI + Y+L+++++G  VPY 
Sbjct: 281 CSVFVTAAFSFAGSELIGIAAAESAEPRKSVPKAAKQVFWRITLFYMLSLLMVGLLVPYT 340

Query: 351 DDQLMGAGGSATHASPYVLAASIHGVKIVPHIINAVILISVVSVANSSLYAGPRLICSLA 410
           D++L+GA      ASP+V+A + HG++ +P ++N VILI+V+SV NS++Y   R +C+LA
Sbjct: 341 DERLIGASSVDAAASPFVIAITSHGIRGLPSVVNVVILIAVLSVGNSAVYGCSRTLCALA 400

Query: 411 QQGYAPKFLDYVDREGRPLRALIVCCVFGVIAFVAASSKEEIVFTWLAAIAGLSELFTWT 470
           QQ + PK   Y+DR GRPL  +     FG++AFVA S KE  VF WL A++GLS LFTW 
Sbjct: 401 QQNFLPKIFGYIDRSGRPLFGIAFTSAFGLVAFVAQSKKEGEVFAWLLALSGLSSLFTWG 460

Query: 471 SIMLSHLRFRQAMKVQGRSLDELGYKATTGIWGSIYGVFFNILVFVAQFWVALAPLGNGG 530
            I   H+RFR A+  QGRS DEL +KA  GI+GS++G+F  +L+F+AQF+VAL P   GG
Sbjct: 461 GICFCHIRFRAALTAQGRSTDELPFKAPAGIYGSMWGLFMIVLMFMAQFYVALFP--PGG 518

Query: 531 KCDAESFFQNYLAFPIWLAFYFGYMVYNRDFTLLNPLDKIDLDFHRRIYDPELMRQEDEE 590
           K  AE FFQ+YL+FP+ LAFYFG+ +Y R++ LL PL K+D+D  RR  D +++RQE  E
Sbjct: 519 KPSAEVFFQSYLSFPVVLAFYFGHKLYARNWKLLIPLSKLDIDTGRREMDLDVLRQEIAE 578

Query: 591 NKEKL 595
            K+ +
Sbjct: 579 EKQMM 583

>Sklu_2390.1 YGR191W, Contig c2390 5453-7270 reverse complement
          Length = 605

 Score =  479 bits (1232), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 239/533 (44%), Positives = 348/533 (65%), Gaps = 3/533 (0%)

Query: 64  STTRTKQINENTSDLEDGVESITSDSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHY 123
           S    K    + SD E+ V    +DSKL K +  RH++ +++G  IGTGL V +   L+ 
Sbjct: 61  SKENIKSDVPHVSDFENNVYDTANDSKLNKDLSVRHLLTLAVGGAIGTGLFVNSGASLNT 120

Query: 124 GGPAALIIGYILVSFETYFMIQAAGEMAVTYPTLPANFNAYSSIFISKSFGFATVWLYCF 183
           GGPA+LI+ +++VS   + ++ A GE+A  +P +   FN Y + F+  SFGFA    Y  
Sbjct: 121 GGPASLIVAWVIVSTCLFTIVNALGELAAVFPVV-GGFNVYITRFVEPSFGFAVNINYLA 179

Query: 184 QWLTVLPLELITASMTIQFGNDKINPDIYILIFYVFLVFIHFFGVKAYGETEFIFNCCKI 243
           QW  +LPLEL+ AS+TI++ N+ IN D ++ IFY  +   +   VK++GETEF+ +  KI
Sbjct: 180 QWAVLLPLELVAASITIRYWNNTINSDAWVAIFYTAIFLANMLDVKSFGETEFVLSMIKI 239

Query: 244 LMIAGFIILSIVINCGGAGNDGYIGATYWHNPGAFAGDTSIGRFKNVCYILVTAYFSFGG 303
           L I GF IL IV+ CGG  +  YIG  YW++PGAF GDT   RFK VC + VTA FS+ G
Sbjct: 240 LAIIGFTILGIVLACGGGPSGEYIGGRYWNDPGAFVGDTPGRRFKGVCAVFVTAAFSYSG 299

Query: 304 MELFALSVQEQSNPRKSTPVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLMGAGGSA-T 362
            EL A+S  E  NPR + P A+KR+ + I + Y+  + +IG  VPYND++L+    S   
Sbjct: 300 TELVAVSAAESHNPRVTLPKASKRTFWLITLCYITVLTIIGCLVPYNDERLLNGNSSVDA 359

Query: 363 HASPYVLAASIHGVKIVPHIINAVILISVVSVANSSLYAGPRLICSLAQQGYAPKFLDYV 422
            ASP V+A    G+K +P ++NA+ILI+++SVANS++YA  R + ++A+ G  PK L+Y+
Sbjct: 360 AASPLVIAIENGGIKGLPSLMNAIILIAILSVANSAVYACSRCMVAMAEIGNLPKRLNYI 419

Query: 423 DREGRPLRALIVCCVFGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQA 482
           D+ GRPL A+    +FG+++F+AAS K+E VFTWL+A++GLS LF W SI LSH+RFRQA
Sbjct: 420 DKRGRPLYAIFATLIFGLLSFIAASDKQEEVFTWLSALSGLSTLFCWFSINLSHIRFRQA 479

Query: 483 MKVQGRSLDELGYKATTGIWGSIYGVFFNILVFVAQFWVALAPLGNGGKCDAESFFQNYL 542
           MK Q RSL+EL + + TG++GS YG     LV +A FW +L P+G+ G  DAESFF+ YL
Sbjct: 480 MKAQDRSLNELPFVSITGVYGSWYGCIVIFLVLIASFWTSLFPVGSDG-ADAESFFEGYL 538

Query: 543 AFPIWLAFYFGYMVYNRDFTLLNPLDKIDLDFHRRIYDPELMRQEDEENKEKL 595
           + PI++  Y G+ VY +D+ L      +DLD  RR  D ++++QE    +E++
Sbjct: 539 SLPIFIVCYLGHKVYKKDWRLYVKTKDMDLDTGRREIDLDILKQEIRLEREQM 591

>KLLA0A06886g complement(621646..623409) similar to sp|P19145
           Saccharomyces cerevisiae YKR039w GAP1 general amino acid
           permease, start by similarity
          Length = 587

 Score =  471 bits (1211), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 250/542 (46%), Positives = 356/542 (65%), Gaps = 15/542 (2%)

Query: 52  HRFADSFKRAEGSTTRTKQINENTSDLEDGVESITSDSKLKKSMKSRHVVMMSLGTGIGT 111
            RF DSFKRA+     T+ ++ N +D E  +  +T+++ LK+++KSRH+ M+++G  IGT
Sbjct: 43  ERFRDSFKRAD-----TQDLDPNLTDAEK-MAILTANAPLKRTLKSRHLQMIAIGGAIGT 96

Query: 112 GLLVANAKGLHYGGPAALIIGYILVSFETYFMIQAAGEMAVTYPTLPANFNAYSSIFISK 171
           GL V + K L   GPA ++IG+ L     Y M+ A GE+AVT+P +   F  Y+S F+ +
Sbjct: 97  GLFVGSGKALATAGPAGILIGWALTGTMIYCMVMAMGELAVTFP-IAGGFTTYASRFVDE 155

Query: 172 SFGFATVWLYCFQWLTVLPLELITASMTIQF-GNDKINPDIYILIFYVFLVFIHFFGVKA 230
           SFGFA   +Y  QWL VLPLE++ AS+T+ + G      D ++ +FYV +V I+FFGVK 
Sbjct: 156 SFGFAFNTIYMLQWLVVLPLEIVAASITVNYWGTPDKYRDGFVALFYVVIVAINFFGVKG 215

Query: 231 YGETEFIFNCCKILMIAGFIILSIVINCGGAGNDGYIGATYWHNPGAFAGDTSIGRFKNV 290
           YGE EFIF+  K++ + G+IIL +++ CGG    GYIG   WHNPGAFA       FK V
Sbjct: 216 YGEAEFIFSFIKVITVIGYIILGVILVCGGGPQGGYIGGRLWHNPGAFANG-----FKGV 270

Query: 291 CYILVTAYFSFGGMELFALSVQEQSNPRKSTPVAAKRSIYRIVVIYLLTMILIGFNVPYN 350
           C + VTA FSF G EL  L+  E +NPRKS P AAK+  +RI + Y+L ++++G  VPY 
Sbjct: 271 CSVFVTAAFSFAGSELVGLAAAETANPRKSLPSAAKQVFWRITLFYILALLMVGLLVPYT 330

Query: 351 DDQLMGAGGSATHASPYVLAASIHGVKIVPHIINAVILISVVSVANSSLYAGPRLICSLA 410
            D+L+G       ASP+V++    G+K +P +IN VILI+V+SV NS+++A  R + +LA
Sbjct: 331 SDRLIGQSSVDAAASPFVISIQNAGIKGLPSVINVVILIAVLSVGNSAVFACSRSMAALA 390

Query: 411 QQGYAPKFLDYVDREGRPLRALIVCCVFGVIAFVAASSKEEIVFTWLAAIAGLSELFTWT 470
            QG  PK   Y+DR GRPL  +IV CVFG+++F+AAS KE  VF WL A++GLS LFTW 
Sbjct: 391 NQGSLPKIFGYIDRTGRPLVGIIVTCVFGLLSFIAASPKEGEVFDWLLALSGLSSLFTWG 450

Query: 471 SIMLSHLRFRQAMKVQGRSLDELGYKATTGIWGSIYGVFFNILVFVAQFWVALAPLGNGG 530
            IML H+R R+A+  Q R+  EL + A TG+WGS+YG    IL+ +AQFW+AL P+G+  
Sbjct: 451 GIMLCHIRVRRALAAQNRTTAELSFTAPTGVWGSVYGFVLIILILMAQFWIALFPIGD-- 508

Query: 531 KCDAESFFQNYLAFPIWLAFYFGYMVYNRDFTLLNPLDKIDLDFHRRIYDPELMRQEDEE 590
           K  A +FF+ YL+FPI +AFY G+ ++ +++ L      ID+D  RR  D E ++QE  E
Sbjct: 509 KPSASAFFEAYLSFPILIAFYIGHKIWKKNWKLFIRAKNIDIDTGRRETDIEALKQEIAE 568

Query: 591 NK 592
            K
Sbjct: 569 EK 570

>Kwal_33.14276
          Length = 596

 Score =  462 bits (1189), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 248/575 (43%), Positives = 352/575 (61%), Gaps = 20/575 (3%)

Query: 29  NNFQSSSSEKTYSKQKS----GSDKLIHRFADSFKRAEGSTTRTKQINENTSDLEDGVES 84
            + ++SS  + Y K +      S   IH F D F+       +   ++ N S  E    +
Sbjct: 24  QDIETSSENEGYDKYERESKSSSKSWIHNFVDGFRE-----YKLDDVDPNLSSTERAAIA 78

Query: 85  ITSDSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALIIGYILVSFETYFMI 144
            T+ S LK+ +K+RH+ M+++G  IGTGL V + K L  GGPAA+I+ +IL     Y ++
Sbjct: 79  -TARSPLKRHLKNRHLQMIAIGGSIGTGLFVGSGKALRIGGPAAVILAWILTGSMVYSVV 137

Query: 145 QAAGEMAVTYPTLPANFNAYSSIFISKSFGFATVWLYCFQWLTVLPLELITASMTIQFGN 204
           QA GE+ V  P +  ++ +Y S FI  SFGFA  + Y    L  +PLE++ AS+T+ + N
Sbjct: 138 QAIGELCVALP-VSGSYLSYVSRFIDPSFGFAIAYNYLVGNLVTMPLEIVAASITVDYWN 196

Query: 205 -DKINPDIYILIFYVFLVFIHFFGVKAYGETEFIFNCCKILMIAGFIILSIVINCGGAGN 263
            D    D ++ +FYV ++ I+F GVK YGE EF+F+  K+L I GFIIL IV+ CGG  N
Sbjct: 197 VDHKYADGFVALFYVTVLLINFLGVKGYGEAEFVFSIIKVLAIVGFIILGIVLVCGGGSN 256

Query: 264 D-GYIGATYWHNPGAFAGDTSIGRFKNVCYILVTAYFSFGGMELFALSVQEQSNPRKSTP 322
           + GYIG  YWHNPG FA       FK    I VT+ FSF G E+FAL   E  NPR+  P
Sbjct: 257 NTGYIGTKYWHNPGGFAHG-----FKGFAAIFVTSAFSFSGSEMFALGAAESKNPRRDLP 311

Query: 323 VAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLMGAGGSATHASPYVLAASIHGVKIVPHI 382
            AAK+  +RI + YL+++ LIG  VPY +  L  +      ASP+V+A    G+  +P +
Sbjct: 312 KAAKQVFWRITLFYLISLTLIGCLVPYTNKHLFASSSVDASASPFVIAIKEAGISGLPSV 371

Query: 383 INAVILISVVSVANSSLYAGPRLICSLAQQGYAPKFLDYVDREGRPLRALIVCCVFGVIA 442
           IN VIL++V+SV N+ ++A  R   SLA  GY PK   YVDR+GRPL  LI+  VFG+++
Sbjct: 372 INVVILVAVLSVGNTCVFASSRATLSLAHYGYLPKKFAYVDRKGRPLAGLILSMVFGLLS 431

Query: 443 FVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGYKATTGIW 502
           F+++S  + +VF W+ A++GL   FTW SI + HLRFRQ ++ QGRS DEL +KA TGIW
Sbjct: 432 FLSSSKHKGVVFEWMLAVSGLCSFFTWGSICVCHLRFRQGLRAQGRSTDELAFKAQTGIW 491

Query: 503 GSIYGVFFNILVFVAQFWVALAPLGNGGKCDAESFFQNYLAFPIWLAFYFGYMVYNRDFT 562
           GSIYG+    +V   QFWVAL PL       A  FF+ YL+ P+ + FY G+ VY+R++ 
Sbjct: 492 GSIYGITLISVVLCFQFWVALFPLSK--SPSAYHFFEQYLSLPVVIVFYMGHKVYSRNWR 549

Query: 563 LLNPLDKIDLDFHRRIYDPELMRQEDEENKEKLRN 597
           L+ P  ++DLD  RR  D EL++QE +E  E +R+
Sbjct: 550 LVIPAKELDLDTGRREVDLELLKQEIKEENESIRS 584

>Kwal_33.15407
          Length = 587

 Score =  457 bits (1177), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 243/569 (42%), Positives = 350/569 (61%), Gaps = 17/569 (2%)

Query: 38  KTYSKQKSGSDKLIHRFADSFKRAEGSTTRTKQINEN------TSDLEDGVESITSDSKL 91
           +TY +        +   A  FK+A+ ++       EN      TSD ED        S+ 
Sbjct: 19  ETYKQSSRNDMSPLTSEAPDFKKADAASGNESWALENVESTSGTSDAED--------SRY 70

Query: 92  KKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALIIGYILVSFETYFMIQAAGEMA 151
            K +  RH++ +++G  IGTGL V +   L  GGP +L+I ++++S   + ++ A GE++
Sbjct: 71  NKDLSVRHLLTLAVGGAIGTGLFVNSGSALTTGGPGSLVIDWVIISTCLFTIVNALGELS 130

Query: 152 VTYPTLPANFNAYSSIFISKSFGFATVWLYCFQWLTVLPLELITASMTIQFGNDKINPDI 211
            T+P +   FN Y S F+  SFGFA    Y  QW  +LPLEL+ AS+TI++ N  IN D 
Sbjct: 131 STFPVV-GGFNVYISRFVEPSFGFAVNLNYLAQWAVLLPLELVAASLTIRYWNSTINSDA 189

Query: 212 YILIFYVFLVFIHFFGVKAYGETEFIFNCCKILMIAGFIILSIVINCGGAGNDGYIGATY 271
           ++ IFY  +   +   VK++GETEF+ +  KIL I GF IL IV+ CGG    GYIG  Y
Sbjct: 190 WVAIFYTIIFLANLLDVKSFGETEFVLSMVKILAIIGFTILGIVLTCGGGPEGGYIGGKY 249

Query: 272 WHNPGAFAGDTSIGRFKNVCYILVTAYFSFGGMELFALSVQEQSNPRKSTPVAAKRSIYR 331
           W NPGAF G+TS  RF  +C + VTA FS+ G EL A+S  E  NPR + P A KR+ + 
Sbjct: 250 WSNPGAFVGNTSSQRFHGLCSVFVTAAFSYSGTELIAVSAAESVNPRITLPKACKRTFWL 309

Query: 332 IVVIYLLTMILIGFNVPYNDDQLM-GAGGSATHASPYVLAASIHGVKIVPHIINAVILIS 390
           I V Y++ + L+G  VP +D +L+ G+      ASP V+A    G+K +P ++NA+ILI+
Sbjct: 310 ITVCYIVVLTLVGCLVPSDDPRLLHGSSSVDVAASPLVIAIENGGIKGLPSLMNAIILIA 369

Query: 391 VVSVANSSLYAGPRLICSLAQQGYAPKFLDYVDREGRPLRALIVCCVFGVIAFVAASSKE 450
           V+SVANS++YA  R + S+A+ G  PK   YVDR+GRPL A++   +FG+++F+AAS+K+
Sbjct: 370 VLSVANSAVYACSRCMASMARIGNLPKTFSYVDRKGRPLYAILATLIFGLLSFIAASNKQ 429

Query: 451 EIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGYKATTGIWGSIYGVFF 510
           E VFTWL+A++GLS LF W +I +SH+RFR  MK +GRSLDEL + + TG+WGS YG   
Sbjct: 430 ETVFTWLSALSGLSTLFCWFAINVSHIRFRYTMKQRGRSLDELPFVSMTGVWGSYYGCVI 489

Query: 511 NILVFVAQFWVALAPLGNGGKCDAESFFQNYLAFPIWLAFYFGYMVYNRDFTLLNPLDKI 570
             +V V  FW AL P    G   AESFF+ YL+FPI L  Y G+ +Y + + LL P  +I
Sbjct: 490 IFVVLVVCFWTALFP-STEGVASAESFFETYLSFPILLVCYIGHKLYTKSWRLLTPTTEI 548

Query: 571 DLDFHRRIYDPELMRQEDEENKEKLRNMS 599
           D+D  RR  D E+++ E    ++ +R  S
Sbjct: 549 DIDSGRRAVDIEVLKDEKRMEEQAMREKS 577

>CAGL0B03773g 373956..375773 highly similar to sp|P06775
           Saccharomyces cerevisiae YGR191w HIP1 Histidine
           permease, start by similarity
          Length = 605

 Score =  458 bits (1179), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 252/566 (44%), Positives = 363/566 (64%), Gaps = 17/566 (3%)

Query: 18  DSISIRSFSAGNNFQSSS--SEKTYSKQKSGSDKLIHRFADSFKRAEGSTTRTKQINENT 75
           DS + RS S+ +NF+ SS  S    +   SG+D ++      + R        K   E  
Sbjct: 25  DSANDRS-SSPDNFELSSVNSPVRVNVSSSGNDDILKGDTKEYPR------DVKATPEAA 77

Query: 76  SDLEDGVESITSDSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALIIGYIL 135
           S +ED      +++ L K +  RH++ +++G  IGTGL V +   L  GGPA+L+IG+++
Sbjct: 78  SYVED-----INNTNLNKDLSVRHLLTLAVGGAIGTGLFVNSGASLTTGGPASLVIGWVI 132

Query: 136 VSFETYFMIQAAGEMAVTYPTLPANFNAYSSIFISKSFGFATVWLYCFQWLTVLPLELIT 195
           VS   + +I + GE+A  +P +   FN Y + FI  SF FA    Y  QWL +LPLEL+ 
Sbjct: 133 VSTCLFTVINSLGELAAAFPVV-GGFNVYITRFIEPSFAFAINLNYLAQWLVLLPLELVA 191

Query: 196 ASMTIQFGNDKINPDIYILIFYVFLVFIHFFGVKAYGETEFIFNCCKILMIAGFIILSIV 255
           AS+TI++ NDKIN D ++ IFY  +   +   VK++GETEFI +  KIL I GF IL IV
Sbjct: 192 ASITIRYWNDKINSDAWVAIFYTAIALANMLDVKSFGETEFILSMVKILAIIGFGILGIV 251

Query: 256 INCGGAGNDGYIGATYWHNPGAFAGDTSIGRFKNVCYILVTAYFSFGGMELFALSVQEQS 315
           + CGG  + GYIG  YWHNPGAF G ++  +FK +C + VTA FS+ G+E+ A+S  E  
Sbjct: 252 LTCGGGPHGGYIGGKYWHNPGAFVGHSAGSQFKGLCSVFVTAAFSYSGIEMTAVSAAESR 311

Query: 316 NPRKSTPVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLM-GAGGSATHASPYVLAASIH 374
           NP+++ P AAKR+ + I V Y+  + LIG  VPYND +L+ G+      ASP V+A    
Sbjct: 312 NPKETIPKAAKRTFWLITVSYVGILTLIGCLVPYNDPRLLNGSSSVDAAASPLVIAIENG 371

Query: 375 GVKIVPHIINAVILISVVSVANSSLYAGPRLICSLAQQGYAPKFLDYVDREGRPLRALIV 434
           G+K +P ++NA+ILI++VSVANS++YA  R + S+A  G  PKFL  VD+ GRPL A+++
Sbjct: 372 GIKGLPSLMNAIILIAIVSVANSAVYACSRCMVSMAHIGNLPKFLSKVDKRGRPLNAILL 431

Query: 435 CCVFGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELG 494
              FG+++F+AAS K+E VFTWL+A++GLS +F W +I LS +RFR AMK QGRSLDE+ 
Sbjct: 432 TLFFGLLSFIAASDKQEEVFTWLSALSGLSTIFCWMAINLSLIRFRDAMKAQGRSLDEMP 491

Query: 495 YKATTGIWGSIYGVFFNILVFVAQFWVALAPLGNGGKCDAESFFQNYLAFPIWLAFYFGY 554
           + + +G WG+ YGV    LV VA FW +L P+G+     A+SFF+ YL+ PI +A Y G+
Sbjct: 492 FLSQSGTWGAWYGVIVLFLVLVASFWTSLFPVGS-STASAKSFFEGYLSLPILIACYVGH 550

Query: 555 MVYNRDFTLLNPLDKIDLDFHRRIYD 580
            ++ RD+ LL PL ++DLD  RR+ D
Sbjct: 551 KLWKRDWRLLVPLMEMDLDSGRRVLD 576

>AGR319W [4630] [Homologous to ScYGR191W (HIP1) - SH]
           complement(1327939..1329819) [1881 bp, 626 aa]
          Length = 626

 Score =  456 bits (1173), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 261/607 (42%), Positives = 369/607 (60%), Gaps = 25/607 (4%)

Query: 9   SSGKKETSPDSISIRSFSAGNNFQSSSSEK----TYSKQKSGSDKLIHRFADSFKRA-EG 63
           +S K+E S      RS+      QS SSE     +   +    D    R  + FKRA EG
Sbjct: 16  TSTKQEMSNS----RSYLTTTAHQSLSSEALSMGSLDARSPQKDVWYTRLLNDFKRADEG 71

Query: 64  STTRT----------KQINENTSDLEDGV-ESITSDSKLKKSMKSRHVVMMSLGTGIGTG 112
            TTR+          K+  E T D+E  V ++  + S+L K++  RH++ +++G  IGTG
Sbjct: 72  ETTRSVADSDMEVDGKRYKEMT-DVERAVCDAARNSSQLSKNLSIRHLLTLAVGGAIGTG 130

Query: 113 LLVANAKGLHYGGPAALIIGYILVSFETYFMIQAAGEMAVTYPTLPANFNAYSSIFISKS 172
           L V +   L+ GGP +++I + L+S   + ++ + GE+A  +P +   FN Y + F+  S
Sbjct: 131 LFVNSGASLNTGGPGSILIAWTLISTCLFTIVNSLGELASAFPVV-GGFNVYITRFVEPS 189

Query: 173 FGFATVWLYCFQWLTVLPLELITASMTIQFGNDKINPDIYILIFYVFLVFIHFFGVKAYG 232
           FGFA    Y  QW  +LPLEL  AS+TI++ N+KIN D ++ IFYV +   +   VK++G
Sbjct: 190 FGFAVNISYLAQWAVLLPLELAAASITIKYWNNKINSDAWVAIFYVCIALANMLDVKSFG 249

Query: 233 ETEFIFNCCKILMIAGFIILSIVINCGGAGNDGYIGATYWHNPGAFAGDTSIGRFKNVCY 292
           ETEF+ +  KIL I GF IL  V+ CGG    G+IGA YWH+PGAF GDT   +FK +C 
Sbjct: 250 ETEFVLSMVKILAIFGFAILGTVLICGGGPVGGFIGAKYWHDPGAFVGDTPGAQFKGLCS 309

Query: 293 ILVTAYFSFGGMELFALSVQEQSNPRKSTPVAAKRSIYRIVVIYLLTMILIGFNVPYNDD 352
           + VTA FS+ G EL  +S  E  NPR + P A+KRS + I   YLL + + G  VP ND 
Sbjct: 310 VFVTAAFSYSGTELVGVSAAESINPRYTIPRASKRSFWLITSSYLLVLTIAGCLVPSNDP 369

Query: 353 QLM-GAGGSATHASPYVLAASIHGVKIVPHIINAVILISVVSVANSSLYAGPRLICSLAQ 411
           +L+ G       ASP V+A    G++ VP ++NA+ILI+++SVANSS+YA  R + S+AQ
Sbjct: 370 RLLNGMSSVDVAASPLVIAIENGGIRGVPSLMNAIILIAIISVANSSVYACSRCMVSMAQ 429

Query: 412 QGYAPKFLDYVDREGRPLRALIVCCVFGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTS 471
            G  PK  +Y+DR+GRPL A++   VFG+++FVAAS K+E +FTWL+A++GLS LF W +
Sbjct: 430 VGNLPKVFNYIDRKGRPLVAILATLVFGLLSFVAASDKQEAIFTWLSALSGLSTLFCWFA 489

Query: 472 IMLSHLRFRQAMKVQGRSLDELGYKATTGIWGSIYGVFFNILVFVAQFWVALAPLGNGGK 531
           I +SH+RFR+AM  Q RSLDEL Y + TG+ GS YG    + V V  FW +L P G+ G 
Sbjct: 490 INISHIRFRRAMCAQQRSLDELPYLSLTGVLGSWYGAAVLLFVLVLSFWTSLFPPGSSGP 549

Query: 532 CDAESFFQNYLAFPIWLAFYFGYMVYNRDFTLLNPLDKIDLDFHRRIYD-PELMRQEDEE 590
             AESFF+ YL+FPI+L  Y  + +Y RD+ L  P  +ID+D  RR  D  EL  Q+  E
Sbjct: 550 -SAESFFEGYLSFPIFLICYISHKLYKRDWRLFIPAGQIDVDSGRRALDIEELKEQKLRE 608

Query: 591 NKEKLRN 597
             E  + 
Sbjct: 609 QAETAKK 615

>YGR191W (HIP1) [2141] chr7 (880423..882234) Histidine permease,
           member of the amino acid permease family of membrane
           transporters [1812 bp, 603 aa]
          Length = 603

 Score =  452 bits (1162), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 239/530 (45%), Positives = 344/530 (64%), Gaps = 12/530 (2%)

Query: 64  STTRTKQINENTSDL---------EDGVESITSDSKLKKSMKSRHVVMMSLGTGIGTGLL 114
           S+  +  IN+ T+D+         ED  +   +++ L K +  RH++ +++G  IGTGL 
Sbjct: 50  SSKDSPGINQTTNDITSSDRFRRNEDTEQEDINNTNLSKDLSVRHLLTLAVGGAIGTGLY 109

Query: 115 VANAKGLHYGGPAALIIGYILVSFETYFMIQAAGEMAVTYPTLPANFNAYSSIFISKSFG 174
           V     L  GGPA+L+I ++++S   + +I + GE++  +P +   FN YS  FI  SF 
Sbjct: 110 VNTGAALSTGGPASLVIDWVIISTCLFTVINSLGELSAAFPVV-GGFNVYSMRFIEPSFA 168

Query: 175 FATVWLYCFQWLTVLPLELITASMTIQFGNDKINPDIYILIFYVFLVFIHFFGVKAYGET 234
           FA    Y  QWL +LPLEL+ AS+TI++ NDKIN D ++ IFY  +   +   VK++GET
Sbjct: 169 FAVNLNYLAQWLVLLPLELVAASITIKYWNDKINSDAWVAIFYATIALANMLDVKSFGET 228

Query: 235 EFIFNCCKILMIAGFIILSIVINCGGAGNDGYIGATYWHNPGAFAGDTSIGRFKNVCYIL 294
           EF+ +  KIL I GF IL IV++CGG  + GYIG  YWH+PGAF G +S  +FK +C + 
Sbjct: 229 EFVLSMIKILSIIGFTILGIVLSCGGGPHGGYIGGKYWHDPGAFVGHSSGTQFKGLCSVF 288

Query: 295 VTAYFSFGGMELFALSVQEQSNPRKSTPVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQL 354
           VTA FS+ G+E+ A+S  E  NPR++ P AAKR+ + I   Y+  + LIG  VP ND +L
Sbjct: 289 VTAAFSYSGIEMTAVSAAESKNPRETIPKAAKRTFWLITASYVTILTLIGCLVPSNDPRL 348

Query: 355 MGAGGSATHA-SPYVLAASIHGVKIVPHIINAVILISVVSVANSSLYAGPRLICSLAQQG 413
           +    S   A SP V+A    G+K +P ++NA+ILI+VVSVANS++YA  R + ++A  G
Sbjct: 349 LNGSSSVDAASSPLVIAIENGGIKGLPSLMNAIILIAVVSVANSAVYACSRCMVAMAHIG 408

Query: 414 YAPKFLDYVDREGRPLRALIVCCVFGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIM 473
             PKFL+ VD+ GRP+ A+++   FG+++FVAAS K+  VFTWL+A++GLS +F W +I 
Sbjct: 409 NLPKFLNRVDKRGRPMNAILLTLFFGLLSFVAASDKQAEVFTWLSALSGLSTIFCWMAIN 468

Query: 474 LSHLRFRQAMKVQGRSLDELGYKATTGIWGSIYGVFFNILVFVAQFWVALAPLGNGGKCD 533
           LSH+RFRQAMKVQ RSLDEL + + TG+ GS YG     LV +A FW +L PLG  G   
Sbjct: 469 LSHIRFRQAMKVQERSLDELPFISQTGVKGSWYGFIVLFLVLIASFWTSLFPLGGSG-AS 527

Query: 534 AESFFQNYLAFPIWLAFYFGYMVYNRDFTLLNPLDKIDLDFHRRIYDPEL 583
           AESFF+ YL+FPI +  Y G+ +Y R++TL+  L+ +DLD  R+  D  L
Sbjct: 528 AESFFEGYLSFPILIVCYVGHKLYTRNWTLMVKLEDMDLDTGRKQVDLTL 577

>KLLA0A11770g 1014918..1016663 similar to sp|P06775 Saccharomyces
           cerevisiae YGR191w HIP1 histidine permease, start by
           similarity
          Length = 581

 Score =  445 bits (1144), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 242/570 (42%), Positives = 359/570 (62%), Gaps = 13/570 (2%)

Query: 36  SEKTYSKQKSGSDKLIHRFADSFKRAEGSTTRTKQIN-----ENTSDLEDGVESI--TSD 88
           S+   +KQ+  S   +     SF + E  +   KQ+      ++ +D+ D  ++I  T D
Sbjct: 5   SKNMDTKQQDLSS--LSEVGQSFAKEETWSVE-KQLKPLAEEKDYADMNDVEKAIYNTKD 61

Query: 89  SKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALIIGYILVSFETYFMIQAAG 148
           SKL K +  RH++ +++G  IGTGL V +   L  GGPA+L+I + ++S   + ++ + G
Sbjct: 62  SKLNKDLSIRHLLTLAVGGAIGTGLFVNSGDSLSTGGPASLVIAWTIISTCLFTIVNSLG 121

Query: 149 EMAVTYPTLPANFNAYSSIFISKSFGFATVWLYCFQWLTVLPLELITASMTIQFGNDKIN 208
           E++ T+P +   FN Y + F+  SFGFA  + Y  QW  +LPLEL  AS+TI++ N  IN
Sbjct: 122 ELSATFPVV-GGFNVYVTRFVEPSFGFAVNFNYLAQWAILLPLELCAASITIRYWNKSIN 180

Query: 209 PDIYILIFYVFLVFIHFFGVKAYGETEFIFNCCKILMIAGFIILSIVINCGGAGNDGYIG 268
           PD ++ IFYV + F +   VK++GETEF+ +  KIL I GF IL IV+ CGG  + G+IG
Sbjct: 181 PDAWVSIFYVAIAFANMLDVKSFGETEFVLSMVKILAIIGFTILGIVLICGGGPSGGFIG 240

Query: 269 ATYWHNPGAFAGDTSIGRFKNVCYILVTAYFSFGGMELFALSVQEQSNPRKSTPVAAKRS 328
             YW++PGAF GDT   RFK +  + +TA FS+ G+EL  +S  E  NPR + P AAKR+
Sbjct: 241 GKYWNDPGAFVGDTPAQRFKGLSAVFITAAFSYSGLELVGVSAAESRNPRVTLPKAAKRT 300

Query: 329 IYRIVVIYLLTMILIGFNVPYNDDQLM-GAGGSATHASPYVLAASIHGVKIVPHIINAVI 387
            + I + YL+ + LIG  VP ND  L+ G       ASP V+A    G+K +P ++NA+I
Sbjct: 301 FWLITMSYLVILTLIGCLVPSNDPLLLNGTSSVDAAASPLVIAIQNGGIKGLPSLMNAII 360

Query: 388 LISVVSVANSSLYAGPRLICSLAQQGYAPKFLDYVDREGRPLRALIVCCVFGVIAFVAAS 447
           LI+++SVANS++YA  R I S+A+ G  P+ L +VD++GRPL A+ +  + G+++F+AAS
Sbjct: 361 LIALLSVANSAVYACSRCIISMAEIGNLPRSLAHVDKKGRPLYAIAITLLVGLLSFIAAS 420

Query: 448 SKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGYKATTGIWGSIYG 507
           +K + VFTWL+A++GLS LF W +I L+HLRFR AMK Q RSL+EL Y + TG WGS YG
Sbjct: 421 NKRDEVFTWLSALSGLSTLFCWFAINLAHLRFRHAMKHQNRSLEELPYVSMTGEWGSWYG 480

Query: 508 VFFNILVFVAQFWVALAPLGNGGKCDAESFFQNYLAFPIWLAFYFGYMVYNRDFTLLNPL 567
                LV +A FW +L P G  G  DA SFF++YL+ PI++A Y G+ ++ R+  L   L
Sbjct: 481 CIVIGLVLIASFWTSLFPAGGNG-ADATSFFESYLSLPIFIACYLGHKIWKRNLRLYIKL 539

Query: 568 DKIDLDFHRRIYDPELMRQEDEENKEKLRN 597
            ++D+D  R   D   ++QE E   E ++ 
Sbjct: 540 SEVDVDSGRTDTDAATLKQEKEAEAELMKT 569

>KLLA0F01012g complement(90772..92442) similar to sp|P48813
           Saccharomyces cerevisiae YDR508c GNP1 high-affinity
           glutamine permease, hypothetical start
          Length = 556

 Score =  439 bits (1130), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 219/517 (42%), Positives = 323/517 (62%), Gaps = 13/517 (2%)

Query: 66  TRTKQINENTSDLEDGVESITSDSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGG 125
           TRT  I + T+D+          ++LK+S+K  HV MMS  TGIGTGLLV N + +   G
Sbjct: 19  TRTNSI-DTTADVT------LPKNELKQSIKPFHVFMMSTATGIGTGLLVGNGRSIAIAG 71

Query: 126 PAALIIGYILVSFETYFMIQAAGEMAVTYPTLPANFNAYSSIFISKSFGFATVWLYCFQW 185
               ++GY+++       +Q  GE+ V +P++P  F +Y   FI  S GF   WL+   W
Sbjct: 72  VGGTLVGYLIIGIMLTCCMQTVGELVVAFPSMPGGFTSYGKRFIDPSVGFTISWLFFLNW 131

Query: 186 LTVLPLELITASMTIQFGNDKINPDIYILIFYVFLVFIHFFGVKAYGETEFIFNCCKILM 245
             VLPLE+  ASMTI F N+ INP I + + Y  +  ++FFG + Y + + IFNC K+LM
Sbjct: 132 TVVLPLEICVASMTINFWNENINPSIVVALCYSLVCGVNFFGARCYADADCIFNCLKVLM 191

Query: 246 IAGFIILSIVINCGGAGNDGYIGATYWHNPGAFAGDTSIGRFKNVCYILVTAYFSFGGME 305
           I GFIIL I +N G  G  GY+G  Y+H+PG F  D   G FK++   L+TA FS GG E
Sbjct: 192 ILGFIILGIFVNTGVVGTSGYLGFKYFHSPGFFRNDE--GLFKSIAATLITACFSTGGTE 249

Query: 306 LFALSVQEQSN---PRKSTPVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLMGAGGSAT 362
             ALS  EQ+    PR S   A+ + + RI +I+ +++++IG  VP+N   LMG+G   T
Sbjct: 250 FVALSCAEQNTEDMPR-SIKRASIQVVVRIAIIFCVSLMIIGLLVPFNSPYLMGSGSELT 308

Query: 363 HASPYVLAASIHGVKIVPHIINAVILISVVSVANSSLYAGPRLICSLAQQGYAPKFLDYV 422
           HASPYV+A + +GV+I+PHI+NA+IL+S++SVAN+++Y+  R + SLA+QG+A K+   +
Sbjct: 309 HASPYVVALTTNGVRIIPHIVNAIILLSIISVANNAMYSSSRTLHSLAEQGFAMKYFCKL 368

Query: 423 DREGRPLRALIVCCVFGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQA 482
           D  G+P R L V    G+ +F+A    +E VF WL +I+GLS +FTW+   +SHLRFR+A
Sbjct: 369 DESGKPFRCLCVSAFTGLFSFIAEYKDQETVFVWLLSISGLSTIFTWSMTCVSHLRFRKA 428

Query: 483 MKVQGRSLDELGYKATTGIWGSIYGVFFNILVFVAQFWVALAPLGNGGKCDAESFFQNYL 542
           MK Q ++LD+LGY++  G++GS   +F   ++ + QFWV+L PL + G+ +  SF QNY+
Sbjct: 429 MKDQDQALDQLGYQSPCGVYGSYISLFICAIILIVQFWVSLFPLESNGRLNVVSFLQNYM 488

Query: 543 AFPIWLAFYFGYMVYNRDFTLLNPLDKIDLDFHRRIY 579
           A PI +  Y G+  Y  ++       +ID+   R IY
Sbjct: 489 AVPITIVLYLGHKAYTGNWKPFIRAPEIDIQTDRDIY 525

>Scas_479.1
          Length = 595

 Score =  439 bits (1128), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 236/540 (43%), Positives = 342/540 (63%), Gaps = 15/540 (2%)

Query: 72  NENTSD--LEDGVESITSDSK---------LKKSMKSRHVVMMSLGTGIGTGLLVANAKG 120
           NE + D  +ED ++ ITS S          L K +  RH++ +++G  IG GL V +   
Sbjct: 49  NEKSKDSPIEDNID-ITSQSSVTKEDINKSLNKDLSIRHLLTLAVGGAIGVGLFVNSGAA 107

Query: 121 LHYGGPAALIIGYILVSFETYFMIQAAGEMAVTYPTLPANFNAYSSIFISKSFGFATVWL 180
           L  GGPA+L+I ++++S   + +I + GE+A  +P +   FN Y + F+  SF FA    
Sbjct: 108 LASGGPASLVIDWVIISTCLFTVINSLGELAAAFPVV-GGFNVYITRFVDPSFAFAVNLN 166

Query: 181 YCFQWLTVLPLELITASMTIQFGNDKINPDIYILIFYVFLVFIHFFGVKAYGETEFIFNC 240
           Y  QWL +LPLEL+ AS+TI++ N  IN D ++ IFY  +   +   VK++GETEF+ + 
Sbjct: 167 YLAQWLVLLPLELVAASITIKYWNSTINSDAWVAIFYTVITLANMLDVKSFGETEFVLSM 226

Query: 241 CKILMIAGFIILSIVINCGGAGNDGYIGATYWHNPGAFAGDTSIGRFKNVCYILVTAYFS 300
            KIL I GF IL IV++CGG    GY+G  YWHNPGAF G TS  +FK +C + VTA FS
Sbjct: 227 VKILAIIGFTILGIVLSCGGGPKGGYLGGKYWHNPGAFVGHTSGTKFKGLCSVFVTAAFS 286

Query: 301 FGGMELFALSVQEQSNPRKSTPVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLM-GAGG 359
           + G+E+ A+S  E  +PRK+ P AAKR+ + I   Y+  + L+G  VPY+D +LM G   
Sbjct: 287 YSGIEMTAVSAAESKDPRKTIPKAAKRTFWLITASYVTILTLVGCLVPYDDPRLMSGTSS 346

Query: 360 SATHASPYVLAASIHGVKIVPHIINAVILISVVSVANSSLYAGPRLICSLAQQGYAPKFL 419
               ASP V+A    G+K +  ++NA+ILIS++SVANS++YA  R + S+A  G  PK L
Sbjct: 347 VDAAASPLVIAIENGGIKGLDSLMNAIILISIISVANSAVYACSRCMVSMAHIGNLPKKL 406

Query: 420 DYVDREGRPLRALIVCCVFGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRF 479
             VD+ GRP+ A +V   FG+++F+AAS K+  VFTWL+A++GLS +F W +I +SH+RF
Sbjct: 407 GKVDKRGRPINATLVTLFFGLLSFIAASDKQNEVFTWLSALSGLSTIFCWMAINISHIRF 466

Query: 480 RQAMKVQGRSLDELGYKATTGIWGSIYGVFFNILVFVAQFWVALAPLGNGGKCDAESFFQ 539
           RQAM  Q RSLDE+ Y + TG+WGS+YGV    LV VA FW +L PLG G   D +SFF+
Sbjct: 467 RQAMIKQNRSLDEMPYLSQTGVWGSLYGVVVLFLVLVASFWTSLFPLG-GDSADVQSFFE 525

Query: 540 NYLAFPIWLAFYFGYMVYNRDFTLLNPLDKIDLDFHRRIYDPELMRQEDEENKEKLRNMS 599
            YL+ PI +  Y G+ +Y ++++ +  L+++DLD  R+  DP L R E    +  +  MS
Sbjct: 526 GYLSLPILIVCYIGHKLYFKNWSWVVTLEEMDLDTGRKALDPHLHRAEVLAEEAAVAKMS 585

>Scas_507.1
          Length = 592

 Score =  437 bits (1125), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 247/582 (42%), Positives = 356/582 (61%), Gaps = 22/582 (3%)

Query: 7   FGSSGKKETSPDSIS-IRSFSAGN---NFQSSSSEKTYSKQKSGSDKLIHRFADSFKRAE 62
            GS  K+E   + I+  +S  AGN   NF     + T S   S   K+ H      ++ +
Sbjct: 2   LGSPLKREYWNEMITGSKSSEAGNIDANFALEEKDSTLSPLASLDSKVPH------EKIQ 55

Query: 63  GSTTRTKQINENTSDLEDGVESITSDSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLH 122
            +T     I+      ED + ++     L K++  RH++ +++G  IG GL V +   L 
Sbjct: 56  TTTDFASVISH-----EDDINNV----NLNKNLSIRHLLTLAVGGSIGVGLFVNSGAALA 106

Query: 123 YGGPAALIIGYILVSFETYFMIQAAGEMAVTYPTLPANFNAYSSIFISKSFGFATVWLYC 182
            GGPA+L+I +I++S   + +I A GEMA  +P +   FN Y + FI  S GFA    Y 
Sbjct: 107 SGGPASLVIDWIIISTCLFTVINALGEMAAAFPVV-GGFNVYITRFIDPSVGFAVNINYL 165

Query: 183 FQWLTVLPLELITASMTIQFGNDKINPDIYILIFYVFLVFIHFFGVKAYGETEFIFNCCK 242
            QWL +LPLEL+ ASMTI++ N+ IN D ++ IFY  +   +   VK++GETEF+ +  K
Sbjct: 166 AQWLVLLPLELVAASMTIKYWNETINSDAWVAIFYCVIALANMLEVKSFGETEFVLSMIK 225

Query: 243 ILMIAGFIILSIVINCGGAGNDGYIGATYWHNPGAFAGDTSIGRFKNVCYILVTAYFSFG 302
           IL I GF IL IV+ CGG  + G+IG  YW++PG+F G  S  +FK +C + VTA FS+ 
Sbjct: 226 ILAIIGFTILGIVLACGGGPHGGFIGGKYWNHPGSFVGHNSGTKFKGLCSVFVTAAFSYS 285

Query: 303 GMELFALSVQEQSNPRKSTPVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLMGAGGSAT 362
           G+E+ A+S  E  +PR + P AAKR+ + I   Y+  + LIG  VPY+D +L+    S  
Sbjct: 286 GIEMTAVSAAESKDPRTTIPKAAKRTFWLITASYVTILTLIGCLVPYDDPRLLSGTSSVD 345

Query: 363 HA-SPYVLAASIHGVKIVPHIINAVILISVVSVANSSLYAGPRLICSLAQQGYAPKFLDY 421
            A SP V+A    G+K +P ++NA+ILIS++SVANS++YA  R + ++A  G  P+ L+ 
Sbjct: 346 AASSPLVIAIENDGIKGLPSLMNAIILISIISVANSAVYACSRCMVAMAHIGNVPRILNR 405

Query: 422 VDREGRPLRALIVCCVFGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQ 481
           VD +GRP+ A+I    FG+++FVAAS ++  VFTWL+A++GLS +F W +I LSH+RFRQ
Sbjct: 406 VDTKGRPMNAIIFTLFFGLLSFVAASDRQADVFTWLSALSGLSTIFCWMAINLSHIRFRQ 465

Query: 482 AMKVQGRSLDELGYKATTGIWGSIYGVFFNILVFVAQFWVALAPLGNGGKCDAESFFQNY 541
           +M  Q RSLDEL + + TG+WGS YG     LV VA FW +L PLG G   DAESFF+ Y
Sbjct: 466 SMAKQNRSLDELPFLSQTGVWGSWYGTIVLFLVLVASFWTSLFPLG-GTSADAESFFEGY 524

Query: 542 LAFPIWLAFYFGYMVYNRDFTLLNPLDKIDLDFHRRIYDPEL 583
           L+FPI LA YFG+ +Y R    +  L  +DLD  RR  D ++
Sbjct: 525 LSFPILLACYFGHKLYVRKREFMVGLADMDLDTGRRQVDLDV 566

>Scas_607.4
          Length = 599

 Score =  430 bits (1105), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 219/514 (42%), Positives = 326/514 (63%), Gaps = 16/514 (3%)

Query: 89  SKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALIIGYILVSFETYFMIQAAG 148
           + LK+S+K+RH++M+++G  IGTGL V + + +  GGP A++IG+ +   +    I   G
Sbjct: 83  NNLKRSLKARHLIMIAIGGSIGTGLFVGSGQAIATGGPLAVVIGWAIAGSQIIGTIHGLG 142

Query: 149 EMAVTYPTLPANFNAYSSIFISKSFGFATVWLYCFQWLTVLPLELITASMTIQFGNDKIN 208
           E+ V +P + A F  YS+ F+  S  F    +Y  QW  VLPLE+I+++MT+Q+ N  I+
Sbjct: 143 EITVRFPVVGA-FANYSTRFLDPSLSFVISTIYVIQWFFVLPLEIISSAMTVQYWNQSID 201

Query: 209 PDIYILIFYVFLVFIHFFGVKAYGETEFIFNCCKILMIAGFIILSIVINCGGAGNDGYIG 268
           P +++ IFY  +V I+ FG + +GE EF+F+  K+L I GFIIL IV+ CGG  +  ++G
Sbjct: 202 PVVWVAIFYCAIVSINLFGARGFGEAEFVFSSVKVLTICGFIILCIVLICGGGPDHDFVG 261

Query: 269 ATYWHNPGAFAGDTSIGRFKNVCYILVTAYFSFGGMELFALSVQEQSNPRKSTPVAAKRS 328
           A YWH+PG  A       F  V  +LV A +S GG E+  L+  E ++P K  P A K++
Sbjct: 262 AKYWHDPGCLAHG-----FPGVLSVLVVASYSLGGTEMVCLASGE-TDP-KELPSAIKQT 314

Query: 329 IYRIVVIYLLTMILIGFNVPYNDDQLMGAGGSATHASPYVLAASIHGVKIVPHIINAVIL 388
            +RI+  +L+++ LIGF VPY ++ L+G  GS+ + SP+V+A  +H +K++P I+NAVIL
Sbjct: 315 FWRILFFFLVSLTLIGFLVPYTNENLLG--GSSVNNSPFVIAIKLHQIKVLPSIVNAVIL 372

Query: 389 ISVVSVANSSLYAGPRLICSLAQQGYAPKFLDYVDREGRPLRALIVCCVFGVIAFVAASS 448
           IS++SV NS ++A  R +CS+A QG  P+F  Y+DR GRPL  +I   +FG++AF+  SS
Sbjct: 373 ISILSVGNSCIFASSRTLCSMAHQGLIPRFFGYIDRAGRPLTGIITNSLFGLLAFLVKSS 432

Query: 449 KEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGYKATTGIWGSIYGV 508
               VF WL AIAGL+    W SI +SH+RFR AMK QGRSLDEL + +  GIWGS Y  
Sbjct: 433 SMSEVFDWLMAIAGLATCIVWLSINISHIRFRLAMKAQGRSLDELEFVSAVGIWGSAYSA 492

Query: 509 FFNILVFVAQFWVALAPLG--NGGKCDAESFFQNYLAFPIWLAFYFGYMVYNR----DFT 562
             N L+ VAQF+ AL P+G        A+ FFQ+YL   I +  + G+ ++ R     + 
Sbjct: 493 VINSLILVAQFYCALWPIGGWENSSIRAKKFFQSYLCALIMIVLFVGHKIFYRYKTGKWW 552

Query: 563 LLNPLDKIDLDFHRRIYDPELMRQEDEENKEKLR 596
            + PL+KIDL+  R+  D E+++QE  E    LR
Sbjct: 553 SMLPLNKIDLETDRKNIDIEILKQEIAERNRHLR 586

>KLLA0A06930g complement(625498..627261) similar to sp|P19145
           Saccharomyces cerevisiae YKR039w GAP1 general amino acid
           permease, hypothetical start
          Length = 587

 Score =  424 bits (1090), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 238/542 (43%), Positives = 346/542 (63%), Gaps = 15/542 (2%)

Query: 52  HRFADSFKRAEGSTTRTKQINENTSDLEDGVESITSDSKLKKSMKSRHVVMMSLGTGIGT 111
            RF DSF+ AE     T  ++ + +  E  +  +T+++ LK+++KSRH+ M+ +G  IGT
Sbjct: 43  ERFKDSFREAE-----TVDLDPSLTPAEK-MAILTANAPLKRTLKSRHLQMIGIGGAIGT 96

Query: 112 GLLVANAKGLHYGGPAALIIGYILVSFETYFMIQAAGEMAVTYPTLPANFNAYSSIFISK 171
           GL V + K L   GPA ++IG+ L     Y M+ A GE+AVT+P +   +  Y+S F+ +
Sbjct: 97  GLFVGSGKSLATAGPAGILIGWALTGTMIYCMVMAMGELAVTFP-VAGGYTTYASRFVDE 155

Query: 172 SFGFATVWLYCFQWLTVLPLELITASMTIQF-GNDKINPDIYILIFYVFLVFIHFFGVKA 230
           SFGFA   +Y   WL  LPLE++ AS+T+ + G      D ++ +FYV +V I+ FGVK 
Sbjct: 156 SFGFAFNTVYAMGWLITLPLEIVAASITVNYWGTPAKYRDAFVALFYVVIVGINLFGVKG 215

Query: 231 YGETEFIFNCCKILMIAGFIILSIVINCGGAGNDGYIGATYWHNPGAFAGDTSIGRFKNV 290
           YGE EFIF+  K++ + GFIIL +++ CGG    GYIG   WHNPGAFA       FK V
Sbjct: 216 YGEAEFIFSFIKVIAVIGFIILGVILVCGGGPQGGYIGGRLWHNPGAFANG-----FKGV 270

Query: 291 CYILVTAYFSFGGMELFALSVQEQSNPRKSTPVAAKRSIYRIVVIYLLTMILIGFNVPYN 350
           C + VTA FSF G EL  L+  E +NPRKS P AAK+  +RI + Y+L ++++G  VPY 
Sbjct: 271 CSVFVTAAFSFAGSELVGLAAAETANPRKSIPSAAKQVFWRITLFYILALLMVGLLVPYT 330

Query: 351 DDQLMGAGGSATHASPYVLAASIHGVKIVPHIINAVILISVVSVANSSLYAGPRLICSLA 410
            D+L+G       ASP+V++    G+K +P +IN VILI+V+SV N +++   R + +LA
Sbjct: 331 SDRLIGQSSVDAAASPFVISIQNAGIKGLPSVINVVILIAVLSVGNCAVFGCSRSMAALA 390

Query: 411 QQGYAPKFLDYVDREGRPLRALIVCCVFGVIAFVAASSKEEIVFTWLAAIAGLSELFTWT 470
            QG  PK   Y+DR GRPL  ++V CVFG+++F+AAS KE  VF WL A++GLS LFTW 
Sbjct: 391 NQGSLPKIFGYIDRTGRPLVGIVVTCVFGLLSFIAASPKEGEVFDWLLALSGLSSLFTWG 450

Query: 471 SIMLSHLRFRQAMKVQGRSLDELGYKATTGIWGSIYGVFFNILVFVAQFWVALAPLGNGG 530
            I+L H+R R+A+  Q R+  EL + A T +WGS+Y +   IL+ +AQFW+AL P+  GG
Sbjct: 451 GILLCHIRVRRALAAQNRTTAELSFTAPTDVWGSVYSLILIILILIAQFWIALFPI--GG 508

Query: 531 KCDAESFFQNYLAFPIWLAFYFGYMVYNRDFTLLNPLDKIDLDFHRRIYDPELMRQEDEE 590
           K  A +FF+ YL+FPI++ FY G+ ++ +++ L      ID+D  RR  D E ++QE  E
Sbjct: 509 KPSAAAFFEAYLSFPIYIVFYIGHKIWKKNWKLFIKASDIDIDSGRRETDIEALKQEIAE 568

Query: 591 NK 592
            K
Sbjct: 569 EK 570

>AFR230C [3422] [Homologous to ScYKR039W (GAP1) - NSH]
           (855416..857230) [1815 bp, 604 aa]
          Length = 604

 Score =  417 bits (1073), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 213/546 (39%), Positives = 335/546 (61%), Gaps = 11/546 (2%)

Query: 54  FADSFKRAEGSTTRTKQINENTSDLEDGVESITSDSKLKKSMKSRHVVMMSLGTGIGTGL 113
           F D+F+RAE        I+ N S+ E  +   T+ + L + +K+RH+ M+++G  IG GL
Sbjct: 52  FVDTFRRAE-----MPVIDPNLSEAEK-LAIRTAAAPLSRRLKNRHLQMIAIGGAIGVGL 105

Query: 114 LVANAKGLHYGGPAALIIGYILVSFETYFMIQAAGEMAVTYPTLPANFNAYSSIFISKSF 173
            V + K L   GPA ++IG+ L +     M  + GE+AVT+P +   +  Y++ FI +S+
Sbjct: 106 FVGSGKALATAGPAGVLIGWGLTATMILIMCLSLGELAVTFP-VSGGYITYAARFIDESW 164

Query: 174 GFATVWLYCFQWLTVLPLELITASMTIQFGN-DKINPDIYILIFYVFLVFIHFFGVKAYG 232
           GFA  + Y  Q + V+PLE++ AS+T+ + + D      ++ +F+V +V I+ FGV+ +G
Sbjct: 165 GFANNFNYMMQAMVVMPLEIVAASVTVGYWDTDPKYKLAFVALFWVVIVSINLFGVRGFG 224

Query: 233 ETEFIFNCCKILMIAGFIILSIVINCGGAGNDGYIGATYWHNPGAFAGDTSIGRFKNVCY 292
           E E IF+  K++ I GFII+ +V+  GG  +   IG  YW++PG F G+    +FK VC 
Sbjct: 225 EAESIFSLIKVITIIGFIIMGVVLISGGGPDHEVIGGKYWNDPGPFVGNAPSDKFKGVCS 284

Query: 293 ILVTAYFSFGGMELFALSVQEQSNPRKSTPVAAKRSIYRIVVIYLLTMILIGFNVPYNDD 352
           + VTA FSF G EL  L+  E   PRKS P AAK+  +RI + Y+L+++++G  VP N++
Sbjct: 285 VFVTAAFSFAGSELIGLAAAETREPRKSIPKAAKQVFWRITLFYILSLLIVGLLVPSNNE 344

Query: 353 QLMGAGGSATHASPYVLAASIHGVKIVPHIINAVILISVVSVANSSLYAGPRLICSLAQQ 412
            L+         SP+V+A  +H ++++P IIN VIL +V+SV NSS+Y+  R +C+LA+ 
Sbjct: 345 HLLAPQQIDAAHSPFVIAMDMHRIRVLPSIINVVILTAVISVGNSSVYSSSRTMCALAEH 404

Query: 413 GYAPKFLDYVDREGRPLRALIVCCVFGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSI 472
           G+ PK   Y+DR+GRPL A+    +FG++ FVA + +E  +F WL AI+GLS  FTW +I
Sbjct: 405 GFLPKIFGYIDRKGRPLFAICFTSLFGLLCFVAGAKEEGEIFDWLLAISGLSSFFTWLTI 464

Query: 473 MLSHLRFRQAMKVQGRSLDELGYKATTGIWGSIYGVFFNILVFVAQFWVAL---APLGNG 529
            L+H+RFR A+K QGR+ +EL + + TG  GS Y V    +V VAQFWVAL   +P G  
Sbjct: 465 NLAHMRFRMALKAQGRTTNELSFTSPTGFIGSCYAVGLICVVLVAQFWVALYPPSPDGTS 524

Query: 530 GKCDAESFFQNYLAFPIWLAFYFGYMVYNRDFTLLNPLDKIDLDFHRRIYDPELMRQEDE 589
            K     FF+ YL+F + +  Y  + +++R++       ++D+D  RR  D EL ++E  
Sbjct: 525 AKPSPILFFKQYLSFAVAIVMYLAHKIWSRNWKFFIKAKEMDIDTGRRELDLELFKEELA 584

Query: 590 ENKEKL 595
           + +  L
Sbjct: 585 QERALL 590

>CAGL0D02178g 222597..224330 highly similar to sp|P38967
           Saccharomyces cerevisiae YOL020w SCM2 high affinity
           tryptophan transport protein, hypothetical start
          Length = 577

 Score =  414 bits (1064), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 226/576 (39%), Positives = 337/576 (58%), Gaps = 25/576 (4%)

Query: 29  NNFQSSSSEKT-YSKQKSGSDKLIHRFADSFKRAEGSTTRTKQINENTSDLEDGVESITS 87
               +S+SE T Y  QK         +  S +  E   T+           +  V+    
Sbjct: 8   EEIHTSTSEFTKYDSQKP--------YYSSGESPEPVVTKRNIFQRCVDSFKPPVDGSFD 59

Query: 88  DSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALIIGYILVSFETYFMIQAA 147
            S LK+++KSRH++M+++G  IGTGL + + + L  GGP A+IIG+ +   +    I   
Sbjct: 60  TSNLKRTLKSRHLIMIAIGGSIGTGLFIGSGQALATGGPLAVIIGWTIAGSQIVGTIHGL 119

Query: 148 GEMAVTYPTLPANFNAYSSIFISKSFGFATVWLYCFQWLTVLPLELITASMTIQFGNDKI 207
           GE+ V +P + A F  YS+ F+  S  F    +Y  QW  VLPLE+I +++TIQ+ N  I
Sbjct: 120 GEITVRFPVVGA-FADYSTRFLDPSISFVVSTIYVIQWFFVLPLEIIASAITIQYWNSSI 178

Query: 208 NPDIYILIFYVFLVFIHFFGVKAYGETEFIFNCCKILMIAGFIILSIVINCGGAGNDGYI 267
           +P +++ IFY  +V I+ FG + +GE EF+F+  K + I GFIIL IV+ CGG  +  +I
Sbjct: 179 DPVVWVAIFYGVIVSINLFGARGFGEAEFVFSTIKAITICGFIILCIVLICGGGPDHEFI 238

Query: 268 GATYWHNPGAFAGDTSIGRFKNVCYILVTAYFSFGGMELFALSVQEQSNPRKSTPVAAKR 327
           GA YWH+PGA A       F  V  +LV A +S GG E+  L+  E ++P K  P A K+
Sbjct: 239 GAKYWHDPGALAHG-----FPGVLSVLVVASYSLGGTEMTCLASGE-TDP-KELPSAIKQ 291

Query: 328 SIYRIVVIYLLTMILIGFNVPYNDDQLMGAGGSATHASPYVLAASIHGVKIVPHIINAVI 387
             +RI+  +L ++ L+GF VPY ++ L+G  GS+   SP+V+A  +H +K +P I+NAVI
Sbjct: 292 VFWRILFFFLASLTLVGFLVPYTNENLLG--GSSVDNSPFVIAIKLHHIKALPSIVNAVI 349

Query: 388 LISVVSVANSSLYAGPRLICSLAQQGYAPKFLDYVDREGRPLRALIVCCVFGVIAFVAAS 447
           LIS++SV NS ++A  R +CS+A QG  P+F  Y+DR GRPL  ++   +FG++AF+  S
Sbjct: 350 LISILSVGNSCIFASSRTLCSMAHQGLIPRFFGYIDRAGRPLAGIVTNSLFGLLAFLVKS 409

Query: 448 SKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGYKATTGIWGSIYG 507
           S    VF WL AIAGL+    W SI LSH+RFR AMK Q ++LDEL + +  GIWGS Y 
Sbjct: 410 SSVSEVFDWLMAIAGLATCIVWLSINLSHIRFRLAMKAQNKTLDELEFVSAVGIWGSAYS 469

Query: 508 VFFNILVFVAQFWVALAPLGNGGKCD--AESFFQNYLAFPIWLAFYFGYMVYNR----DF 561
              N+L+ +AQF+++L P+G        A+ FFQ+YL   I L  +  + VY R     +
Sbjct: 470 ALINVLILIAQFYISLWPIGGWTDSSQRAKKFFQSYLCALIMLLIFCIHKVYYRVSFGKW 529

Query: 562 TLLNPLDKIDLDFHRRIYDPELMRQEDEENKEKLRN 597
             + PL  IDL+  R+  D ++++ E  E K  L+ 
Sbjct: 530 WDVKPLKDIDLETGRKNVDIDVIKAEIAERKMYLKK 565

>AEL030W [2476] [Homologous to ScYOL020W (TAT2) - SH]
           complement(577332..579551) [2220 bp, 739 aa]
          Length = 739

 Score =  416 bits (1070), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 213/538 (39%), Positives = 330/538 (61%), Gaps = 16/538 (2%)

Query: 62  EGSTTRTKQINENTSDLEDGVESITSDSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGL 121
           E  T +   +       +  V+       LK+++KSRH++M+++G  IGTGL + + K L
Sbjct: 196 ESRTNKRGLVRRCIDSFKPPVDGSFDPDNLKRTLKSRHLIMIAIGGSIGTGLFIGSGKAL 255

Query: 122 HYGGPAALIIGYILVSFETYFMIQAAGEMAVTYPTLPANFNAYSSIFISKSFGFATVWLY 181
             GGP A++IG+ L   +    I   GE+ V +P + A F  YS+ F+  S  F    +Y
Sbjct: 256 ATGGPLAVLIGWTLAGTQMVGTIHGLGEVTVRFPVVGA-FANYSTRFLDPSVSFVVSSIY 314

Query: 182 CFQWLTVLPLELITASMTIQFGNDKINPDIYILIFYVFLVFIHFFGVKAYGETEFIFNCC 241
             QW  VLPLE+I +++T++F    ++P +++ +FY  ++ I+ FGV+ +G+ +F+F+  
Sbjct: 315 VLQWFFVLPLEIIASAITMEFWTTSVDPVVWVAVFYTLIISINLFGVRWFGKPKFVFSVI 374

Query: 242 KILMIAGFIILSIVINCGGAGNDGYIGATYWHNPGAFAGDTSIGRFKNVCYILVTAYFSF 301
           K++ I GFIIL +V+  GG     +IGA YWH+PGA A       FK V  ++VTA +S 
Sbjct: 375 KMVPICGFIILCLVLILGGGPTHEFIGARYWHDPGALANG-----FKGVAAVMVTASYSL 429

Query: 302 GGMELFALSVQEQSNPRKSTPVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLMGAGGSA 361
           GG E+  L+  E ++P K  P A K+  +RI+  +L+++ L+GF VPY +DQL+G  GS 
Sbjct: 430 GGSEMTCLASGE-TDP-KEIPHAIKQIFWRIIFFFLVSLTLVGFLVPYTNDQLLG--GSN 485

Query: 362 THASPYVLAASIHGVKIVPHIINAVILISVVSVANSSLYAGPRLICSLAQQGYAPKFLDY 421
            + SP+V+A  +H ++++PHIIN VIL+S++SV NS ++A  R +CS+A QG  P+   Y
Sbjct: 486 VNNSPFVIAIKMHNIRVLPHIINGVILVSILSVGNSCIFASSRTLCSMAHQGLLPRIFGY 545

Query: 422 VDREGRPLRALIVCCVFGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQ 481
           VDR GRPL  ++   +FG++AF+  SS    VFTWL A+AGL+    W SI +SH+RFR 
Sbjct: 546 VDRAGRPLTGILTNSLFGLLAFLVKSSSTGTVFTWLMAVAGLATAVVWLSINVSHIRFRL 605

Query: 482 AMKVQGRSLDELGYKATTGIWGSIYGVFFNILVFVAQFWVALAPLG--NGGKCDAESFFQ 539
           AMK QG+SLDEL + +  G+WGS+Y    N++V VAQF+V+L P+      +   E+FFQ
Sbjct: 606 AMKAQGKSLDELEFVSAVGMWGSVYSGVMNVVVLVAQFYVSLWPIEGWKDPRGRTEAFFQ 665

Query: 540 NYLAFPIWLAFYFGYMVYNRDFT----LLNPLDKIDLDFHRRIYDPELMRQEDEENKE 593
           NYL   I L  +  + +Y R  T     + PL +IDL+  R+  D E+++ E    K+
Sbjct: 666 NYLCALILLFMFVAHKIYYRSTTGQWWKILPLAEIDLESGRKNIDIEVVKHEVAARKK 723

>YOL020W (TAT2) [4796] chr15 (286172..287950) High affinity
           tryptophan permease, also transports other aromatic
           amino acids, alanine and glycine, member of the amino
           acid permease family [1779 bp, 592 aa]
          Length = 592

 Score =  409 bits (1050), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 223/558 (39%), Positives = 327/558 (58%), Gaps = 36/558 (6%)

Query: 44  KSGSDKLIHRFADSFKRAEGSTTRTKQINENTSDLEDGVESITSDSKLKKSMKSRHVVMM 103
           + G   +  R  DSFK                S L+   ++    S LK+++K RH++M+
Sbjct: 51  QHGKRNIFQRCVDSFK----------------SPLDGSFDT----SNLKRTLKPRHLIMI 90

Query: 104 SLGTGIGTGLLVANAKGLHYGGPAALIIGYILVSFETYFMIQAAGEMAVTYPTLPANFNA 163
           ++G  IGTGL V + K +  GGP  ++IG+ +   +    I   GE+ V +P + A F  
Sbjct: 91  AIGGSIGTGLFVGSGKAIAEGGPLGVVIGWAIAGSQIIGTIHGLGEITVRFPVVGA-FAN 149

Query: 164 YSSIFISKSFGFATVWLYCFQWLTVLPLELITASMTIQFGNDKINPDIYILIFYVFLVFI 223
           Y + F+  S  F    +Y  QW  VLPLE+I A+MT+Q+ N  I+P I++ IFY  +V I
Sbjct: 150 YGTRFLDPSISFVVSTIYVLQWFFVLPLEIIAAAMTVQYWNSSIDPVIWVAIFYAVIVSI 209

Query: 224 HFFGVKAYGETEFIFNCCKILMIAGFIILSIVINCGGAGNDGYIGATYWHNPGAFAGDTS 283
           + FGV+ +GE EF F+  K + + GFIIL +V+ CGG  +  +IGA YWH+PG  A    
Sbjct: 210 NLFGVRGFGEAEFAFSTIKAITVCGFIILCVVLICGGGPDHEFIGAKYWHDPGCLANG-- 267

Query: 284 IGRFKNVCYILVTAYFSFGGMELFALSVQEQSNPRKSTPVAAKRSIYRIVVIYLLTMILI 343
              F  V  +LV A +S GG+E+  L+  E ++P K  P A K+  +RI+  +L+++ L+
Sbjct: 268 ---FPGVLSVLVVASYSLGGIEMTCLASGE-TDP-KGLPSAIKQVFWRILFFFLISLTLV 322

Query: 344 GFNVPYNDDQLMGAGGSATHASPYVLAASIHGVKIVPHIINAVILISVVSVANSSLYAGP 403
           GF VPY +  L+G  GS+   SP+V+A  +H +K +P I+NAVILISV+SV NS ++A  
Sbjct: 323 GFLVPYTNQNLLG--GSSVDNSPFVIAIKLHHIKALPSIVNAVILISVLSVGNSCIFASS 380

Query: 404 RLICSLAQQGYAPKFLDYVDREGRPLRALIVCCVFGVIAFVAASSKEEIVFTWLAAIAGL 463
           R +CS+A QG  P +  Y+DR GRPL  ++   +FG++AF+  S     VF WL AIAGL
Sbjct: 381 RTLCSMAHQGLIPWWFGYIDRAGRPLVGIMANSLFGLLAFLVKSGSMSEVFNWLMAIAGL 440

Query: 464 SELFTWTSIMLSHLRFRQAMKVQGRSLDELGYKATTGIWGSIYGVFFNILVFVAQFWVAL 523
           +    W SI LSH+RFR AMK QG+SLDEL + +  GIWGS Y    N L+ +AQF+ +L
Sbjct: 441 ATCIVWLSINLSHIRFRLAMKAQGKSLDELEFVSAVGIWGSAYSALINCLILIAQFYCSL 500

Query: 524 APLG--NGGKCDAESFFQNYLAFPIWLAFYFGYMVYNR----DFTLLNPLDKIDLDFHRR 577
            P+G    GK  A+ FFQNYL   I L  +  + +Y +     +  +  L  IDL+  R+
Sbjct: 501 WPIGGWTSGKERAKIFFQNYLCALIMLFIFIVHKIYYKCQTGKWWGVKALKDIDLETDRK 560

Query: 578 IYDPELMRQEDEENKEKL 595
             D E+++QE  E K  L
Sbjct: 561 DIDIEIVKQEIAEKKMYL 578

>KLLA0A10813g complement(936126..937880) similar to sp|P38967
           Saccharomyces cerevisiae YOL020w SCM2 high affinity
           tryptophan transport protein, hypothetical start
          Length = 584

 Score =  407 bits (1046), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 233/576 (40%), Positives = 348/576 (60%), Gaps = 42/576 (7%)

Query: 29  NNFQSSSSEKTYSKQKSGSDKLIHRFADSFKRAEGSTTRTKQINENTSDLEDGVESITSD 88
           +   S  +E    K++  +  ++ R  DSFK                    DG  S  SD
Sbjct: 28  DGIMSKETEIDLDKKEDKNKNIVRRMIDSFKPPL-----------------DG--SYHSD 68

Query: 89  SKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALIIGYILVSFETYFMIQAAG 148
           + LK+ +KSRH++M+++G  IGTGL V + K L  GGP A+IIG+ +   +    I   G
Sbjct: 69  N-LKRKLKSRHLIMIAIGGSIGTGLFVGSGKALATGGPLAMIIGWSIAGSQMVGTIHGLG 127

Query: 149 EMAVTYPTLPANFNAYSSIFISKSFGFATVWLYCFQWLTVLPLELITASMTIQFGNDKIN 208
           E+ + +P + A F  YS+  +  S  F    +Y  QW  VLP+ELI ++MT+QF   K++
Sbjct: 128 EITMRFPVVGA-FANYSTRLLDPSISFMVSSIYICQWYFVLPIELIASAMTVQFWTTKVD 186

Query: 209 PDIYILIFYVFLVFIHFFGVKAYGETEFIFNCCKILMIAGFIILSIVINCGGAGNDGYIG 268
           P +++ IFYV +V ++ FGVK +GE EF F+  K++ I GFIILSI++ CGG  +  +IG
Sbjct: 187 PVVWVAIFYVIVVSVNLFGVKVFGEAEFAFSLVKVITIIGFIILSIILICGGGPDHRFIG 246

Query: 269 ATYWHNPGAFAGDTSIGRFKNVCYILVTAYFSFGGMELFALSVQEQSNPRKSTPVAAKRS 328
             YWH+PGA A       FK V  + VTA +S GG E+  L   E ++P K  P A K+ 
Sbjct: 247 TEYWHHPGALANG-----FKGVASVFVTASYSLGGSEMVCLCSAE-TDP-KELPHAIKQV 299

Query: 329 IYRIVVIYLLTMILIGFNVPYNDDQLMGAGGSATHASPYVLAASIHGVKIVPHIINAVIL 388
            +RIV  +L+++ L+GF VPY ++ L+G  GS+ + SP+V+A  + G++++P IINAVIL
Sbjct: 300 FWRIVFFFLVSLTLVGFLVPYTNENLLG--GSSVNNSPFVIAIKLSGIRVLPSIINAVIL 357

Query: 389 ISVVSVANSSLYAGPRLICSLAQQGYAPKFLDYVDREGRPLRALIVCCVFGVIAFVAASS 448
           IS++SV NS ++A  R +CS+A QG  P+   YVDR GRPL  +IV  +FG++AF+  S+
Sbjct: 358 ISILSVGNSCIFASSRTLCSMAHQGLIPRVFGYVDRAGRPLVGIIVNSLFGLLAFLVKSA 417

Query: 449 KEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGYKATTGIWGSIYGV 508
              +VF WL AIAGL+    W SI +SH+RFR AMK Q RSLDEL +K++ G++GSIY  
Sbjct: 418 SMGVVFDWLMAIAGLATCVVWLSINISHIRFRLAMKAQNRSLDELEFKSSVGVYGSIYSA 477

Query: 509 FFNILVFVAQFWVALAPLG--NGGKCDAESFFQNYLAFPIWLAFYFGYMVYNR------- 559
             NIL+ +AQF+++L P+G     +   ESFF+NYL   + +  +  + +Y +       
Sbjct: 478 TVNILILIAQFYISLWPVGGWTSSQQRTESFFKNYLCALVLVFVFVTHKIYFKCSTGKWF 537

Query: 560 DFTLLNPLDKIDLDFHRRIYDPELMRQEDEENKEKL 595
           DF    PL +IDL+  R+  D E+++QE  E +  L
Sbjct: 538 DF---KPLAEIDLETDRKNIDIEIVKQEVREREMYL 570

>Kwal_34.16254
          Length = 481

 Score =  375 bits (962), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 201/491 (40%), Positives = 298/491 (60%), Gaps = 36/491 (7%)

Query: 22  IRSFSAGNNFQSSS-SEKTYS-----KQKSGSDKLIHRFADSFKRAEGSTTRTKQINENT 75
           + ++++G   +SS  SEKT       +++S +  ++ R  DSFK  E             
Sbjct: 18  LEAYASGQEIKSSDFSEKTTPENDGVRRRSTNRNVLQRMVDSFKPPE------------- 64

Query: 76  SDLEDGVESITSDSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALIIGYIL 135
               DG  S  SD+ LKKS+K+RH+VM+++G  IGTGL + + K L  GGP ALIIG+ +
Sbjct: 65  ----DG--SFHSDN-LKKSLKARHLVMIAIGGSIGTGLFIGSGKALALGGPLALIIGWTI 117

Query: 136 VSFETYFMIQAAGEMAVTYPTLPANFNAYSSIFISKSFGFATVWLYCFQWLTVLPLELIT 195
              +    I   GE+ V +P + A F  Y + F+  S  F  V +Y  QW  VLPLE+I 
Sbjct: 118 AGTQMVGTIHGLGEITVRFPVVGA-FADYGTRFLEPSISFVVVLIYVLQWCFVLPLEIIA 176

Query: 196 ASMTIQFGNDKINPDIYILIFYVFLVFIHFFGVKAYGETEFIFNCCKILMIAGFIILSIV 255
           A+MT+++ +  ++P +++ IFY  +  I+  GV+ +GE EF+F+  K++ I GFIIL IV
Sbjct: 177 AAMTVEYWDTSVSPVVWVAIFYGIIALINLVGVRGFGEAEFVFSLIKVITIVGFIILCIV 236

Query: 256 INCGGAGNDGYIGATYWHNPGAFAGDTSIGRFKNVCYILVTAYFSFGGMELFALSVQEQS 315
           + CGG     ++GA YWH+PG  A       FK V  +LV A +S GG E+  L+  E +
Sbjct: 237 LICGGGPKKEFVGAKYWHDPGPLANG-----FKGVAGVLVIASYSLGGTEMACLASGE-T 290

Query: 316 NPRKSTPVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLMGAGGSATHASPYVLAASIHG 375
           +P K  P A K+  +RIV  +L+++ L+GF VPY +  LMG  GS+   SP+V+A  +HG
Sbjct: 291 DP-KELPSAIKQVFWRIVFFFLVSLTLVGFLVPYTNQNLMG--GSSVDNSPFVIAIRLHG 347

Query: 376 VKIVPHIINAVILISVVSVANSSLYAGPRLICSLAQQGYAPKFLDYVDREGRPLRALIVC 435
           +  +P I+NAVIL+S++SV NS ++A  R +CS+A QG  P+   Y+DR GRPL  ++  
Sbjct: 348 INALPSIVNAVILVSLLSVGNSCIFASSRTLCSMAHQGLIPRVFGYIDRAGRPLTGILTN 407

Query: 436 CVFGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGY 495
            +FG++AF+  S     VFTWL AIAGL+    W SI +SH+RFR AMK QG  L+EL +
Sbjct: 408 LLFGLLAFLVKSGSAGDVFTWLMAIAGLATCVVWLSINISHIRFRLAMKAQGVDLEELEF 467

Query: 496 KATTGIWGSIY 506
            +  GI+GS+Y
Sbjct: 468 VSGVGIYGSVY 478

>Kwal_56.22951
          Length = 596

 Score =  367 bits (941), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 231/599 (38%), Positives = 351/599 (58%), Gaps = 27/599 (4%)

Query: 5   EDFGSSGKKETSPDSISIRSFSAGNNFQSSSSEKTYSKQKSGSDKLIHRFADSFKRAEGS 64
           +D+ + G  E +  S+  R++    N ++S S     KQKS   + IH  A SF+R E  
Sbjct: 3   KDYKNEGV-EQAVSSVESRTW----NGETSGSLINRFKQKS--RRQIHDIAHSFQRQEAP 55

Query: 65  TTRTKQINENTSDLEDGVESITSDSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYG 124
            +    ++  + +     E   ++   +KS+  RH++M+S+G  +GTGL +     L   
Sbjct: 56  NSEGVDLSLLSEEQRRNYE--LANQPYEKSLSQRHLMMISIGGTLGTGLFIGLGFSLA-S 112

Query: 125 GPAALIIGYILVSFETYFMIQAAGEMAVTYPTLPANFNAYSSIFISKSFGFATVWLYCFQ 184
           GP +L+IG+++V    + ++Q+A EMA  YP +  +F+ + S F+  S GF     Y   
Sbjct: 113 GPGSLLIGFLIVGLMMFCVVQSAAEMACQYP-VSGSFSTHVSRFMEPSIGFTVSTNYALA 171

Query: 185 WLTVLPLELITASMTIQFGNDKINPDIYILIFYVFLVFIHFFGVKAYGETEFIFNCCKIL 244
           WL   P ELI  ++T+++ +  +N  +++ IFYVF++ ++ FGV+ YGE EF  +  K++
Sbjct: 172 WLISFPSELIGCAITLRYWSS-VNGAVWVAIFYVFIMQLNLFGVRGYGEAEFWMSLFKVV 230

Query: 245 MIAGFIILSIVINCGGAGND-GYIGATYWHNPGAFAGDTSIGRFKNVCYILVTAYFSFGG 303
            I  FII+ IV+ CGG  +  GYIG  YWHNPG+FA       FK +C   ++A FSFGG
Sbjct: 231 AIVIFIIIGIVLICGGGPHSSGYIGTKYWHNPGSFAKPV----FKGLCNTFISAAFSFGG 286

Query: 304 MELFALSVQEQSNPRKSTPVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLMGAG-GSAT 362
            EL  L+  E S   +S   AAK + +RI + Y+ T+++IG  VPY DD+L+G   G   
Sbjct: 287 AELVVLTASE-SKKVESVSRAAKGTFWRIAIFYITTVVVIGCLVPYTDDRLLGGDTGEDI 345

Query: 363 HASPYVLAASIHGV--KIVPHIINAVILISVVSVANSSLYAGPRLICSLAQQGYAPKFLD 420
            ASP+V+A S  G     V H +NAVILI+V+SV NS +YA  R+I +L   G  P+   
Sbjct: 346 TASPFVIALSGQGSMGTKVSHFMNAVILIAVLSVCNSCVYASSRVIQALGACGQLPRACG 405

Query: 421 YVDREGRPLRALIVCCVFGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFR 480
           Y+D++GRPL  + +C VFG++ F+ A  K++ VFTWL A+  +S  FTW  I +S +RFR
Sbjct: 406 YIDKKGRPLVGIAICGVFGLLGFLVACDKQDDVFTWLFALCSISSFFTWFCICVSQVRFR 465

Query: 481 QAMKVQGRSLDELGYKATTGIWGSIYGVFFNILVFVAQFWVALAPLGNGGKCDAESFFQN 540
            A++ QGRS DE+ +K+  GI+G I G   NIL+   + +V++ PL  GG   AE FFQ 
Sbjct: 466 LALRAQGRSTDEIAHKSMLGIYGGILGGVLNILLIAGEIYVSIFPL--GGSPSAEQFFQY 523

Query: 541 YLAFPIWLAFYFGYMVYN---RDFT-LLNPLDKIDLDFHRRIYDPELMRQEDEENKEKL 595
            ++ PI +  Y  +  Y    RD   +L PL +IDLD  RRI D EL + E EE+K ++
Sbjct: 524 CMSIPIMIVVYALHKTYKATRRDAKRILVPLSEIDLDSGRRIQDIELFKHELEEDKARI 582

>KLLA0B06776g 594172..595938 similar to sgd|S0006195 Saccharomyces
           cerevisiae YPL274w SAM3 high affinity
           S-adenosylmethionine permease, start by similarity
          Length = 588

 Score =  363 bits (931), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 215/560 (38%), Positives = 332/560 (59%), Gaps = 18/560 (3%)

Query: 43  QKSGSDKLIHRFADSFKRAEGSTTRTKQINENTSDLEDGVES--ITSDSKLKKSMKSRHV 100
            + GS  L  R  DSFKR E     T+ I+ +T  + D   +  + +    +K++  RH+
Sbjct: 26  DEDGSRSLFTRVKDSFKRQE--LVETEGIDLDTYSMTDYQRTNYLLAKQPYQKNLSQRHL 83

Query: 101 VMMSLGTGIGTGLLVANAKGLHYGGPAALIIGYILVSFETYFMIQAAGEMAVTYPTLPAN 160
            M+++G  +GTGL +     L   GP  L+IG++L     + ++Q A E++  YP +  +
Sbjct: 84  TMIAIGGTLGTGLFIGIGWSLA-SGPGNLLIGFLLTGLAIFCVVQCAAELSCQYP-VSGS 141

Query: 161 FNAYSSIFISKSFGFATVWLYCFQWLTVLPLELITASMTIQFGNDKINPDIYILIFYVFL 220
           F ++ S F+  S+GF     YC  W    P ELI  +MTI + +  +NP ++++IF++F+
Sbjct: 142 FASHVSRFVDPSWGFTVTTNYCLAWSISFPSELIGCAMTIGYWDSSVNPVVWVIIFWLFI 201

Query: 221 VFIHFFGVKAYGETEFIFNCCKILMIAGFIILSIVINCGGAGN-DGYIGATYWHNPGAFA 279
           + ++ FGV+ + ETE++ +  KIL I  F+I+ +V+ CGG  N +GYIG  YWH+PG+F 
Sbjct: 202 MALNLFGVRGFAETEYVLSIFKILAIIIFLIIGVVLICGGGPNSNGYIGTKYWHDPGSFK 261

Query: 280 GDTSIGRFKNVCYILVTAYFSFGGMELFALSVQEQSNPRKSTPVAAKRSIYRIVVIYLLT 339
                  FK++C   V+A FSFGG EL  L+  E S   +S   AAK + +R++V Y+ T
Sbjct: 262 APV----FKSLCNTFVSAAFSFGGTELVVLTAAE-SRKVESISRAAKGTFWRVIVFYVST 316

Query: 340 MILIGFNVPYNDDQLMGAGGSA-THASPYVLAASIHGV--KIVPHIINAVILISVVSVAN 396
           +++IG  VPY D++L+G   S    ASP+V+A +  G   + V + +NAVILI+V+SV N
Sbjct: 317 VVVIGCLVPYTDERLLGGDTSEDIAASPFVIALANTGKFGERVSNFMNAVILIAVLSVCN 376

Query: 397 SSLYAGPRLICSLAQQGYAPKFLDYVDREGRPLRALIVCCVFGVIAFVAASSKEEIVFTW 456
           S +YA  R+I SL   G  P    YVDR+GRPL  ++V  +FG + F+ AS+K   VF W
Sbjct: 377 SCVYAASRVIQSLGASGQLPSICGYVDRKGRPLFGILVVGLFGFLPFIVASNKVSEVFDW 436

Query: 457 LAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGYKATTGIWGSIYGVFFNILVFV 516
           L A+  +S +F W SI  S+LR+R A+K Q RS DE+ YK+  GIWG+  G+  + L+ V
Sbjct: 437 LFALCSISSMFIWFSICYSYLRYRWALKKQNRSADEIAYKSMLGIWGAYLGLLLSALLIV 496

Query: 517 AQFWVALAPLGNGGKCDAESFFQNYLAFPIWLAFYFGYMVYNRDF-TLLNPLDKIDLDFH 575
            + +V+L PLG      AE+FF+  L+ PI +A Y G+  Y  ++ + + PL  IDLD  
Sbjct: 497 GEIYVSLFPLGESP--SAEAFFKYCLSIPIMIAVYIGHKSYTGNWKSFVIPLSGIDLDTG 554

Query: 576 RRIYDPELMRQEDEENKEKL 595
               D E+M+ E E  + KL
Sbjct: 555 LSHSDVEIMKHELEIQRVKL 574

>YLL061W (MMP1) [3363] chr12 (17956..19707) High affinity
           S-methylmethionine permease, member of the amino
           acid-polyamine-choline (APC) family of membrane
           transporters [1752 bp, 583 aa]
          Length = 583

 Score =  354 bits (909), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 207/564 (36%), Positives = 324/564 (57%), Gaps = 17/564 (3%)

Query: 36  SEKTYSKQKSGSDKLIHRFADSFKRAEGSTTRTKQINENTSDLEDGVESITSDSKLKKSM 95
           S    S   +  + LIHRF +SFKR +    +   +    S+ E+ ++   ++   KK +
Sbjct: 15  STSVLSTPSNEGNNLIHRFKNSFKRNDSPAIQEGLLYSELSE-EEKIQWDLANQPYKKVL 73

Query: 96  KSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALIIGYILVSFETYFMIQAAGEMAVTYP 155
             RH+ M+++G  +GTGL +   + L   GPA+L+IG++LV      ++Q   E++  YP
Sbjct: 74  DQRHLTMIAIGGTLGTGLFIGLGESLA-SGPASLLIGFLLVGASMLCVVQCGAELSCQYP 132

Query: 156 TLPANFNAYSSIFISKSFGFATVWLYCFQWLTVLPLELITASMTIQFGNDKINPDIYILI 215
            +  ++  ++S FI  S GF+    Y   WL   P EL+  S+TI +    +NP  ++ I
Sbjct: 133 -VSGSYALHASRFIDPSVGFSIGINYLLMWLISYPSELVGCSLTISYWAPSVNPAAWVAI 191

Query: 216 FYVFLVFIHFFGVKAYGETEFIFNCCKILMIAGFIILSIVINCGGAGND-GYIGATYWHN 274
            +V  + ++ FG + + E+EF  +  KI+ +  FII+ IV+  GG  +  GYIG  YWH+
Sbjct: 192 AFVLSMLLNLFGARGFAESEFYMSIFKIVALFIFIIIGIVLIAGGGPDSTGYIGTKYWHD 251

Query: 275 PGAFAGDTSIGRFKNVCYILVTAYFSFGGMELFALSVQEQSNPRKSTPVAAKRSIYRIVV 334
           PG+FA    +  FKN+C   V+A +SF G E+  L+  E +    S   AAK + +RI++
Sbjct: 252 PGSFA----VPVFKNLCNTFVSAAYSFSGTEMVVLTSTE-ARSVSSVSRAAKGTFWRIII 306

Query: 335 IYLLTMILIGFNVPYNDDQLM-GAGGSATHASPYVLAASIHGV--KIVPHIINAVILISV 391
            Y++T+I+IG  VPYND +L+ G+      ASP+V+A S  G     V H +NAVILI+V
Sbjct: 307 FYIVTVIIIGCLVPYNDPRLISGSSSEDITASPFVIALSNTGAMGTRVSHFMNAVILIAV 366

Query: 392 VSVANSSLYAGPRLICSLAQQGYAPKFLDYVDREGRPLRALIVCCVFGVIAFVAASSKEE 451
            SV NS +YA  RLI  LA  G  PK   Y+DR GRPL  + +C  FG++ F+  S  + 
Sbjct: 367 FSVCNSCVYASSRLIQGLATAGQLPKICAYMDRNGRPLVGMAICGAFGLLGFLVVSKNQG 426

Query: 452 IVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGYKATTGIWGSIYGVFFN 511
            VFTWL A+  +S   TW  I    +RFR AMK QGRS D++ Y++T GI+G I+G   N
Sbjct: 427 TVFTWLFALCSISFFTTWFCICFCQVRFRMAMKAQGRSKDDIIYRSTLGIYGGIFGCILN 486

Query: 512 ILVFVAQFWVALAPLGNGGKCDAESFFQNYLAFPIWLAFYFGYMVYNRDFT--LLNPLDK 569
           +L+ + + +V+ AP+G+     A +FF+  ++ PI +A Y G+ +Y RD+    +  +D 
Sbjct: 487 VLLVIGEIYVSAAPVGS--PSSAANFFEYCMSIPIMIAVYIGHRIYRRDWRHWYIKRMD- 543

Query: 570 IDLDFHRRIYDPELMRQEDEENKE 593
           IDLD    + D E  + E +E+K+
Sbjct: 544 IDLDSGHSLEDFEATKLERDEDKK 567

>Scas_536.1
          Length = 372

 Score =  342 bits (877), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 181/358 (50%), Positives = 246/358 (68%), Gaps = 2/358 (0%)

Query: 238 FNCCKILMIAGFIILSIVINCGGAGNDGYIGATYWHNPGAFAGDTSIGRFKNVCYILVTA 297
           F+  K+  + GFIIL IV+ CGG    G++GA YWH+PGAF G  S  +FK VC + VTA
Sbjct: 3   FSIIKVTTVIGFIILGIVLVCGGGPKGGFVGAKYWHDPGAFVGHGSGAQFKGVCSVFVTA 62

Query: 298 YFSFGGMELFALSVQEQSNPRKSTPVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLMGA 357
            FSF G EL  ++  E +NPRKS P AAK+ ++RIV+ Y+ T+ +IG  VPYND +L+GA
Sbjct: 63  AFSFAGSELIGITAAEAANPRKSIPGAAKQVVWRIVLFYMGTLTMIGLLVPYNDKRLIGA 122

Query: 358 GGSATHASPYVLAASIHGVKIVPHIINAVILISVVSVANSSLYAGPRLICSLAQQGYAPK 417
                 ASP+V+A   HG+K +P +IN VILI+V+SV NS+++A  R I +L+ QG+ PK
Sbjct: 123 SSVDAAASPFVIAIVTHGIKGLPSVINVVILIAVLSVGNSAIFACSRTIAALSDQGFLPK 182

Query: 418 FLDYVDREGRPLRALIVCCVFGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHL 477
              Y+DR GRPL  + +   FG++AFVAAS KE  VF WL A++GLS LFTW  I L H+
Sbjct: 183 VFGYIDRSGRPLVGIAITSTFGLLAFVAASKKEGEVFNWLLALSGLSSLFTWGGICLCHI 242

Query: 478 RFRQAMKVQGRSLDELGYKATTGIWGSIYGVFFNILVFVAQFWVALAPLGNGGKCDAESF 537
           RFR A+K QGR  +EL + +  G+ GS +G+F  +L+F+AQF+VAL P   GGK DAE F
Sbjct: 243 RFRMALKAQGRDTNELTFVSPAGVAGSYWGLFMIVLMFIAQFYVALFP--PGGKPDAEVF 300

Query: 538 FQNYLAFPIWLAFYFGYMVYNRDFTLLNPLDKIDLDFHRRIYDPELMRQEDEENKEKL 595
           FQ+YL+FPI +A YFG+ +Y R++ L  PL+ +D+D  RR  D EL++QE  E K  L
Sbjct: 301 FQSYLSFPIVVATYFGHKIYKRNWKLFIPLEDMDIDTGRRETDMELLKQEIMEEKAIL 358

>YPL274W (SAM3) [5177] chr16 (22938..24701) High affinity
           S-adenosylmethionine permease, member of the amino acid
           permease family of membrane transporters [1764 bp, 587
           aa]
          Length = 587

 Score =  348 bits (892), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 217/570 (38%), Positives = 328/570 (57%), Gaps = 23/570 (4%)

Query: 32  QSSSSEKTYSKQKSGSDKLIHRFADSFKRAEGSTTRTKQINENTSDLEDGVESITSDSKL 91
           ++ S+       +SGS  LI R  DSFK++          N   ++ E  ++   +    
Sbjct: 17  ETESTTIPNDSDRSGS--LIRRMKDSFKQSNLHVIPEDLENSEQTEQEK-IQWKLASQPY 73

Query: 92  KKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYG---GPAALIIGYILVSFETYFMIQAAG 148
           +K +  RH+ M+++G  +GTGL +    GL Y    GPAAL+IG++LV    + ++Q+A 
Sbjct: 74  QKVLSQRHLTMIAIGGTLGTGLFI----GLGYSLASGPAALLIGFLLVGTSMFCVVQSAA 129

Query: 149 EMAVTYPTLPANFNAYSSIFISKSFGFATVWLYCFQWLTVLPLELITASMTIQFGNDKIN 208
           E++  +P +  ++  + S FI +S GF     Y   WL   P ELI  ++TI + N  +N
Sbjct: 130 ELSCQFP-VSGSYATHVSRFIDESVGFTVATNYALAWLISFPSELIGCALTISYWNQTVN 188

Query: 209 PDIYILIFYVFLVFIHFFGVKAYGETEFIFNCCKILMIAGFIILSIVINCGGAGND-GYI 267
           P +++ IFYVF++ ++ FGV+ + ETEF  +  K++ I  FII+ IV+  GG  N  GYI
Sbjct: 189 PAVWVAIFYVFIMVLNLFGVRGFAETEFALSIIKVIAIFIFIIIGIVLIAGGGPNSTGYI 248

Query: 268 GATYWHNPGAFAGDTSIGRFKNVCYILVTAYFSFGGMELFALSVQEQSNPRKSTPVAAKR 327
           GA YWH+PGAFA       FKN+C   V+A FSFGG EL  L+  E  N   +   AAK 
Sbjct: 249 GAKYWHDPGAFAKPV----FKNLCNTFVSAAFSFGGSELVLLTSTESKNI-SAISRAAKG 303

Query: 328 SIYRIVVIYLLTMILIGFNVPYNDDQLM-GAGGSATHASPYVLAASIHGV--KIVPHIIN 384
           + +RI + Y+ T+++IG  VPYND +L+ G+      ASP+V+A S  G     V + +N
Sbjct: 304 TFWRIAIFYITTVVIIGCLVPYNDPRLLSGSNSEDVSASPFVIALSNTGSMGAKVSNFMN 363

Query: 385 AVILISVVSVANSSLYAGPRLICSLAQQGYAPKFLDYVDREGRPLRALIVCCVFGVIAFV 444
            VIL++VVSV NS +YA  RLI +L   G  P    Y+DR+GRPL  + +   FG++ F+
Sbjct: 364 VVILVAVVSVCNSCVYASSRLIQALGASGQLPSVCSYMDRKGRPLVGIGISGAFGLLGFL 423

Query: 445 AASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGYKATTGIWGS 504
            AS KE+ VFTWL A+  +S  FTW  I +S +RFR A+K QGRS DE+ YK+  G++G 
Sbjct: 424 VASKKEDEVFTWLFALCSISSFFTWFCICMSQIRFRMALKAQGRSNDEIAYKSILGVYGG 483

Query: 505 IYGVFFNILVFVAQFWVALAPLGNGGKCDAESFFQNYLAFPIWLAFYFGYMVYNRDFT-L 563
           I G   N L+   + +V+ AP+G+     AE+FF+  L+ PI +  YF +  Y RD+   
Sbjct: 484 ILGCVLNALLIAGEIYVSAAPVGS--PSSAEAFFEYCLSIPIMIVVYFAHRFYRRDWKHF 541

Query: 564 LNPLDKIDLDFHRRIYDPELMRQEDEENKE 593
                +IDLD    + + EL + + E  ++
Sbjct: 542 YIKRSEIDLDTGCSVENLELFKAQKEAEEQ 571

>YNL268W (LYP1) [4340] chr14 (138549..140384) High affinity lysine
           permease, also transports methionine [1836 bp, 611 aa]
          Length = 611

 Score =  325 bits (833), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 199/597 (33%), Positives = 314/597 (52%), Gaps = 21/597 (3%)

Query: 4   SEDFGSSGKKETSPDSIS--IRSFSAGNNFQSSS-SEKTYSKQKSGSDKLIHRFADSFKR 60
             + G    +E   D I   + +    N     S  EK Y+ +K          AD    
Sbjct: 17  QNNIGEQSMQELPEDQIEHEMEAIDPSNKTTPYSIDEKQYNTKKKHGSLQGGAIAD-VNS 75

Query: 61  AEGSTTRTKQINENTSDLEDGVESITSDSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKG 120
              S TR + ++  T   ED  E+   D  +K+++K RH+ M++LG  IGTGL V  +  
Sbjct: 76  ITNSLTRLQVVSHETDINEDEEEAHYEDKHVKRALKQRHIGMIALGGTIGTGLFVGISTP 135

Query: 121 LHYGGPAALIIGYILVSFETYFMIQAAGEMAVTYPTLPANFNAYSSIFISKSFGFATVWL 180
           L   GP   +I YI +    YF+ Q+ GEMA   P + ++   +S  F+S +FG +  ++
Sbjct: 136 LSNAGPVGSLIAYIFMGTIVYFVTQSLGEMATFIP-VTSSITVFSKRFLSPAFGVSNGYM 194

Query: 181 YCFQWLTVLPLELITASMTIQFGNDKINPDIYILIFYVFLVFIHFFGVKAYGETEFIFNC 240
           Y F W     +E+      I++  DK+    +I IF+V +  ++FF VK YGE EF    
Sbjct: 195 YWFNWAITYAVEVSVIGQVIEYWTDKVPLAAWIAIFWVIITLMNFFPVKVYGEFEFWVAS 254

Query: 241 CKILMIAGFIILSIVINCGGAGNDGYIGATYWHNPGAF-----AGDTSIGRFKNVCYILV 295
            K+L I G++I +++I CGG+ + G IG  YW NPGA+     + D S GRF      L+
Sbjct: 255 VKVLAIMGYLIYALIIVCGGS-HQGPIGFRYWRNPGAWGPGIISSDKSEGRFLGWVSSLI 313

Query: 296 TAYFSFGGMELFALSVQEQSNPRKSTPVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLM 355
            A F++ G EL  ++  E +NPRK+ P A  + ++RIV+ Y++++  IG  VPYND +L 
Sbjct: 314 NAAFTYQGTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIMSLFFIGLLVPYNDSRLS 373

Query: 356 GAGGSATHASPYVLAASIHGVKIVPHIINAVILISVVSVANSSLYAGPRLICSLAQQGYA 415
            +  +   +SP+V++    G   +P I NAV+LI+VVS ANS++Y G R++ SLA+ G A
Sbjct: 374 ASS-AVIASSPFVISIQNAGTYALPDIFNAVVLITVVSAANSNVYVGSRVLYSLARTGNA 432

Query: 416 PKFLDYVDREGRPLRALIVCCVFGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLS 475
           PK   YV R+G P   ++     G++AF+  ++     F WL  I+ L+ L  W  I L+
Sbjct: 433 PKQFGYVTRQGVPYLGVVCTAALGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLA 492

Query: 476 HLRFRQAMKVQGRSLDELGYKATTGIWGSIYGVFFNILVFVAQFWVALAPLGNGGKCDAE 535
           H+RF QA+K +G S D+L +KA    +G+ Y  FF  ++   Q + A  P          
Sbjct: 493 HIRFMQALKHRGISRDDLPFKAKLMPYGAYYAAFFVTVIIFIQGFQAFCPF------KVS 546

Query: 536 SFFQNYLAFPIWLAFYFGYMVYNRDFTLLNPLDKIDLDFHRRIYDPELMRQEDEENK 592
            FF +Y++  +    + G  +Y +    +  L+ ID+D  RR  + E +  ED+E K
Sbjct: 547 EFFTSYISLILLAVVFIGCQIYYK-CRFIWKLEDIDIDSDRR--EIEAIIWEDDEPK 600

>CAGL0J08162g complement(801555..803348) Highly similar to sp|P32487
           Saccharomyces cerevisiae YNL268w LYP1 or sp|P04817
           Saccharomyces cerevisiae YEL063c CAN1 or sp|P38971
           Saccharomyces cerevisiae YNL270c ALP1, hypothetical
           start
          Length = 597

 Score =  321 bits (822), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 181/509 (35%), Positives = 285/509 (55%), Gaps = 14/509 (2%)

Query: 88  DSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALIIGYILVSFETYFMIQAA 147
           D+++K+++K RH+ M++LG  IGTGL V  +  L   GP   +I YI +    YF+ Q+ 
Sbjct: 88  DTRVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNSGPVGALIAYIFMGTIIYFVTQSL 147

Query: 148 GEMAVTYPTLPANFNAYSSIFISKSFGFATVWLYCFQWLTVLPLELITASMTIQFGNDKI 207
           GEMA   P + ++   +S  F+S +FG A  ++Y F W     +E+      IQ+   K+
Sbjct: 148 GEMATFIP-VTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEVSVIGQVIQYWTFKV 206

Query: 208 NPDIYILIFYVFLVFIHFFGVKAYGETEFIFNCCKILMIAGFIILSIVINCGGAGNDGYI 267
               +I IF+V +  ++FF VK YGE EF     K++ I G++I +++I CGG+ + G I
Sbjct: 207 PLAAWIGIFWVLITLMNFFPVKIYGEFEFWVASIKVIAIVGYLIYALIIVCGGS-HQGPI 265

Query: 268 GATYWHNPGAF-----AGDTSIGRFKNVCYILVTAYFSFGGMELFALSVQEQSNPRKSTP 322
           G  YW NPGA      + D    RF      L+ A F++ G EL  ++  E +NPRKS P
Sbjct: 266 GFRYWRNPGAMGAGIISSDLGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 325

Query: 323 VAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLMGAGGSATHASPYVLAASIHGVKIVPHI 382
            A  + ++RIV+ Y++++  +G  VPYND +L  +  +   +SP+V++    G K++P I
Sbjct: 326 RAINKVVFRIVLFYIMSLFFVGLLVPYNDPRLSASS-AVIASSPFVISIQNAGTKVLPDI 384

Query: 383 INAVILISVVSVANSSLYAGPRLICSLAQQGYAPKFLDYVDREGRPLRALIVCCVFGVIA 442
            NAV+L++V+S ANS++Y G R++ +LAQ G APK   YV R G P   +I   + G++A
Sbjct: 385 FNAVVLVTVISAANSNVYVGSRVLYALAQSGNAPKQFAYVTRHGVPYLGVICTALLGLLA 444

Query: 443 FVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGYKATTGIW 502
           F+  +      F WL  I+ L+ L  W  I L+H+RF QA+K +G S D+L +KA    W
Sbjct: 445 FLVVNHNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKFRGISRDDLPFKAKFMPW 504

Query: 503 GSIYGVFFNILVFVAQFWVALAPLGNGGKCDAESFFQNYLAFPIWLAFYFGYMVYNRDFT 562
           G+ Y  FF  ++   Q + A AP     K D   FF  Y++  + +  + G  +Y R   
Sbjct: 505 GAYYASFFVTVIIFIQGFQAFAP-----KFDVSEFFTAYISLILLVVLFAGCQLYYRC-R 558

Query: 563 LLNPLDKIDLDFHRRIYDPELMRQEDEEN 591
            L  L+ ID+D  RR  D  +   ++ +N
Sbjct: 559 FLWKLEDIDIDSDRREIDAIVWEDDEPQN 587

>Scas_706.36d
          Length = 607

 Score =  318 bits (816), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 195/594 (32%), Positives = 313/594 (52%), Gaps = 26/594 (4%)

Query: 4   SEDFGSSGKKETSPDSISIRSFSAGNNFQSSSSEKTYSKQKSGSDKLIHRFADSFKRAEG 63
           +E   S+  ++TSPD  SI      N       +K     +  SD  IH   DS  R   
Sbjct: 24  TEIHTSTEDEQTSPDDHSIEIIK--NEILEKDKKKIAHTNQFSSD--IHSITDSLAR--- 76

Query: 64  STTRTKQINENTSDLEDGVESITSDSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHY 123
             +R   + ++  + +        D+++K+++K RH+ M++LG  IGTGL V  +  L  
Sbjct: 77  --SRLPHLGDDDDEEDAEEAQY-HDTEVKRALKQRHIGMIALGGTIGTGLFVGISVPLTN 133

Query: 124 GGPAALIIGYILVSFETYFMIQAAGEMAVTYPTLPANFNAYSSIFISKSFGFATVWLYCF 183
            GP   +I Y+ +    Y + Q+ GEMA   P + ++   +S  F+S +FG A  ++Y F
Sbjct: 134 SGPVGSLIAYLFMGSIIYSITQSLGEMATFIP-VTSSITVFSKRFLSPAFGVANGYMYWF 192

Query: 184 QWLTVLPLELITASMTIQFGNDKINPDIYILIFYVFLVFIHFFGVKAYGETEFIFNCCKI 243
            W     +E+      I++   K+    +I IF+VF+  ++FF VK YGE EF     K+
Sbjct: 193 NWAITYAVEISVVGQVIEYWTKKVPLAAWIAIFWVFVTLMNFFPVKVYGEIEFWIAFMKV 252

Query: 244 LMIAGFIILSIVINCGGAGNDGYIGATYWHNPGAFAG-----DTSIGRFKNVCYILVTAY 298
           L IAG+++ +++I CGG+ + G IG  YW NPG +       D +  RF      L+ A 
Sbjct: 253 LAIAGYLLYALIIVCGGS-SQGPIGFRYWRNPGPWGAGIISKDKNTSRFLGWVSSLINAA 311

Query: 299 FSFGGMELFALSVQEQSNPRKSTPVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLMGAG 358
           F++ G EL  ++  E +NPRKS P A  + ++RI + Y++++  IG  VPY+D +L    
Sbjct: 312 FTYQGTELVGITAGEAANPRKSVPRAINKVVFRIALFYIMSLFFIGLLVPYDDPRLSSDS 371

Query: 359 GSATHASPYVLAASIHGVKIVPHIINAVILISVVSVANSSLYAGPRLICSLAQQGYAPKF 418
            +   +SP+V++    G KI+P I NA+++I+V+S ANS++Y G R++ +LAQ G APK 
Sbjct: 372 -AVVASSPFVISIQNAGTKILPDIFNAIVMITVISAANSNVYVGSRVLYALAQTGNAPKQ 430

Query: 419 LDYVDREGRPLRALIVCCVFGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLR 478
             YV R G P   ++     G++AF+  ++     F WL  I+ L+ L  W  I +SH+R
Sbjct: 431 FAYVTRHGVPYLGVLCTAALGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISISHIR 490

Query: 479 FRQAMKVQGRSLDELGYKATTGIWGSIYGVFFNILVFVAQFWVALAPLGNGGKCDAESFF 538
           F QA+K +G S D+L +KA    W + Y  FF  ++   Q + A +P       D  +FF
Sbjct: 491 FMQALKFRGISRDDLPFKAKFMPWAAYYATFFVTVIIFIQGFQAFSP-----HFDVTAFF 545

Query: 539 QNYLAFPIWLAFYFGYMVYNRDFTLLNPLDKIDLDFHRRIYDPELMRQEDEENK 592
             Y++  I    + G  +Y R       L+ ID+D  RR  + E +  ED+E K
Sbjct: 546 TAYISLIILAVLFIGCQIYYR-CRFFWKLEDIDIDTDRR--EIEEVIWEDDEPK 596

>YEL063C (CAN1) [1365] chr5 complement(31694..33466) Permease for
           basic amino acids, arginine, lysine, and histidine,
           member of the amino acid-polyamine-choline (APC) family
           of membrane transporters [1773 bp, 590 aa]
          Length = 590

 Score =  318 bits (814), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 195/565 (34%), Positives = 299/565 (52%), Gaps = 22/565 (3%)

Query: 37  EKTYSKQKSGSDKLIHRFADSFKRAEGSTTRTKQINENTSDLEDGV----ESITSDSKLK 92
           E + +  + GS  L    +          TR     E+T  +EDG+    E    ++++K
Sbjct: 28  EASQTHHRRGSIPLKDEKSKELYPLRSFPTRVN--GEDTFSMEDGIGDEDEGEVQNAEVK 85

Query: 93  KSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALIIGYILVSFETYFMIQAAGEMAV 152
           + +K RH+ M++LG  IGTGL +  +  L   GP   +I Y+ +    Y + Q+ GEMA 
Sbjct: 86  RELKQRHIGMIALGGTIGTGLFIGLSTPLTNAGPVGALISYLFMGSLAYSVTQSLGEMAT 145

Query: 153 TYPTLPANFNAYSSIFISKSFGFATVWLYCFQWLTVLPLELITASMTIQFGNDKINPDIY 212
             P + ++F  +S  F+S +FG A  ++Y F W     LEL      IQF   K+    +
Sbjct: 146 FIP-VTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKVPLAAW 204

Query: 213 ILIFYVFLVFIHFFGVKAYGETEFIFNCCKILMIAGFIILSIVINCGGAGNDGYIGATYW 272
           I IF+V +  ++ F VK YGE EF     K+L I GF+I    + CG AG  G +G  YW
Sbjct: 205 ISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCG-AGVTGPVGFRYW 263

Query: 273 HNPGAF-----AGDTSIGRFKNVCYILVTAYFSFGGMELFALSVQEQSNPRKSTPVAAKR 327
            NPGA+     + D + GRF      L+ A F+F G EL  ++  E +NPRKS P A K+
Sbjct: 264 RNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVPRAIKK 323

Query: 328 SIYRIVVIYLLTMILIGFNVPYNDDQLMGAGGSATHASPYVLAASIHGVKIVPHIINAVI 387
            ++RI+  Y+ +++ IG  VPYND +L  +  S    SP+++A    G K++PHI NAVI
Sbjct: 324 VVFRILTFYIGSLLFIGLLVPYNDPKLTQST-SYVSTSPFIIAIENSGTKVLPHIFNAVI 382

Query: 388 LISVVSVANSSLYAGPRLICSLAQQGYAPKFLDYVDREGRPLRALIVCCVFGVIAFVAAS 447
           L +++S ANS++Y G R++  L++   APKFL    + G P  A+ V   FG +A++  S
Sbjct: 383 LTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALAYMETS 442

Query: 448 SKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGYKATTGIWGSIYG 507
           +  + VF WL  I G++  F W  I +SH+RF QA+K +G S DEL +KA      + Y 
Sbjct: 443 TGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLAYYA 502

Query: 508 VFFNILVFVAQFWVALAPLGNGGKCDAESFFQNYLAFPIWLAFYFGYMVYNRDFTLLNPL 567
             F  ++ + Q + A AP  NG    A ++   +L   +W+ F     ++   F  +  +
Sbjct: 503 ATFMTIIIIIQGFTAFAPKFNGVSF-AAAYISIFLFLAVWILF---QCIFRCRF--IWKI 556

Query: 568 DKIDLDFHRRIYDPELMRQEDEENK 592
             +D+D  RR  D E +  ED E K
Sbjct: 557 GDVDIDSDRR--DIEAIVWEDHEPK 579

>AER405C [2905] [Homologous to ScYPL274W (SAM3) - NSH]
           (1413790..1415283) [1494 bp, 497 aa]
          Length = 497

 Score =  312 bits (800), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 187/499 (37%), Positives = 295/499 (59%), Gaps = 21/499 (4%)

Query: 102 MMSLGTGIGTGLLVANAKGLHYGGPAALIIGYILVSFETYFMIQAAGEMAVTYPTLPANF 161
           M+S+G  +GTGL +   + L   GP  L+IG+++V    + +IQ+A E++  YP +  +F
Sbjct: 1   MISIGGTLGTGLFIGIGQSLQ-SGPGTLLIGFLIVGVSIFCVIQSAAELSCQYP-VSGSF 58

Query: 162 NAYSSIFISKSFGFATVWLYCFQWLTVLPLELITASMTIQFGNDKINPDIYILIFYVFLV 221
           +++ S FI  S GF     Y   WL   P EL+  +MTI + N+ I P +++LI Y+ ++
Sbjct: 59  SSHVSRFIEPSLGFTVSCAYALSWLISFPNELVGLAMTIGYWNEDIPPAVWVLIGYLLVI 118

Query: 222 FIHFFGVKAYGETEFIFNCCKILMIAGFIILSIVINCGGAGN--DGYIGATYWHNPGAFA 279
            ++ F V+ + E+EF  +  K+L I  F+I+ IVI CGG  N  +GY+G  YWH+PGAF 
Sbjct: 119 GLNLFAVRGFAESEFWLSIIKVLAIIIFLIIGIVIICGGGPNNKEGYLGGKYWHDPGAFR 178

Query: 280 GDTSIGRFKNVCYILVTAYFSFGGMELFALSVQEQSNPRKSTPVAAKRSIYRIVVIYLLT 339
                  F ++C   V+A F+FGG EL  L+  E S   +S   AAK + +RI + Y+ T
Sbjct: 179 PPF----FSSLCQTFVSAAFTFGGAELVLLTANE-SRKIESISRAAKGTFWRIAIFYIST 233

Query: 340 MILIGFNVPYNDDQLMGAGGSATHASPYVLAASIHGV--KIVPHIINAVILISVVSVANS 397
           +I+IG  VPY    L    G +  ASP+V+A S  G     V H +NAVI+ +V+SV NS
Sbjct: 234 VIVIGCLVPYTSPAL---DGESIRASPFVIALSNTGSFGTNVSHFMNAVIVAAVLSVCNS 290

Query: 398 SLYAGPRLICSLAQQGYAPKFLDYVDREGRPLRALIVCCVFGVIAFVAASSKEEIVFTWL 457
            +YA  R+I SL   G  P+   Y+D++GRPL  + VC VFG++AF+  ++K + VF WL
Sbjct: 291 CVYAASRVIQSLGACGQLPEIFGYIDKKGRPLVGIGVCAVFGLLAFLVETTKVKDVFNWL 350

Query: 458 AAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGYKATTGIWGSIYGVFFNILVFVA 517
            A+  ++  F W  I +S LR+R+A+KVQG   +E+ Y++  G W  + G   N L+   
Sbjct: 351 FALCSIAAFFVWFCICVSQLRYRRALKVQGFPTEEIAYQSMLGKWSGVIGTLLNFLLICG 410

Query: 518 QFWVALAPLGNGGKCDAESFFQNYLAFPIWLAFYFGYMVYNRDF-TLLNPLDKIDLDFHR 576
           + +V++    +G   D E+FFQN ++ P+ + FYF + +Y RD+ T L P   +DL+  R
Sbjct: 411 EIYVSVK---DG---DVETFFQNCMSIPLLIIFYFCHRLYRRDWKTWLIPARDLDLNTGR 464

Query: 577 RIYDPELMRQEDEENKEKL 595
           +  D E+M+ E   ++ ++
Sbjct: 465 KPEDLEMMKHELIVSRARI 483

>KLLA0E16335g 1455271..1457088 gi|28565044|gb|AAO32605.1
           Kluyveromyces lactis DIP5, start by similarity
          Length = 605

 Score =  309 bits (791), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 198/596 (33%), Positives = 318/596 (53%), Gaps = 34/596 (5%)

Query: 12  KKETSPDSISIRSFSAGNNFQSSSSEKTYSKQKSGSDKLIHRFADSFKRAEGSTTRTKQI 71
           + +T  D    + F   N     SS+  Y  Q   SD  +H          G  +  K +
Sbjct: 13  RVDTDEDIEKQQLFGDDNIVIERSSQLFYDGQ---SDSKVHGIT------SGHGSDVKNV 63

Query: 72  NENTSDLEDGVESITSDSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALII 131
             +TS+ +   + I    +LKK++++RHV M+++G  +GTGLL+     L   GPAA++I
Sbjct: 64  VTHTSEFDGKHDGI----RLKKALEARHVSMIAIGGSLGTGLLIGTGSSLALAGPAAILI 119

Query: 132 GYILVSFETYFMIQAAGEMAVTYPTLPANFNAYSSIFISKSFGFATVWLYCFQWLTVLPL 191
            Y  V    +F++   GEMA   P     F +YS+ +   + GFA  + Y F++  ++P 
Sbjct: 120 AYAFVGLLVFFVMSCLGEMAAYIPL--DGFTSYSTRYADPALGFAVGYAYLFKYWIIVPN 177

Query: 192 ELITASMTIQF--GNDKINPDIYILIFYVFLVFIHFFGVKAYGETEFIFNCCKILMIAGF 249
           +L   ++ IQ+    DK+NP ++I I  V ++ I+F GV+ +GE E+  +  KI ++ G 
Sbjct: 178 QLTAGALVIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMLGL 237

Query: 250 IILSIVINCGGAGNDGYIGATYWHNPGAFAG-DTSI----GRFKNVCYILVTAYFSFGGM 304
           IIL +V+ CGG  N   +G  YW NPGAF    T+I    GRF +   + V A F++ G 
Sbjct: 238 IILLLVLACGGGPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGT 297

Query: 305 ELFALSVQEQSNPRKSTPVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLMGAGGSATHA 364
           EL  + V E  NPRK+ P A K ++YRI+V YL+++ L+G  VP+ND  L+ A  + T A
Sbjct: 298 ELCGIVVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLISAKSAKTSA 357

Query: 365 S--PYVLAASIHGVKIVPHIINAVILISVVSVANSSLYAGPRLICSLAQQGYAPKFLDYV 422
           S  P+V+A    G+ ++PHI+NA ILI V S ANS LY   R +  LA    AP+     
Sbjct: 358 SASPFVVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKT 417

Query: 423 DREGRPLRALIVCCVFGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQA 482
           +++G P  +L+V  +F ++A++  SS    VFT+      +  L +W SI+++++RF +A
Sbjct: 418 NKQGVPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKA 477

Query: 483 MKVQGRSLDELGYKATTGIWGSIYGVFFNILV-FVAQFWVALAPLGNGGKCDAESFFQNY 541
            +VQG     L Y++    +G+ + +FF IL+  +  F     P   G   D +SF   Y
Sbjct: 478 FRVQGIDKSTLAYQSPLQPYGAWFSLFFCILIGLIKNF-----PAFLGDTFDYKSFITGY 532

Query: 542 LAFPIWLAFYFGYMVYNRDFTLLNPLDKIDLDFHRRIYD--PELMRQEDEENKEKL 595
           +  P ++  Y GY ++ +  T + P +++DL   +   D   E  +  DEE    L
Sbjct: 533 IGIPTYIISYIGYKLWYK--TKIIPSEEVDLVSFKEAVDLEEEEGKMLDEERAAHL 586

>CAGL0J08184g 804507..806225 similar to sp|P04817 Saccharomyces
           cerevisiae YEL063c CAN1 or sp|P38971 Saccharomyces
           cerevisiae YNL270c ALP1 or sp|P32487 Saccharomyces
           cerevisiae YNL268w LYP1, hypothetical start
          Length = 572

 Score =  306 bits (784), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 182/547 (33%), Positives = 292/547 (53%), Gaps = 20/547 (3%)

Query: 55  ADSFKRAEGSTTRTKQINENTS----DLEDGVESITSDSKLKKSMKSRHVVMMSLGTGIG 110
           +DS     G   R K+    +S    DL    + +     +K+S+K RH+ M++LG  IG
Sbjct: 26  SDSHNSNTGELGRRKRKTSVSSTQYEDLATEKDELLEHHDVKRSLKQRHIGMIALGGTIG 85

Query: 111 TGLLVANAKGLHYGGPAALIIGYILVSFETYFMIQAAGEMAVTYPTLPANFNAYSSIFIS 170
           TGL +  A  L   GP   ++ Y+ +    + + Q+ GEMA   P + ++F+ ++  F+S
Sbjct: 86  TGLFIGIATPLANAGPVGALVAYLFMGTVVFSVTQSLGEMATFIP-VTSSFSVFAQRFLS 144

Query: 171 KSFGFATVWLYCFQWLTVLPLELITASMTIQFGNDKINPDIYILIFYVFLVFIHFFGVKA 230
            + G A  ++Y   W     LEL      IQF   K+    +I IF+V L   + F VK 
Sbjct: 145 PALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFKVPLAAWISIFWVLLTAFNMFPVKF 204

Query: 231 YGETEFIFNCCKILMIAGFIILSIVINCGGAGNDGYIGATYWHNPGAF-----AGDTSIG 285
           YGE EF     K+L + GF+I S+ I CG AG  G IG  YW NPGA      + +T   
Sbjct: 205 YGEFEFWIASIKVLALMGFLIYSLCIVCG-AGKTGPIGFRYWRNPGAMGPGIISSNTGEA 263

Query: 286 RFKNVCYILVTAYFSFGGMELFALSVQEQSNPRKSTPVAAKRSIYRIVVIYLLTMILIGF 345
           RF      L+ A F++ G EL  ++  E +NPRK+ P A ++ + RI++ Y+ ++  IG 
Sbjct: 264 RFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGL 323

Query: 346 NVPYNDDQLMGAGGSATHASPYVLAASIHGVKIVPHIINAVILISVVSVANSSLYAGPRL 405
            VPYND +L     S   +SP+++     G +++PHI NAVIL +++S  NS++Y G R+
Sbjct: 324 TVPYNDPKLTSTD-SYVSSSPFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRI 382

Query: 406 ICSLAQQGYAPKFLDYVDREGRPLRALIVCCVFGVIAFVAASSKEEIVFTWLAAIAGLSE 465
           + S+A+ G APKFL     +G P  +++    FG ++++  S+     F WL  I G++ 
Sbjct: 383 LFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAG 442

Query: 466 LFTWTSIMLSHLRFRQAMKVQGRSLDELGYKATTGIWGSIYGVFFNILVFVAQFWVALAP 525
            F W  I  SH+RF QA+K +G S D+L YKA    W + Y +FF +++ + Q + + AP
Sbjct: 443 FFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAP 502

Query: 526 LGNGGKCDAESFFQNYLAFPIWLAFYFGYMVYNRDFTLLNPLDKIDLDFHRRIYDPELMR 585
             +G       F   Y++  ++L F+  + +Y R   ++  L+ +D+D  RR  + E + 
Sbjct: 503 HFSG-----RDFVAAYISVGLFLVFWGFFQIYFR-CRIIWKLEDVDIDTDRR--EIESVV 554

Query: 586 QEDEENK 592
            ED+  K
Sbjct: 555 WEDDAPK 561

>Kwal_33.13411
          Length = 560

 Score =  305 bits (780), Expect = 5e-96,   Method: Compositional matrix adjust.
 Identities = 182/562 (32%), Positives = 292/562 (51%), Gaps = 23/562 (4%)

Query: 32  QSSSSEKTYSKQKSGSDKLIHRFADSFKRAEGSTTRTKQINENTSDLEDGVESITSDSKL 91
           +SS      ++ K+ SD+    +  S +   G +       ++  DL++G        ++
Sbjct: 4   KSSELSSPLTQGKTRSDEF-QMYVYSNETQNGGSGHNSSFEDDEGDLQEG--------QV 54

Query: 92  KKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALIIGYILVSFETYFMIQAAGEMA 151
           K+++K RHV M++LG  IGTGL V  A  L   GP   +I YI +    YF+ Q+ GEMA
Sbjct: 55  KRALKPRHVSMIALGGTIGTGLFVGIASPLSSAGPVGALIAYIFMGSIVYFVTQSMGEMA 114

Query: 152 VTYPTLPANFNAYSSIFISKSFGFATVWLYCFQWLTVLPLELITASMTIQFGNDKINPDI 211
            T+  + ++   +S+ F+S +FG A  ++Y F W     +E+      IQ+    +    
Sbjct: 115 -TFIPVTSSITVFSNRFLSPAFGVANGYMYWFNWAITYAVEISVIGQVIQYWTKAVPLAA 173

Query: 212 YILIFYVFLVFIHFFGVKAYGETEFIFNCCKILMIAGFIILSIVINCGGAGNDGYIGATY 271
           +I IF+V +   +FF V+ YGE EF     K++ I G+++ +++I CGG+   G IG  Y
Sbjct: 174 WIGIFWVAITLANFFPVRFYGEVEFWVASIKVIAIVGYLLYALIIVCGGS-KQGPIGFRY 232

Query: 272 WHNPGAF-----AGDTSIGRFKNVCYILVTAYFSFGGMELFALSVQEQSNPRKSTPVAAK 326
           W NPG +     +GD   GRF      L+ A F++ G EL  ++  E +NPRK+ P A  
Sbjct: 233 WRNPGPWGDGIISGDKDKGRFLGWVASLINASFTYQGTELVGITAGEAANPRKTVPKAIN 292

Query: 327 RSIYRIVVIYLLTMILIGFNVPYNDDQLMGAGGSATHASPYVLAASIHGVKIVPHIINAV 386
           +  +RI+  Y+L++  +G  VPYN   L     S   +SP+V++    G +I+P I NAV
Sbjct: 293 KVFFRILFFYILSLFFVGLLVPYNHPGL-DKHTSVIASSPFVISIQSAGTRILPDIFNAV 351

Query: 387 ILISVVSVANSSLYAGPRLICSLAQQGYAPKFLDYVDREGRPLRALIVCCVFGVIAFVAA 446
           +L++++S ANS++Y G R++ SLA  G APK   YV  +G P   +I   + G++AF+  
Sbjct: 352 VLVTIISAANSNVYVGSRILFSLAHTGIAPKQFSYVTNQGVPYLGVICTALLGLLAFLVV 411

Query: 447 SSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGYKATTGIWGSIY 506
                  F WL  I+ L+ L  W  I +SH+RF Q +K +G S D+L +K+    +G+ Y
Sbjct: 412 DDNANEGFNWLINISTLAGLCAWLFISISHIRFMQCLKQRGISRDDLPFKSKLMPYGAYY 471

Query: 507 GVFFNILVFVAQFWVALAPLGNGGKCDAESFFQNYLAFPIWLAFYFGYMVYNRDFTLLNP 566
             F+  ++   Q + A  P     K     FF  Y++  I LA  F            N 
Sbjct: 472 AAFWVAVIIFVQGFQAFCP-----KFKVAEFFTGYISL-ILLAVVFCLAQLYYRCRFFNR 525

Query: 567 LDKIDLDFHRRIYDPELMRQED 588
           L+ ID+D  RR  D  +  +E+
Sbjct: 526 LEDIDIDSDRREIDALIWEEEE 547

>Scas_706.37
          Length = 544

 Score =  297 bits (760), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 182/524 (34%), Positives = 286/524 (54%), Gaps = 18/524 (3%)

Query: 76  SDLEDGVESITSDSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALIIGYIL 135
           S L+D  E       +K+ +K RH+ M++LG  IGTGL +  A+ L   GP   +I Y+ 
Sbjct: 23  STLDDDQEK---QQDVKRELKKRHISMIALGGTIGTGLFLGIARPLIIAGPIGALIAYLF 79

Query: 136 VSFETYFMIQAAGEMAVTYPTLPANFNAYSSIFISKSFGFATVWLYCFQWLTVLPLELIT 195
           +    + + Q+ GEM    P + A+F  ++  F+S +FG A  ++Y F W     LEL  
Sbjct: 80  MGTVVFSVTQSLGEMCTFIP-VTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSV 138

Query: 196 ASMTIQFGNDKINPDIYILIFYVFLVFIHFFGVKAYGETEFIFNCCKILMIAGFIILSIV 255
               IQF    +    +I I +V L   + F V+ YGE EF     K+L I GFII  I 
Sbjct: 139 VGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLAILGFIIYGIC 198

Query: 256 INCGGAGNDGYIGATYWHNPGAF-----AGDTSIGRFKNVCYILVTAYFSFGGMELFALS 310
           I CG AG  G +G  YW NPG +     + + +  RF      L+ A F+F G EL  ++
Sbjct: 199 IICG-AGVTGPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGIT 257

Query: 311 VQEQSNPRKSTPVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLMGAGGSATHASPYVLA 370
             E  NPRK+ P A K+ ++RI+V Y+ ++++IG  VPYND +L  +  S   +SP+++ 
Sbjct: 258 AGEAKNPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQ-SNDSYVSSSPFIIT 316

Query: 371 ASIHGVKIVPHIINAVILISVVSVANSSLYAGPRLICSLAQQGYAPKFLDYVDREGRPLR 430
               G KI+PHI NAVILI+++S  NS++Y G R++  LA+   APKF     + G P  
Sbjct: 317 IQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYV 376

Query: 431 ALIVCCVFGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSL 490
            ++   +FG +A++  ++  +  FTWL  I G++  F W  I  SH+RF +A+K +G S 
Sbjct: 377 TVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISR 436

Query: 491 DELGYKATTGIWGSIYGVFFNILVFVAQFWVALAPLGNGGKCDAESFFQNYLAFPIWLAF 550
           ++L YKA    W + Y VFF +++ V Q + + AP     K    +FF  Y++  +++ F
Sbjct: 437 NDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAP-----KFKVANFFAAYISVFLFIIF 491

Query: 551 YFGYMVYNRDFTLLNPLDKIDLDFHRRIYDPELMRQEDEENKEK 594
           +  + ++ +   L+  L  +DLD  RR  + E+   +D E+K K
Sbjct: 492 WVAFQIWFKC-RLVWKLQDVDLDTDRRDIEEEVW-SDDVEDKNK 533

>KLLA0C02365g 208462..210201 similar to sp|P32487 Saccharomyces
           cerevisiae YNL268w LYP1 lysine-specific high-affinity
           permease, hypothetical start
          Length = 579

 Score =  298 bits (762), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 182/527 (34%), Positives = 287/527 (54%), Gaps = 19/527 (3%)

Query: 75  TSDLEDGVESITSD-----SKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAAL 129
           +S+L D  ES   +     +++K+++K RHV M++LG  IGTGL V  AK L   GP   
Sbjct: 52  SSELYDHAESEEGEGDFHETEVKRALKPRHVSMIALGGTIGTGLFVGIAKPLSLSGPVGS 111

Query: 130 IIGYILVSFETYFMIQAAGEMAVTYPTLPANFNAYSSIFISKSFGFATVWLYCFQWLTVL 189
           +I YI +    YF+ Q+ GEMA   P + ++   +S  F+S +FG A  ++Y F W    
Sbjct: 112 LIAYIFMGSVVYFVTQSLGEMATFIP-VTSSITVFSKRFLSPAFGVANGYMYWFNWAITY 170

Query: 190 PLELITASMTIQFGNDKINPDIYILIFYVFLVFIHFFGVKAYGETEFIFNCCKILMIAGF 249
            +EL      I +  D +    +I IF+V L   +FF VK YGE EF     K++ I G+
Sbjct: 171 AVELSVLGQIINYWTDAVPLAAWIAIFWVLLTAANFFPVKWYGEFEFCVASIKVIAIVGY 230

Query: 250 IILSIVINCGGAGNDGYIGATYWHNPGAF-----AGDTSIGRFKNVCYILVTAYFSFGGM 304
           ++ +++I CGG+ + G IG  YW NPG +     A + +  RF      LV A F++ G 
Sbjct: 231 LLYALIIVCGGS-SQGPIGFRYWRNPGPWGTGTIAKNVNKARFLGWVGSLVNASFTYQGT 289

Query: 305 ELFALSVQEQSNPRKSTPVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLMGAGGSATHA 364
           EL  ++  E SNPRK+ P A  +  +RI+V Y+ ++  +G  VPYN  QL  +  +   +
Sbjct: 290 ELVGITAGEASNPRKTVPKAINKVFFRILVFYIGSLFFVGLLVPYNSPQLE-SNSAVIAS 348

Query: 365 SPYVLAASIHGVKIVPHIINAVILISVVSVANSSLYAGPRLICSLAQQGYAPKFLDYVDR 424
           SP+V++    G K++P I NAV+L++++S  NS++Y G R++ SLA  G APK   YV +
Sbjct: 349 SPFVISIQNAGTKVLPDIFNAVVLVTILSAGNSNVYVGSRVLYSLALSGNAPKQFSYVTK 408

Query: 425 EGRPLRALIVCCVFGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMK 484
           +G P   +I   + G++AF+A +      F WL  I+ L+ L  W  I ++H+RF Q +K
Sbjct: 409 QGVPYLGVICTALLGLLAFLATNENANTAFNWLINISTLAGLCAWFFISVAHIRFMQCLK 468

Query: 485 VQGRSLDELGYKATTGIWGSIYGVFFNILVFVAQFWVALAPLGNGGKCDAESFFQNYLAF 544
           ++G S D L +KA    WG+ Y  FF  L+   Q + A AP     + D   FF  Y++ 
Sbjct: 469 LRGISRDSLPFKAKLMPWGAYYAAFFVGLIVFIQGFTAFAP-----RFDVSEFFTAYISL 523

Query: 545 PIWLAFYFGYMVYNRDFTLLNPLDKIDLDFHRRIYDPELMRQEDEEN 591
            + +  +    +Y R    L  ++ ID+D  RR  D  +   ++ +N
Sbjct: 524 ILLVVLFILCQLYYR-CRFLTKIEDIDIDSDRREIDAIIWEDDEPKN 569

>KLLA0C02343g complement(203552..205297) similar to sp|P04817
           Saccharomyces cerevisiae YEL063c CAN1 amino acid
           permease, start by similarity
          Length = 581

 Score =  297 bits (761), Expect = 5e-93,   Method: Compositional matrix adjust.
 Identities = 174/513 (33%), Positives = 281/513 (54%), Gaps = 10/513 (1%)

Query: 44  KSGSDKLIHRFADSFKRAEGSTTRTKQINENTSDLEDGVESITSDSKLKKSMKSRHVVMM 103
           +SG      +  D  + ++ +    + I++++S + D   SI   +++K+++K RHV M+
Sbjct: 27  RSGMHVSNSKIDDPLRFSKDNNLTLEAIDDDSSRMFDPEGSI-GQAEVKRALKPRHVSMI 85

Query: 104 SLGTGIGTGLLVANAKGLHYGGPAALIIGYILVSFETYFMIQAAGEMAVTYPTLPANFNA 163
           +LG  IGTGL ++ +  L   GP   +I ++L+    Y + Q+ GEMA   P + ++F  
Sbjct: 86  ALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIP-VTSSFTV 144

Query: 164 YSSIFISKSFGFATVWLYCFQWLTVLPLELITASMTIQFGNDKINPDIYILIFYVFLVFI 223
           +S  FIS + G A  ++Y F W     LEL      IQ+  D +  + +I IF+V LV  
Sbjct: 145 FSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSF 204

Query: 224 HFFGVKAYGETEFIFNCCKILMIAGFIILSIVINCGGAGNDGYIGATYWHNPGAF----- 278
           + F VK YGE EF     K++ I GF+I S+ + CG AG +G IG  YW  PG +     
Sbjct: 205 NMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCG-AGPEGPIGFRYWRKPGPWGNGII 263

Query: 279 AGDTSIGRFKNVCYILVTAYFSFGGMELFALSVQEQSNPRKSTPVAAKRSIYRIVVIYLL 338
           A + +  RF      L++A F++ G EL  ++  E  NPRK+ P A  +  +RI++ Y+ 
Sbjct: 264 AKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIG 323

Query: 339 TMILIGFNVPYNDDQLMGA-GGSATHASPYVLAASIHGVKIVPHIINAVILISVVSVANS 397
           ++  IG  VPYND +L G+  GS    SP+++A       ++PHI NAVIL +++S  NS
Sbjct: 324 SLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNS 383

Query: 398 SLYAGPRLICSLAQQGYAPKFLDYVDREGRPLRALIVCCVFGVIAFVAASSKEEIVFTWL 457
           ++Y G R++  L++   APKF     + G P  A+++  VFG +A++  S+  + VF WL
Sbjct: 384 NVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWL 443

Query: 458 AAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGYKATTGIWGSIYGVFFNILVFVA 517
             I  ++   TW  I +SH+RF Q +K +G S D+L YKA    + + Y  FF  ++ + 
Sbjct: 444 LNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKAKFMPYAAYYAAFFITVIIII 503

Query: 518 QFWVALAPLGNGGKCDAESFFQNYLAFPIWLAF 550
           Q + A AP  N     A ++   +L F +W  F
Sbjct: 504 QGFTAFAPHFNVSDFFA-AYISVFLFFIVWAIF 535

>Kwal_33.13401
          Length = 559

 Score =  296 bits (757), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 176/556 (31%), Positives = 292/556 (52%), Gaps = 27/556 (4%)

Query: 35  SSEKTYSKQKSGS---DKLIHRFADSFKRAEGSTTRTKQINENTSDLEDGVESITSDSKL 91
           +SEK    QK+ +   D  +  FA+     E  +++  Q+  +              + +
Sbjct: 4   TSEKEGMSQKTETRLEDYEMGSFAEEALDQEAQSSQDSQLGSSGH----------GRNAV 53

Query: 92  KKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALIIGYILVSFETYFMIQAAGEMA 151
           ++ +K RHV M++LG  IGTGL +     L   GP   +I Y+ +    Y + Q+ GEMA
Sbjct: 54  QRQLKPRHVSMIALGGTIGTGLFIGIESPLRNAGPVGALISYLFMGSIAYCVTQSLGEMA 113

Query: 152 VTYPTLPANFNAYSSIFISKSFGFATVWLYCFQWLTVLPLELITASMTIQFGNDKINPDI 211
              P + ++F  ++  F+S   G A  ++YCF W     LEL      I++    +    
Sbjct: 114 TFIP-VTSSFTVFTRRFLSLPLGAANGYMYCFSWSVTYALELSIVGQIIEYWTSAVPNAA 172

Query: 212 YILIFYVFLVFIHFFGVKAYGETEFIFNCCKILMIAGFIILSIVINCGGAGNDGYIGATY 271
           +I IF+V +   +   VK YGE +F     K++ I GF++  + + CG AG  G +G  Y
Sbjct: 173 WIAIFWVPITLSNLVPVKFYGEFQFWIALIKVVAIIGFLVYCLCMVCG-AGKTGPVGFRY 231

Query: 272 WHNPGAF-----AGDTSIGRFKNVCYILVTAYFSFGGMELFALSVQEQSNPRKSTPVAAK 326
           W NPG +     + D   GRF      LV A F++ G EL  +S  E +NPRK+ P A  
Sbjct: 232 WRNPGPWGDGIISHDIHEGRFLGWVSSLVNAAFTYQGTELVGISAGESANPRKTVPKAIN 291

Query: 327 RSIYRIVVIYLLTMILIGFNVPYNDDQLMGAGGSATHASPYVLAASIHGVKIVPHIINAV 386
           +  +RI++ Y+ ++  IG  VP+ND++L  +  S +  SP+++A    G KI+P I NAV
Sbjct: 292 KVFFRILLFYVGSLFFIGLLVPFNDEKLTSSD-SYSAGSPFIIAIQNSGTKILPDIFNAV 350

Query: 387 ILISVVSVANSSLYAGPRLICSLAQQGYAPKFLDYVDREGRPLRALIVCCVFGVIAFVAA 446
           IL +++S ANS++Y G R++  LA++  AP+F    +R G P  A++    FG + +++ 
Sbjct: 351 ILATIISAANSNVYVGSRVLYGLAKERLAPRFFARTNRHGVPDVAVLFVANFGFLGYLSV 410

Query: 447 SSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGYKATTGIWGSIY 506
           S+     F WL  I  ++  F+W  I L H+RF QA+K+QG S D+L +KA    WG+ Y
Sbjct: 411 SNGASKAFDWLLNITAIAGFFSWLFISLCHVRFMQALKLQGISRDDLPFKAKLMPWGAYY 470

Query: 507 GVFFNILVFVAQFWVALAPLGNGGKCDAESFFQNYLAFPIWLAFYFGYMVYNRDFTLLNP 566
             FF  L+ + Q + +LAP  N       +FF  Y++  ++L  +  +  + R   +++ 
Sbjct: 471 SAFFITLIIIIQGFTSLAPTFN-----VSNFFAAYISVFMFLVIWAVFQCWYRT-RIIHR 524

Query: 567 LDKIDLDFHRRIYDPE 582
           ++ +D+D  RR  D +
Sbjct: 525 IEHVDIDSDRREVDAQ 540

>AFR667C [3860] [Homologous to ScYNL268W (LYP1) - SH]
           (1657064..1658755) [1692 bp, 563 aa]
          Length = 563

 Score =  295 bits (756), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 166/509 (32%), Positives = 279/509 (54%), Gaps = 12/509 (2%)

Query: 88  DSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALIIGYILVSFETYFMIQAA 147
           ++++K+++K+RH+ M++LG  IGTGL +  A  L   GP   ++ YI +    Y + Q+ 
Sbjct: 52  ETEVKRALKARHISMIALGGTIGTGLFIVIASPLRTAGPVGSLLAYIFIGTVVYSITQSL 111

Query: 148 GEMAVTYPTLPANFNAYSSIFISKSFGFATVWLYCFQWLTVLPLELITASMTIQFGNDKI 207
           GEMA   P + ++   +S  F+S +FG A  ++Y F W     +EL      IQ+  D++
Sbjct: 112 GEMATFIP-VTSSVTVFSKRFLSPAFGVANGYMYWFNWAITFAVELSVVGQIIQYWTDRV 170

Query: 208 NPDIYILIFYVFLVFIHFFGVKAYGETEFIFNCCKILMIAGFIILSIVINCGGA--GNDG 265
               +I+IF+V +  ++FF V+ YGE EF     K+L I G++I + +I CGG+  G  G
Sbjct: 171 PIAAWIVIFWVLVTLVNFFPVRFYGEIEFWIASVKVLTIVGYLIYAFIIVCGGSKQGPIG 230

Query: 266 YIGATYWHNPGAFAGDTSIGR---FKNVCYILVTAYFSFGGMELFALSVQEQSNPRKSTP 322
                     GA A   +  +   F      L+ A F++ G EL  ++  E +NPRK+ P
Sbjct: 231 LPATGGIPARGARASSRTTRKRHGFLGWVSSLIKAAFTYQGTELVGITAGESTNPRKNVP 290

Query: 323 VAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLMGAGGSATHASPYVLAASIHGVKIVPHI 382
            A  +  +RI+  Y+ +++ +G  VPY+D +L     +  +ASP+V++    G KI+P I
Sbjct: 291 KAINKVFFRILFFYIGSLLFVGLLVPYDDPRLNSESSTDVNASPFVISIKNAGTKILPDI 350

Query: 383 INAVILISVVSVANSSLYAGPRLICSLAQQGYAPKFLDYVDREGRPLRALIVCCVFGVIA 442
            NAV+LI+V+S ANS++Y G R+  SLA  G APK L +V ++G P   +++  + G+++
Sbjct: 351 FNAVVLITVISAANSNVYIGSRVAYSLALAGNAPKQLAFVTKQGVPYFGVLITSLMGLMS 410

Query: 443 FVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGYKATTGIW 502
           F+  +      F WL  I+ L+ L  W  I L+H+RF Q +K +G S D+L +KA    W
Sbjct: 411 FLVLNHNASTAFDWLVNISTLAGLCAWLFISLAHIRFMQCLKHRGISRDDLPFKAKFMPW 470

Query: 503 GSIYGVFFNILVFVAQFWVALAPLGNGGKCDAESFFQNYLAFPIWLAFYFGYMVYNRDFT 562
            + Y  FF  ++   Q + A  P     K D  +FF +Y++  + L  + G  +Y +   
Sbjct: 471 AAYYATFFVTVIIFIQGYTAFTP-----KFDVTTFFTSYISLFLMLLVFIGCQIYYK-CR 524

Query: 563 LLNPLDKIDLDFHRRIYDPELMRQEDEEN 591
            L  ++ ID+D  RR  D  +  +++ +N
Sbjct: 525 FLWAVEDIDIDSDRREIDAIVWEEDEPKN 553

>CAGL0A01199g 121067..122908 similar to sp|P53388 Saccharomyces
           cerevisiae YPL265w DIP5 dicarboxylic amino acid
           permease, hypothetical start
          Length = 613

 Score =  295 bits (755), Expect = 8e-92,   Method: Compositional matrix adjust.
 Identities = 181/545 (33%), Positives = 295/545 (54%), Gaps = 24/545 (4%)

Query: 65  TTRTKQINENTSDLEDGVESITSDSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYG 124
           ++R +   +    ++DG +  T   +L+K +K+RH+ M+++G  IGTGLL+     L+  
Sbjct: 63  SSRLEDSEKQDDYMDDGKDEHT---RLRKDLKARHISMIAIGGSIGTGLLIGTGNSLYTA 119

Query: 125 GPAALIIGYILVSFETYFMIQAAGEMAVTYPTLPANFNAYSSIFISKSFGFATVWLYCFQ 184
           GP ++ I Y  V    +F + A GEMA   P     F +Y+S +   + GFA  + Y  +
Sbjct: 120 GPMSMFIAYAFVGVLVFFTMAALGEMASYIPL--DGFTSYASRYCDPALGFAVGYAYLCK 177

Query: 185 WLTVLPLELITASMTIQFGNDK--INPDIYILIFYVFLVFIHFFGVKAYGETEFIFNCCK 242
           +L + P +L  A++ IQ+  D+  +NP ++I IF V +V ++F GVK +GE EF  +  K
Sbjct: 178 YLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFK 237

Query: 243 ILMIAGFIILSIVINCGGAGNDGYIGATYWHNPGAFAG-----DTSIGRFKNVCYILVTA 297
           ++++ G IIL  VI  GG      +G  ++ +PGAF       D S G+F     +LV A
Sbjct: 238 VIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKFVAFVAVLVYA 297

Query: 298 YFSFGGMELFALSVQEQSNPRKSTPVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLMGA 357
            F++ G+EL  +   E +NPRKS P A K ++YRI+V YL+T+ L+G  V Y+D  L  A
Sbjct: 298 LFAYLGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLKKA 357

Query: 358 --GGSATHASPYVLAASIHGVKIVPHIINAVILISVVSVANSSLYAGPRLICSLAQQGYA 415
              G+   ASPYV+A    G+K +PHI NA +L+ V S  NS LY   R +  LA    A
Sbjct: 358 KTSGTGAAASPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKA 417

Query: 416 PKFLDYVDREGRPLRALIVCCVFGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLS 475
           PK     +R G P  +L++   F ++A+++ SS    +F +   +  +  L +W SI+++
Sbjct: 418 PKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILIT 477

Query: 476 HLRFRQAMKVQGRSLDELGYKATTGIWGSIYGVFFNILV-FVAQFWVALAPLGNGGKCDA 534
           +L F +A+K Q        Y+A    +GS + + F IL+ F+  F V L         D 
Sbjct: 478 YLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFL-----NHHFDY 532

Query: 535 ESFFQNYLAFPIWLAFYFGYMVYNRDFTLLNPLDKIDLDFHRRIYDPELMRQE--DEENK 592
           ++F   Y+  P+++  YFGY    +  T +   +++DL   +   D E  + +  D E +
Sbjct: 533 KNFITGYIGIPVFVISYFGYKFVKK--TKIWKPEEVDLYTFKAAIDEEEEQGKIADAERR 590

Query: 593 EKLRN 597
           E+L+N
Sbjct: 591 ERLKN 595

>YPL265W (DIP5) [5186] chr16 (41043..42869) Dicarboxylic amino acid
           permease, also transports alanine, glycine, serine,
           asparagine and glutamine [1827 bp, 608 aa]
          Length = 608

 Score =  291 bits (746), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 176/524 (33%), Positives = 291/524 (55%), Gaps = 23/524 (4%)

Query: 87  SDSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALIIGYILVSFETYFMIQA 146
            +++L+K +K+RH+ M+++G  +GTGLL+     L  GGP A++I Y  V    ++ +  
Sbjct: 78  ENTRLRKDLKARHISMIAIGGSLGTGLLIGTGTALLTGGPVAMLIAYAFVGLLVFYTMAC 137

Query: 147 AGEMAVTYPTLPANFNAYSSIFISKSFGFATVWLYCFQWLTVLPLELITASMTIQF--GN 204
            GEMA   P     F +Y+S ++  + GFA  + Y F++  + P +L  A++ IQ+    
Sbjct: 138 LGEMASYIPL--DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISR 195

Query: 205 DKINPDIYILIFYVFLVFIHFFGVKAYGETEFIFNCCKILMIAGFIILSIVINCGGAGND 264
           D++NP ++I IF V +V I+  GVK +GE EF  +  K++++ G I+L  +I  GG  N 
Sbjct: 196 DRVNPGVWITIFLVVIVAINVVGVKFFGEFEFWLSSFKVMVMLGLILLLFIIMLGGGPNH 255

Query: 265 GYIGATYWHNPGAFAG-DTSI----GRFKNVCYILVTAYFSFGGMELFALSVQEQSNPRK 319
             +G  YW +PGAF    T+I    G+F +   + V + FS+ G+EL  +   E  NPRK
Sbjct: 256 DRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPRK 315

Query: 320 STPVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLMGAGGSATHA--SPYVLAASIHGVK 377
           S P A K ++YRI+V YL T+ L+G  V YND +L+   G +  A  SP+V+A    G++
Sbjct: 316 SVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIE 375

Query: 378 IVPHIINAVILISVVSVANSSLYAGPRLICSLAQQGYAPKFLDYVDREGRPLRALIVCCV 437
           ++PHI NA +L+ V S  NS LY   R + +LA  G APK      R G P  ALI+  +
Sbjct: 376 VLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSVL 435

Query: 438 FGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGYKA 497
           F  +A++  SS    +F +   +  +  + +W +I++ ++ F +A + QG    +  Y A
Sbjct: 436 FCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVA 495

Query: 498 TTGIWGSIYGVFFNILV-FVAQFWVALAPLGNGGKCDAESFFQNYLAFPIWLAFYFGY-M 555
               +G+ + +FF IL+  +  F V L     G K D ++F   Y+  P+++  + GY +
Sbjct: 496 PGQRYGAYFALFFCILIALIKNFTVFL-----GHKFDYKTFITGYIGLPVYIISWAGYKL 550

Query: 556 VYNRDFTLLNPLDKIDLDFHRRIYDPELM--RQEDEENKEKLRN 597
           +Y    T +     +DL   + IYD E    R +D+E +E+L++
Sbjct: 551 IYK---TKVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKS 591

>AFR668W [3861] [Homologous to ScYEL063C (CAN1) - SH; ScYNL270C
           (ALP1) - SH] complement(1659469..1661139) [1671 bp, 556
           aa]
          Length = 556

 Score =  287 bits (734), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 167/499 (33%), Positives = 271/499 (54%), Gaps = 13/499 (2%)

Query: 61  AEGSTTRTKQINENTSDLEDGVESITSDSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKG 120
           A+    + + +N NTS++E   E   + S +K+ +K RHV M+SLG  IGTGL +  A  
Sbjct: 20  AKPGAIKAEVLNHNTSEVESLCEK-PNQSDVKRELKPRHVTMISLGGTIGTGLFIGIASP 78

Query: 121 LHYGGPAALIIGYILVSFETYFMIQAAGEMAVTYPTLPANFNAYSSIFISKSFGFATVWL 180
           +   GP   ++ YI V+   Y + Q+ GEMA   P + ++F  ++S F+S + G A  +L
Sbjct: 79  IRNAGPVGSLLAYIFVATMAYCVTQSLGEMATFIP-VTSSFTVFASRFVSPALGAANGYL 137

Query: 181 YCFQWLTVLPLELITASMTIQFGNDKINPDIYILIFYVFLVFIHFFGVKAYGETEFIFNC 240
           Y   W     LE+      I + +D +    ++ IF+V L  I+   VK YGE EF    
Sbjct: 138 YWLSWCITFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIAS 197

Query: 241 CKILMIAGFIILSIVINCGGAGNDGYIGATYWHNPGAF-----AGDTSIGRFKNVCYILV 295
            K++ I  F+   +V+ CGG+   G IG  YW +PG +     + +    +F      L+
Sbjct: 198 LKVIAILCFLFYGLVVVCGGS-KLGRIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLI 256

Query: 296 TAYFSFGGMELFALSVQEQSNPRKSTPVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLM 355
            A F+F G EL  ++  E  NPR++ P A     +RI++ Y+ ++++IG  V Y+D QL+
Sbjct: 257 KAAFTFQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLI 316

Query: 356 GAGGSA-THASPYVLAASIHGVKIVPHIINAVILISVVSVANSSLYAGPRLICSLAQQGY 414
             G +   +ASP+V+A +  G K++P I+N VI+++++S  NS++Y G R++  L + G 
Sbjct: 317 QDGSTTNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGL 376

Query: 415 APKFLDYVDREGRPLRALIVCCVFGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIML 474
           AP F+      G P  A++   +FG + ++  SSK   VF WL +I  +S  FTW  I +
Sbjct: 377 APAFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISV 436

Query: 475 SHLRFRQAMKVQGRSLDELGYKATTGIWGSIYGVFFNILVFVAQFWVALAPLGNGGKCDA 534
           SH+RF Q +K +G S D+L +KA    +G+ Y  FF I++ + Q + A  P       D 
Sbjct: 437 SHIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTPF---SAVDF 493

Query: 535 ESFFQNYLAF-PIWLAFYF 552
            +++ +   F  IWL F F
Sbjct: 494 VAYYISAFIFVVIWLLFQF 512

>YNL270C (ALP1) [4339] chr14 complement(135939..137660) Arginine
           permease, has strong similarity to basic amino acid
           permeases Can1p and Lyp1p, member of the amino acid
           permease family of membrane transporters [1722 bp, 573
           aa]
          Length = 573

 Score =  287 bits (735), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 183/544 (33%), Positives = 289/544 (53%), Gaps = 15/544 (2%)

Query: 52  HRFADSFKRAEGSTTRTKQINENTSDLEDGVESITSDSK-LKKSMKSRHVVMMSLGTGIG 110
             F D     E  T       +   D     ES   + + +K+ +K RH+ M++LG  IG
Sbjct: 26  EEFVDEQYSGENVTKAITTERKVEDDAAKETESSPQERREVKRKLKQRHIGMIALGGTIG 85

Query: 111 TGLLVANAKGLHYGGPAALIIGYILVSFETYFMIQAAGEMAVTYPTLPANFNAYSSIFIS 170
           TGL++     L + GP   +I Y+ +    Y + Q+ GEM VT+  + ++F+ ++  F+S
Sbjct: 86  TGLIIGIGPPLAHAGPVGALISYLFMGTVIYSVTQSLGEM-VTFIPVTSSFSVFAQRFLS 144

Query: 171 KSFGFATVWLYCFQWLTVLPLELITASMTIQFGNDKINPDIYILIFYVFLVFIHFFGVKA 230
            + G    ++Y   W     LEL      IQ+  + +    +I+IF+  L  ++ F VK 
Sbjct: 145 PALGATNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKY 204

Query: 231 YGETEFIFNCCKILMIAGFIILSIVINCGGAGNDGYIGATYWHNPGAF-----AGDTSIG 285
           YGE EF     K++ + GFII S  + CG   +DG IG  YW NPGA+     + D + G
Sbjct: 205 YGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEG 264

Query: 286 RFKNVCYILVTAYFSFGGMELFALSVQEQSNPRKSTPVAAKRSIYRIVVIYLLTMILIGF 345
           RF      L+ A F++ G EL  ++  E +NPRK+ P A K+ + RI+V Y+L++  IG 
Sbjct: 265 RFLGWVSSLINAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGL 324

Query: 346 NVPYNDDQLMGAGGSATHASPYVLAASIHGVKIVPHIINAVILISVVSVANSSLYAGPRL 405
            VPYND +L  + G    +SP++++    G K++P I NAV+LI+++S  NS++Y G R+
Sbjct: 325 LVPYNDPKL-DSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRV 383

Query: 406 ICSLAQQGYAPKFLDYVDREGRPLRALIVCCVFGVIAFVAASSKEEIVFTWLAAIAGLSE 465
           + SL++   AP+FL  V R G P  +++   VFG +AF+  S+     F WL  I G++ 
Sbjct: 384 LYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAG 443

Query: 466 LFTWTSIMLSHLRFRQAMKVQGRSLDELGYKATTGIWGSIYGVFFNILVFVAQFWVALAP 525
            F W  I  SH+RF QA++ +G S D+L YKA    + + Y  FF  L+ + Q + A AP
Sbjct: 444 FFAWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAP 503

Query: 526 LGNGGKCDAESFFQNYLAFPIWLAFYFGYMVYNRDFTLLNPLDKIDLDFHRRIYDPELMR 585
                      F   Y++  ++LA +  + V+ +   LL  L  ID+D  RR  + EL+ 
Sbjct: 504 -----TFQPIDFVAAYISIFLFLAIWLSFQVWFK-CRLLWKLQDIDIDSDRRQIE-ELVW 556

Query: 586 QEDE 589
            E E
Sbjct: 557 IEPE 560

>Scas_486.2
          Length = 597

 Score =  278 bits (712), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 182/584 (31%), Positives = 309/584 (52%), Gaps = 43/584 (7%)

Query: 43  QKSGSDKLIHRFADSFKRAEGSTTRTKQINENTSDLEDG---------------VESITS 87
           +++ SD+    F D  K+ +  T  T++      DLE+                V+  T 
Sbjct: 9   EETTSDRYEEYF-DPQKKVDSKTFPTQERELLHDDLENNISLSTSAEDQNDSYNVDGKTE 67

Query: 88  DSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALIIGYILVSFETYFMIQAA 147
            ++LKK ++ R V M+++G  +GTGLL+     L   GP +++I Y  V    +F + + 
Sbjct: 68  GTRLKKVLEGRVVSMVAIGGSLGTGLLIGTGNSLATAGPVSMLIAYAFVGLLVFFTMASL 127

Query: 148 GEMAVTYPTLPANFNAYSSIFISKSFGFATVWLYCFQWLTVLPLELITASMTIQF--GND 205
           GEMA   P     F +Y++ +   + GFA  + Y F++  + P +L  A++ IQ+    +
Sbjct: 128 GEMASYIPL--DGFTSYATRYADPALGFAVGYCYLFKYFILPPNQLTAAALVIQYWIPRE 185

Query: 206 KINPDIYILIFYVFLVFIHFFGVKAYGETEFIFNCCKILMIAGFIILSIVINCGGAGNDG 265
           K+NP ++I IF V +V I+  GV+ +GE EF  +  K+L++   IIL  ++  GG  N  
Sbjct: 186 KVNPGVWITIFLVVIVAINTLGVQFFGEFEFWLSSFKVLVMFALIILLFILMLGGGPNHD 245

Query: 266 YIGATYWHNPGAF-------AGDTSIGRFKNVCYILVTAYFSFGGMELFALSVQEQSNPR 318
            +G  +W +PGAF        GDT  G+F     + V A F++ G EL  + V E  NPR
Sbjct: 246 RLGFRHWKHPGAFNNYSPAITGDT--GKFVAFVSVFVYATFAYLGTELVGIVVGEARNPR 303

Query: 319 KSTPVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLMGAGGSATHA--SPYVLAASIHGV 376
           KS P A K ++YRI++ YL++++L+G  V Y+D  L+ A   +T A  SP+V+A    G+
Sbjct: 304 KSVPKAIKLTMYRIIIFYLISILLLGMCVGYDDPLLLEAKTKSTSAAASPFVVAIVNSGI 363

Query: 377 KIVPHIINAVILISVVSVANSSLYAGPRLICSLAQQGYAPKFLDYVDREGRPLRALIVCC 436
           K++PHI NA +L+ V S  NS LY   R + SLA    APK     +R G P  +L +  
Sbjct: 364 KVLPHIFNACVLVFVFSACNSDLYVASRSLYSLAIDNKAPKIFARTNRWGIPYYSLGLSV 423

Query: 437 VFGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGYK 496
           +F ++A+++ SS    +F +   +  +  L +W  I++++L F +A++ QG       Y 
Sbjct: 424 LFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWICILVTYLAFDRAVRAQGIDKSTFSYV 483

Query: 497 ATTGIWGSIYGVFF-NILVFVAQFWVALAPLGNGGKCDAESFFQNYLAFPIWLAFYFGY- 554
           A    +G+ + +FF +++  +  F V L     G + D ++F   Y+  P++   YFGY 
Sbjct: 484 APGQRYGAYFALFFCSLIALIKNFTVFL-----GHQFDYKTFITGYIGIPVFFISYFGYK 538

Query: 555 MVYNRDFTLLNPLDKIDLDFHRRIYDPELM--RQEDEENKEKLR 596
           ++Y     +++PL+ +DL   +   D E    + ED   KE+++
Sbjct: 539 LIYKTK--IIDPLE-VDLYTFKAAIDQEEEDGKLEDIARKERIK 579

>Scas_377.2
          Length = 490

 Score =  273 bits (698), Expect = 8e-85,   Method: Compositional matrix adjust.
 Identities = 165/495 (33%), Positives = 265/495 (53%), Gaps = 16/495 (3%)

Query: 110 GTGLLVANAKGLHYGGPAALIIGYILVSFETYFMIQAAGEMAVTYPTLPANFNAYSSIFI 169
           G GL +  +  L   GP   +I Y+ ++   Y + Q+ GEMA T+  + ++F  +S  F+
Sbjct: 4   GXGLFIGVSTPLMNAGPVGALIAYLFMATLAYSVTQSLGEMA-TFIPVTSSFTVFSQRFV 62

Query: 170 SKSFGFATVWLYCFQWLTVLPLELITASMTIQFGNDKINPDIYILIFYVFLVFIHFFGVK 229
           S +FG A  ++Y F W     LEL      IQF    +    +I IF+V L  ++ F VK
Sbjct: 63  SPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVK 122

Query: 230 AYGETEFIFNCCKILMIAGFIILSIVINCGGAGNDGYIGATYWHNPGAF-----AGDTSI 284
            YGE EF     K++ I GF+I    + CG AG  G +G  YW +PGAF     A D + 
Sbjct: 123 YYGEFEFWVALVKVVAIMGFLIYCFCMVCG-AGVTGPVGFRYWRHPGAFGPGIIAKDKNQ 181

Query: 285 GRFKNVCYILVTAYFSFGGMELFALSVQEQSNPRKSTPVAAKRSIYRIVVIYLLTMILIG 344
            RF      L+ A F+F G EL  ++  E +NPRK+ P A K+ ++RI+  Y+L++  IG
Sbjct: 182 ARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILFFYILSLFFIG 241

Query: 345 FNVPYNDDQLMGAGGSATHASPYVLAASIHGVKIVPHIINAVILISVVSVANSSLYAGPR 404
             VPY+D +L     S   ASP+++A    G  ++PHI NAVI+ +++S  NS++Y G R
Sbjct: 242 LLVPYDDWKLTSTD-SYVSASPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSR 300

Query: 405 LICSLAQQGYAPKFLDYVDREGRPLRALIVCCVFGVIAFVAASSKEEIVFTWLAAIAGLS 464
           ++  L+    AP  L    + G P  A++V  +FG +A++  S+  +  F WL  I G++
Sbjct: 301 IMYGLSTSRLAPGILSRTTQHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVA 360

Query: 465 ELFTWTSIMLSHLRFRQAMKVQGRSLDELGYKATTGIWGSIYGVFFNILVFVAQFWVALA 524
             FTW  I LSH+RF QA++++G S D+L +KA      + YGVFF  L+ + Q + +  
Sbjct: 361 GFFTWLFISLSHIRFMQALEMRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFC 420

Query: 525 PLGNGGKCDAESFFQNYLAFPIWLAFYFGYMVYNRDFTLLNPLDKIDLDFHRR-IYDPEL 583
           P       +   F   Y++  +++A +  +  + R   L+  ++ +D+D  RR + +   
Sbjct: 421 P------WNGIDFLTAYISVFMFIAIWIAFQAWFRC-RLIWRVEDVDIDTDRRAVEEAVW 473

Query: 584 MRQEDEENKEKLRNM 598
           + QE     +K  N+
Sbjct: 474 IEQEPRGFWDKFWNV 488

>YOR348C (PUT4) [5125] chr15 complement(986894..988777) High
           affinity proline permease, also transports alanine and
           glycine [1884 bp, 627 aa]
          Length = 627

 Score =  276 bits (705), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 185/622 (29%), Positives = 308/622 (49%), Gaps = 53/622 (8%)

Query: 2   LSSEDFGSSGKKETSPDSISIRSFSAGNNFQSSSSEKTYSKQKSGSDKLIHRFADSFKRA 61
           +S +  G   KKE     ++    S   N   S +EK  + +       + + + +   +
Sbjct: 24  VSGDGSGGDTKKEEDVVQVTESPSSGSRNNHRSDNEKDDAIR-------MEKISKNQSAS 76

Query: 62  EGSTTRTKQINENTSDLEDGVESITSDSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGL 121
              T R   I +   +    V+  +   KLK+ ++SRHV +++LG  IGTGLLV  +  L
Sbjct: 77  SNGTIREDLIMDVDLEKSPSVDGDSEPHKLKQGLQSRHVQLIALGGAIGTGLLVGTSSTL 136

Query: 122 HYGGPAALIIGYILVSFETYFMIQAAGEMAVTYPTLPANFNAYSSIFISK----SFGFAT 177
           H  GPA L I YI++S   Y ++ A GEM    P   ++    ++  +++    S GFAT
Sbjct: 137 HTCGPAGLFISYIIISAVIYPIMCALGEMVCFLPGDGSDSAGSTANLVTRYVDPSLGFAT 196

Query: 178 VWLYCFQWLTVLPLELITASMTIQFGNDKINPDIYILIFYVFLVFIHFFGVKAYGETEFI 237
            W Y + ++ ++  E   AS  +++    +   ++I IF   +V ++F  VK YGE+EF 
Sbjct: 197 GWNYFYCYVILVAAECTAASGVVEYWTTAVPKGVWITIFLCVVVILNFSAVKVYGESEFW 256

Query: 238 FNCCKILMIAGFIILSIVINCGGAGNDGYIGATYWHNPGAFAGDT---SIGRFKNVCYIL 294
           F   KIL I G IILS ++  GG  N   +G  YW +PGAFA      S+G F ++   +
Sbjct: 257 FASIKILCIVGLIILSFILFWGGGPNHDRLGFRYWQHPGAFAHHLTGGSLGNFTDIYTGI 316

Query: 295 VTAYFSF-GGMELFALSVQEQSNPRKSTPVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQ 353
           +   F+F  G EL  ++  E ++ R++   A++R ++R++  Y+L  + I   VPYND  
Sbjct: 317 IKGAFAFILGPELVCMTSAECADQRRNIAKASRRFVWRLIFFYVLGTLAISVIVPYNDPT 376

Query: 354 LMGA---GGSATHASPYVLAASIHGVKIVPHIINAVILISVVSVANSSLYAGPRLICSLA 410
           L+ A   G     +SP+V+     G+K++PHIIN  IL S  S AN+ ++A  R + ++A
Sbjct: 377 LVNALAQGKPGAGSSPFVIGIQNAGIKVLPHIINGCILTSAWSAANAFMFASTRSLLTMA 436

Query: 411 QQGYAPKFLDYVDREGRPLRALIVCCVFGVIAFVAASSKEEIVFTWLAAIAGLSELFTWT 470
           Q G APK L  +++ G P  A+ V  +   +A++  SS    VF W + I+ +S    W 
Sbjct: 437 QTGQAPKCLGRINKWGVPYVAVGVSFLCSCLAYLNVSSSTADVFNWFSNISTISGFLGWM 496

Query: 471 SIMLSHLRFRQAMKVQGRSLDELGYKATTGIWGSIYGVFFNILV------------FVAQ 518
              +++LRFR+A+   G   D L +K     WG  Y V+F+++V            F+ +
Sbjct: 497 CGCIAYLRFRKAIFYNGL-YDRLPFKT----WGQPYTVWFSLIVIGIITITNGYAIFIPK 551

Query: 519 FWVALAPLGNGGKCDAESFFQNYLAFPIWLAFYFGYMVYNRDF-TLLNPLDKID-----L 572
           +W                F   Y+  PI+L  +FG+ +Y R +     P+ +ID     +
Sbjct: 552 YW------------RVADFIAAYITLPIFLVLWFGHKLYTRTWRQWWLPVSEIDVTTGLV 599

Query: 573 DFHRRIYDPELMRQEDEENKEK 594
           +   +  + E MR      K+K
Sbjct: 600 EIEEKSREIEEMRLPPTGFKDK 621

>Kwal_33.15545
          Length = 576

 Score =  274 bits (701), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 177/545 (32%), Positives = 283/545 (51%), Gaps = 27/545 (4%)

Query: 68  TKQINENTSDLEDGVESITSDSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPA 127
           T +       + +GV+      +LKK +++RHV M+++G  +GTGLL+     L   GP 
Sbjct: 27  TLESEGQVRSVSEGVDGKHEGIRLKKELEARHVSMIAIGGSLGTGLLIGTGSSLASAGPV 86

Query: 128 ALIIGYILVSFETYFMIQAAGEMAVTYPTLPANFNAYSSIFISKSFGFATVWLYCFQWLT 187
           +++I Y  V    Y ++   GEMA   P     F +Y+S ++  + GFA  + Y F++  
Sbjct: 87  SILISYSFVGLLVYTVMSCLGEMAAFIPL--DGFTSYASRYVDPAVGFAVGYSYLFKYFI 144

Query: 188 VLPLELITASMTIQF--GNDKINPDIYILIFYVFLVFIHFFGVKAYGETEFIFNCCKILM 245
           V P +L   +M +QF    D++NP ++I IF   +V I+  GV+ +GE EF  +  K+L+
Sbjct: 145 VTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKVLV 204

Query: 246 IAGFIILSIVINCGGAGNDGYIGATYWHNPGAF-----AGDTSIGRFKNVCYILVTAYFS 300
           + G I+L  +I  GG  N    G  +W +PGAF     A   S G+F +   +   A F+
Sbjct: 205 MLGLILLLFIIMLGGGPNHDRTGFRFWRDPGAFKPYSEAISGSKGKFVSFASVFALALFA 264

Query: 301 FGGMELFALSVQEQSNPRKSTPVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLMGAGGS 360
           + G EL  +   E  NPR+S P A K ++YRIVV Y++T++L+G  V YND +L+ A   
Sbjct: 265 YTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLKAKKM 324

Query: 361 ATHA--SPYVLAASIHGVKIVPHIINAVILISVVSVANSSLYAGPRLICSLAQQGYAPKF 418
           AT A  SP+V+A     + ++PHI N  +L+ V S  NS LY   R +  LA  G AP+ 
Sbjct: 325 ATSAAASPFVVAIENASIPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRI 384

Query: 419 LDYVDREGRPLRALIVCCVFGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLR 478
               ++ G P  +L +  +F ++A++  SS    VF +   +  +  L +W +I+++++R
Sbjct: 385 FATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIR 444

Query: 479 FRQAMKVQGRSLDELGYKATTGIWGSIYGVFFNILV-FVAQFWVALAPLGNGGKCDAESF 537
           F +A++VQ      L Y A    W +   +FF  L+  +  + V L     G K D ++F
Sbjct: 445 FDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLIGLIKNYTVFL-----GHKFDYKTF 499

Query: 538 FQNYLAFPIWLAFYFGYMVYNRDFTLLNPLDKIDLDFHRRIYDP--------ELMRQEDE 589
              Y+  P++L  Y GY V  R   L+ P D +DL   +   D         E  R E+ 
Sbjct: 500 ISGYIGIPVYLICYVGYKVVYRT-KLIKPED-VDLYTFKDAIDAEEEEYKLLEKERLENM 557

Query: 590 ENKEK 594
           EN  K
Sbjct: 558 ENSPK 562

>Scas_520.2*
          Length = 372

 Score =  267 bits (682), Expect = 7e-84,   Method: Compositional matrix adjust.
 Identities = 146/356 (41%), Positives = 211/356 (59%), Gaps = 13/356 (3%)

Query: 229 KAYGETEFIFNCCKILMIAGFIILSIVINCGGAGNDGYIGATYWHNPGAFAGDTSIGRFK 288
           K++GETEF+ +  +IL I GF IL IV+ CGG  +  +I   YW+ PG+F G  S  +FK
Sbjct: 3   KSFGETEFVLSMVRILAIIGFTILGIVLACGGGPHGSFIDGQYWNYPGSFVGHNSGTKFK 62

Query: 289 NVCYILVTAYFSFGGMELFALSVQEQSNPRKSTPVAAKRSIYRIVVIYLLTMILIGFNVP 348
            +C + V A FS+ G+E+ A+S  E  +PR + P AAKR           T +LIG  VP
Sbjct: 63  GLCSVFVIAAFSYSGIEMTAVSPVENKDPRITIPKAAKR-----------TFVLIGCFVP 111

Query: 349 YNDDQLMGAGGSATHAS-PYVLAASIHGVKIVPHIINAVILISVVSVANSSLYAGPRLIC 407
           Y++ +L+        AS P V+A    G K +  ++NA+ILIS++SVANS++Y   R + 
Sbjct: 112 YDNPRLLSRTSFVDAASSPLVIAIENGGNKGLLTLMNAIILISIISVANSAVYTCSRCMV 171

Query: 408 SLAQQGYAPKFLDYVDREGRPLRALIVCCVFGVIAFVAASSKEEIVFTWLAAIAGLSELF 467
           ++   G  P+ L+ VD +GRP+ A+I    FG+++FVAAS ++  VFTWL+A++GL  +F
Sbjct: 172 AMVHIGNVPRILNRVDTKGRPMNAIIFTLFFGLLSFVAASDRQADVFTWLSALSGLFTIF 231

Query: 468 TWTSIMLSHLRFRQAMKVQGRSLDELGYKATTGIWGSIYGVFFNILVFVAQFWVALAPLG 527
            W +I LSH+R RQAM  Q RSLDEL + + TG+WGS YG        VA FW +L PLG
Sbjct: 232 RWMAINLSHIRVRQAMAKQNRSLDELPFLSQTGVWGSWYGTIVLFSDLVASFWTSLFPLG 291

Query: 528 NGGKCDAESFFQNYLAFPIWLAFYFGYMVYNRDFTLLNPLDKIDLDFHRRIYDPEL 583
            G   DAE FF+ +      ++      +Y R    +  L  +DLD  RR  D ++
Sbjct: 292 -GTSADAELFFEVFFTVSHLISMLLCPNLYMRKREFMVGLTDMDLDTGRRQMDLDV 346

>Kwal_26.9612
          Length = 543

 Score =  261 bits (668), Expect = 7e-80,   Method: Compositional matrix adjust.
 Identities = 171/554 (30%), Positives = 275/554 (49%), Gaps = 38/554 (6%)

Query: 42  KQKSGSDKLIHRFADSFKRAEGSTTRTKQINENTSDLEDGVESITSDSKLKKSMKSRHVV 101
           +Q+   DKL  + A+     E     T  +NE               S +K+++K+RH+ 
Sbjct: 8   QQREDLDKLEPKIAE----VELQRLETDSLNE-----------FDPHSGVKRALKNRHIS 52

Query: 102 MMSLGTGIGTGLLVANAKGLHYGGPAALIIGYILVSFETYFMIQAAGEMAVTYPTLPANF 161
           +++LG  IG G L+     L+ GGP AL++G+ ++    + ++++ GE+   YP+    F
Sbjct: 53  LLALGGIIGPGCLIGAGNALNKGGPLALLLGFGIIGLVCFSIMESIGELVTLYPS-GGGF 111

Query: 162 NAYSSIFISKSFGFATVWLYCFQWLTVLPLELITASMTIQFGNDKINPDIYILIFYVFLV 221
              +  F S+     + + Y   +  VL  E  T S  +QF   ++    Y LIF+ F +
Sbjct: 112 ITLARRFHSEGLSAVSGYAYIVVFFAVLANEYNTISSILQFWGPQVPIYGYTLIFWFFFL 171

Query: 222 FIHFFGVKAYGETEFIFNCCKILMIAGFIILSIVINCGGAGNDGYIGATYWHNPGAFAGD 281
                GV A+GE E+     KIL +  F I SIV   GG      IG  YW NPGA +  
Sbjct: 172 VFQLIGVGAFGECEYWLAWFKILGLVAFYIFSIVYMSGGIPGKPPIGFQYWKNPGALSHG 231

Query: 282 TSIGRFKNVCYILVTAYFSFGGMELFALSVQEQSNPRKSTPVAAKRSIYRIVVIYLLTMI 341
                F+ +  + V     + G E  AL+  E  NPRK+ P+A +++ +RI+++YL    
Sbjct: 232 -----FRGIAVVFVFCSTFYSGTESVALAATESRNPRKAVPLAVRQTFWRILIVYLGISF 286

Query: 342 LIGFNVPYNDDQLMGAGGSATHASPYVLAASIHGVKIVPHIINAVILISVVSVANSSLYA 401
             G  VPYND  L     + +  SP  +A S  G     H++NA IL++ +S  NSSLY 
Sbjct: 287 FYGVTVPYNDPTL--GAQTKSLKSPISIALSRAGWAGGVHLVNAFILMTCISAINSSLYI 344

Query: 402 GPRLICSLAQQGYAPKFLDYVDREGRPLRALIVCCVFGVIAFVAASSKEEIVFTWLAAIA 461
           G R +  LA +G AP+ L + D+ G P+ ALIV    G+I+ +  S      + ++  ++
Sbjct: 345 GSRTLSHLAHEGLAPRILAWTDKRGVPVPALIVFNALGLISLMNVSVGASNAYNYIVNLS 404

Query: 462 GLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGYKATTGIWGSIYGVFFNILVFVAQFWV 521
           G+     W++I ++HLRFR+A   QGRSL EL Y+A    W +I+ +  NI + + Q W 
Sbjct: 405 GVGVFIVWSAISITHLRFRKAWVAQGRSLSELPYRALFYPWTTIFSLAANIFLALIQGWT 464

Query: 522 ALAPLGNGGKCDAESFFQNYLAFPIWLAFYFGYMVY-NRDFTLLNPLDKIDLDFHRRIYD 580
           +L P        A+ F   Y+  P     Y G   + NR+F  +N +  I+L+  +R   
Sbjct: 465 SLVPF------VAKDFVDAYILLPAAGLLYVGINFWKNRNFKTVN-IHGINLEEGQR--- 514

Query: 581 PELMRQEDEENKEK 594
               R  DE++ ++
Sbjct: 515 ----RDLDEDSDDE 524

>KLLA0F27093g 2501049..2502740 similar to sp|P43548 Saccharomyces
           cerevisiae YFL055w AGP3 amino acid permease, start by
           similarity
          Length = 563

 Score =  260 bits (664), Expect = 6e-79,   Method: Compositional matrix adjust.
 Identities = 164/507 (32%), Positives = 253/507 (49%), Gaps = 18/507 (3%)

Query: 73  ENTSDLEDGVESITSDSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALIIG 132
           E + + ED   +   DS +K+ +K RH+ +++LG  IG G L+     L  GGP AL++G
Sbjct: 41  EQSLNRED---TFDPDSGVKRQLKDRHISLLALGGIIGPGCLIGAGNALAIGGPLALLLG 97

Query: 133 YILVSFETYFMIQAAGEMAVTYPTLPANFNAYSSIFISKSFGFATVWLYCFQWLTVLPLE 192
           + ++    + M+++ GEM   YP+    F   +  F S +      + Y   +  VL  E
Sbjct: 98  FGIIGILAFIMMESIGEMITLYPS-GGGFTTLTRRFHSDALSAVCGYAYAVVFFAVLANE 156

Query: 193 LITASMTIQFGNDKINPDIYILIFYVFLVFIHFFGVKAYGETEFIFNCCKILMIAGFIIL 252
             T S  +QF   ++    YILIF+         GV A+GETE+     KIL +  + I 
Sbjct: 157 YNTLSSIMQFWGPQVPLYGYILIFWAAFQVFQLLGVGAFGETEYWLAWFKILGLLTYYIF 216

Query: 253 SIVINCGGAGNDGYIGATYWHNPGAFAGDTSIGRFKNVCYILVTAYFSFGGMELFALSVQ 312
           SIV   GG  N    G  YW++PGA +       FK +  + V     + G E  AL+  
Sbjct: 217 SIVYISGGVKNRPAFGFQYWNDPGALSNG-----FKGIANVFVFCSTFYSGTESVALAAT 271

Query: 313 EQSNPRKSTPVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLMGAGGSATHASPYVLAAS 372
           E  NPR++ P+A +++ +RI+++YL   I  G  VPYND+ L  A  +    SP  +A S
Sbjct: 272 ESKNPRRAVPIAIRQTFWRILIVYLGISIFYGVTVPYNDENLNFA--TKVLKSPIAIAIS 329

Query: 373 IHGVKIVPHIINAVILISVVSVANSSLYAGPRLICSLAQQGYAPKFLDYVDREGRPLRAL 432
             G     H++NA ILI+ +S  N SLY G R +  LA +G APK L + DR G P+ A+
Sbjct: 330 RAGWPAGVHLVNAFILITCISAINGSLYIGSRTLTHLANEGLAPKLLAWTDRRGVPIPAI 389

Query: 433 IVCCVFGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDE 492
            V    G+I+ +  S      + ++  ++G+     W  I L+HLRFR+A K+QG + DE
Sbjct: 390 TVFNALGLISLMNVSVTAVDAYNYIVNLSGVGVFIVWGIISLTHLRFRKAWKLQGHTRDE 449

Query: 493 LGYKATTGIWGSIYGVFFNILVFVAQFWVALAPLGNGGKCDAESFFQNYLAFPIWLAFYF 552
           L YKA       I  +  NI + + Q W    P       DA++F   Y+  P  +  Y 
Sbjct: 450 LPYKAKLFPVFPIVSIIANIFLGLVQGWSYFKPF------DAKNFVDAYILIPAGIILYL 503

Query: 553 GYMVY-NRDFTLLNPLDKIDLDFHRRI 578
           G   +  + F     L +++L F +R+
Sbjct: 504 GVSYWKTKGFLTAVDLSEVNLLFGQRL 530

>Scas_84.1
          Length = 213

 Score =  245 bits (626), Expect = 9e-78,   Method: Compositional matrix adjust.
 Identities = 116/206 (56%), Positives = 149/206 (72%)

Query: 245 MIAGFIILSIVINCGGAGNDGYIGATYWHNPGAFAGDTSIGRFKNVCYILVTAYFSFGGM 304
           M+ GF IL IV+ CGGAGNDGYIG   WHNPG+F GD  + RFK V   L  A F+FG  
Sbjct: 1   MLTGFFILGIVVICGGAGNDGYIGTKLWHNPGSFRGDKPVDRFKGVASTLANAAFAFGMT 60

Query: 305 ELFALSVQEQSNPRKSTPVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLMGAGGSATHA 364
           E   ++  EQSNPRK+ P AAK  +YRI+ IYL ++ ++G+ VPY+ DQL+G  G+AT A
Sbjct: 61  EFLGVTASEQSNPRKAIPSAAKNMLYRIICIYLGSVTIVGYLVPYDSDQLLGTSGAATKA 120

Query: 365 SPYVLAASIHGVKIVPHIINAVILISVVSVANSSLYAGPRLICSLAQQGYAPKFLDYVDR 424
           SPYVLA S+HGV++VPH I+AVIL+SVVSV NS+ Y+  R +  L+Q GYAP FL+YVDR
Sbjct: 121 SPYVLAISVHGVRVVPHFIHAVILMSVVSVGNSAFYSTSRQLLPLSQLGYAPSFLNYVDR 180

Query: 425 EGRPLRALIVCCVFGVIAFVAASSKE 450
            GRP++A  V  + GVIA+ A S +E
Sbjct: 181 NGRPMKAYCVSPLAGVIAYCATSPEE 206

>CAGL0E05632g complement(556619..558415) similar to sp|P15380
           Saccharomyces cerevisiae YOR348c PUT4 proline and
           gamma-aminobutyrate permease, hypothetical start
          Length = 598

 Score =  251 bits (640), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 163/503 (32%), Positives = 261/503 (51%), Gaps = 31/503 (6%)

Query: 90  KLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALIIGYILVSFETYFMIQAAGE 149
           +LK+ +KSRHV +++LG  IGTGL V  +  LH  GPA L I Y ++S   Y ++Q  GE
Sbjct: 74  ELKQGLKSRHVQLIALGGAIGTGLFVGTSSTLHTCGPAGLFISYCIISSVIYPIMQGIGE 133

Query: 150 MAVTYP---TLPANFNAY-SSIFISKSFGFATVWLYCFQWLTVLPLELITASMTIQFGND 205
           M    P   + P  F AY    ++ +S GFA  W Y + ++ ++  E   AS  +++   
Sbjct: 134 MVCYLPGSGSKPEGFAAYLVGKYVDESLGFADAWNYYYCYVILVAAECTAASGVVEYWTT 193

Query: 206 KINPDIYILIFYVFLVFIHFFGVKAYGETEFIFNCCKILMIAGFIILSIVINCGGAGNDG 265
            +    +I IF   +V ++F  VK YGE+EF F   KIL I G IILS ++  GG  N  
Sbjct: 194 SVPKAAWITIFLAAVVILNFTAVKFYGESEFWFASIKILCIVGLIILSFILFWGGGPNHD 253

Query: 266 YIGATYWHNPGAFAGDT---SIGRFKNVCYILVTAYFSF-GGMELFALSVQEQSNPRKST 321
            +G  YW NPG FA      S G F ++   ++   F+F  G E+ A++  E  + R++ 
Sbjct: 254 RLGFRYWQNPGGFAHHIRGGSFGSFLDIYTGIIKGGFAFILGPEMIAMTSSEVEDQRRNI 313

Query: 322 PVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLMGA---GGSATHASPYVLAASIHGVKI 378
             AA+R ++R++  Y+L  + I   V YND  L  A         +SP+V+     G+K+
Sbjct: 314 AKAARRFVWRLMFFYILGALSISVIVAYNDPALENALAQNKPGAGSSPFVIGIQNAGIKV 373

Query: 379 VPHIINAVILISVVSVANSSLYAGPRLICSLAQQGYAPKFLDYVDREGRPLRALIVCCVF 438
           +PHIINA IL S  S  N+ ++   R + ++AQ G AP+    V+R G P  A+ +    
Sbjct: 374 LPHIINACILSSAWSAGNAFMFTSSRSLLTMAQNGQAPRIFAKVNRWGVPYYAVGLSSAI 433

Query: 439 GVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGYKAT 498
             +A++  SS    VF W + I+ +S    W  + ++++RF +A+   G     L Y A 
Sbjct: 434 SCLAYLNCSSSTADVFNWFSNISVISGFIGWICVCIAYIRFHKAILFHGMQ-SRLPYTAR 492

Query: 499 TGIWGSIYGVFFNILVFVAQFWVALAPLGNGGKC------DAESFFQNYLAFPIWLAFYF 552
               G  Y +++ +LV      +++  L NG +       DA++F   Y+  P++   + 
Sbjct: 493 ----GMPYLIYWPLLV------ISIITLTNGYEVFIPRFWDAKNFVAAYITLPVFWVLWI 542

Query: 553 GYMVYNRD-FTL--LNPLDKIDL 572
           G+ VY R  FTL     +++ID+
Sbjct: 543 GHRVYRRKIFTLKWWKSIEEIDV 565

>Sklu_2438.14 YOR348C, Contig c2438 29357-31033
          Length = 558

 Score =  248 bits (634), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 166/517 (32%), Positives = 273/517 (52%), Gaps = 39/517 (7%)

Query: 76  SDLEDGVESITSD-SKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALIIGYI 134
           + LE  +E    D + L+K + SRH+ +++LG  IGTGL V  +  LH  GP  L + ++
Sbjct: 30  NQLESQLEGTKCDENNLEKGLSSRHIQLIALGGCIGTGLFVGTSSTLHNCGPLPLFLSFV 89

Query: 135 LVSFETYFMIQAAGEMAVTYP---TLPANFNAYSSIFISKSFGFATVWLYCFQWLTVLPL 191
           ++SF  Y ++    EM    P   T+P      +S ++  S GFA  W Y + +  ++  
Sbjct: 90  IISFIVYPVMNTLAEMICYLPQQGTVPE----LTSRYVDPSLGFAAGWNYAYSYSILVAT 145

Query: 192 ELITASMTIQFGNDKINPDIYILIFYVFLVFIHFFGVKAYGETEFIFNCCKILMIAGFII 251
           EL  A+  +Q+  DK++  ++I IF V +V ++F  VK YGE+EF F   KI+ I G +I
Sbjct: 146 ELSAAAGVVQYWTDKVHVAVWITIFLVIVVGLNFAPVKFYGESEFWFASLKIICILGLLI 205

Query: 252 LSIVINCGGAGNDGYIGATYWHNPGAFA-----GDTSIGRFKNVCYILVTAYFSF-GGME 305
           +SIVI  GGA +   +G  YW+NPG FA     G+T  GRF ++   ++ + F+F    E
Sbjct: 206 VSIVIFFGGAPSHDRLGFRYWNNPGPFAYHITGGNT--GRFLDIWTAIIKSGFAFILSPE 263

Query: 306 LFALSVQEQSNPRKSTPVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLMGAGGS---AT 362
           L  L+  E  + R++   A++R I+RI+  Y+ + + IGF +  +D +L+ A  S     
Sbjct: 264 LIGLACVEAKDTRRNIEKASRRFIWRIIFFYITSTLCIGFILSRDDPKLIQALTSDAPGA 323

Query: 363 HASPYVLAASIHGVKIVPHIINAVILISVVSVANSSLYAGPRLICSLAQQGYAPKFLDYV 422
            +SP+V   S  G+ ++ HIINAVIL S  S ANS +YA  R I +LA+QG APK    +
Sbjct: 324 ASSPFVQGISNAGIPVLNHIINAVILSSAWSSANSFMYASSRSILALAKQGDAPKVFTRI 383

Query: 423 DREGRPLRALIVCCVFGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQA 482
           +R G P  A+ +      + ++ ASS    VFTWL+ I  +S    W  I +++LRFR+A
Sbjct: 384 NRLGVPYNAVALSTAVSCLTYLNASSSSAQVFTWLSNICTISGFIGWALIGITYLRFRKA 443

Query: 483 M-------KVQGRSLDELGYKATTGIWGSIYGVFFNILVFVAQFWVALAPLGNGGKCDAE 535
           +       +V  +S  +  +     ++  +  +      F+ ++W            +A 
Sbjct: 444 IFYNNLYERVPFKSALQPYFTYFFVVFVVLLCLTNGYATFIPKYW------------NAS 491

Query: 536 SFFQNYLAFPIWLAFYFGYMVYNRDFTLLNPLDKIDL 572
            F   Y+  PI+   Y G+ ++ +    + P  +ID+
Sbjct: 492 DFVAAYITLPIFFLLYLGHKIWFKTRWYI-PFREIDV 527

>AFR156W [3348] [Homologous to ScYOR348C (PUT4) - NSH]
           complement(717645..719321) [1677 bp, 558 aa]
          Length = 558

 Score =  246 bits (627), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 164/527 (31%), Positives = 278/527 (52%), Gaps = 19/527 (3%)

Query: 57  SFKRAE--GSTTRTKQINENTSDLEDGVESITSD-SKLKKSMKSRHVVMMSLGTGIGTGL 113
           S ++A+  G   + K  +  TS  E   +S  S+ + L K ++SRH+ +++LG  IGTGL
Sbjct: 9   SIEKADNGGYMHKVKTPHSRTSLEELETQSAGSEYNTLHKGLQSRHIQLIALGGCIGTGL 68

Query: 114 LVANAKGLHYGGPAALIIGYILVSFETYFMIQAAGEMAVTYPTLPANFNAYSSIFISKSF 173
            V  +  LH  G A L++ +IL+S   Y ++ +  EM + Y     +     S ++  S 
Sbjct: 69  FVGTSWTLHNCGAAPLLLSFILISTIVYPIMCSLAEM-ICYLPQQGSVPELVSRYVDPSL 127

Query: 174 GFATVWLYCFQWLTVLPLELITASMTIQFGNDKINPDIYILIFYVFLVFIHFFGVKAYGE 233
           GFAT W Y + +  ++  EL  A+  + + ++ +    +I IF V +V ++F  VK YGE
Sbjct: 128 GFATGWNYAYAYAILVAAELSAAASVVSYWDNPVPMAAWITIFLVVVVGLNFTAVKYYGE 187

Query: 234 TEFIFNCCKILMIAGFIILSIVINCGGAGNDGYIGATYWHNPGAFA---GDTSIGRFKNV 290
            EF F   K++ I G +++S+VI  GGA N    G  YW NPG FA      S GRF +V
Sbjct: 188 AEFWFASIKLICILGLLVVSVVIFFGGAPNHDRTGFRYWKNPGPFAMSLAPGSTGRFLDV 247

Query: 291 CYILVTAYFSF-GGMELFALSVQEQSNPRKSTPVAAKRSIYRIVVIYLLTMILIGFNVPY 349
              ++ + F+F    EL  ++  E  + R++T  A++R IYRI+  Y+   ++IG  +  
Sbjct: 248 WRAVIKSAFAFILSPELIGIACVEAQDTRRNTEKASRRFIYRIIFFYVSCALMIGVILSR 307

Query: 350 NDDQLMGA---GGSATHASPYVLAASIHGVKIVPHIINAVILISVVSVANSSLYAGPRLI 406
            D +L+ A   G     +SP+V   +  G+ ++ H+IN  IL S  S  NS +YA  R++
Sbjct: 308 TDPKLIEALETGAPGAASSPFVQGIANAGIPVLDHVINVAILSSAWSAGNSFMYASTRMV 367

Query: 407 CSLAQQGYAPKFLDYVDREGRPLRALIVCCVFGVIAFVAASSKEEIVFTWLAAIAGLSEL 466
            +LA++G APKFL  ++R G P  A+IVC +   +A++   +    VF WL+ I  +S  
Sbjct: 368 LALAREGNAPKFLTKINRYGVPYNAVIVCTLVACLAYLNVKTTSANVFQWLSNICTISGF 427

Query: 467 FTWTSIMLSHLRFRQAMKVQGRSLDELGYKATTGIWGSIYGVFFNILVFVAQ-FWVALAP 525
             W ++ ++ +RFR+ + V       + Y+     + + Y  F  ++V +   F V L  
Sbjct: 428 IGWFAMGIAFIRFRRGI-VFNNLQSRIPYQGPLQPYIAYYFTFMTVVVCLTNGFHVFLK- 485

Query: 526 LGNGGKCDAESFFQNYLAFPIWLAFYFGYMVYNRDFTLLNPLDKIDL 572
               G+ +   F   Y+  PI+L  Y G+ ++ R    + P+++ID+
Sbjct: 486 ----GRWNVVDFVAAYVTLPIYLVLYLGHKLWFRTRWYI-PVEQIDV 527

>YFL055W (AGP3) [1629] chr6 (17004..18680) Amino acid permease for
           serine, aspartate and glutamate, member of the amino
           acid permease family of membrane transporters [1677 bp,
           558 aa]
          Length = 558

 Score =  244 bits (623), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 157/523 (30%), Positives = 257/523 (49%), Gaps = 16/523 (3%)

Query: 77  DLEDGVESITSDSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALIIGYILV 136
           D +  V      + +K+++K+RH+ +++LG  IG G LV     L+ GGP AL++G+ ++
Sbjct: 35  DEDPDVSRYDPQTGVKRALKNRHISLLALGGVIGPGCLVGAGNALNKGGPLALLLGFSII 94

Query: 137 SFETYFMIQAAGEMAVTYPTLPANFNAYSSIFISKSFGFATVWLYCFQWLTVLPLELITA 196
               + ++++ GEM   YP+    F   +  F S +      + Y   +  VL  E  T 
Sbjct: 95  GIIAFSVMESIGEMITLYPS-GGGFTTLARRFHSDALPAVCGYAYVVVFFAVLANEYNTL 153

Query: 197 SMTIQFGNDKINPDIYILIFYVFLVFIHFFGVKAYGETEFIFNCCKILMIAGFIILSIVI 256
           S  +QF   ++    YILIF+         GV  +GETE+     KI+ +  + I SIV 
Sbjct: 154 SSILQFWGPQVPLYGYILIFWFAFEIFQLVGVGLFGETEYWLAWLKIVGLVAYYIFSIVY 213

Query: 257 NCGGAGNDGYIGATYWHNPGAFAGDTSIGRFKNVCYILVTAYFSFGGMELFALSVQEQSN 316
             G   N    G  YW++PGA +       FK +  + V     + G E  AL+  E  N
Sbjct: 214 ISGDIRNRPAFGFHYWNSPGALSHG-----FKGIAIVFVFCSTFYSGTESVALAATESKN 268

Query: 317 PRKSTPVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLMGAGGSATHASPYVLAASIHGV 376
           P K+ P+A +++++RI+V+Y+   +  G  VP++D  L  +  +    SP  +A S  G 
Sbjct: 269 PGKAVPLAVRQTLWRILVVYIGIAVFYGATVPFDDPNL--SASTKVLKSPIAIAISRAGW 326

Query: 377 KIVPHIINAVILISVVSVANSSLYAGPRLICSLAQQGYAPKFLDYVDREGRPLRALIVCC 436
               H++NA ILI+ +S  N SLY G R +  LA +G APK L + DR G P+ A+ V  
Sbjct: 327 AGGAHLVNAFILITCISAINGSLYIGSRTLTHLAHEGLAPKILAWTDRRGVPIPAITVFN 386

Query: 437 VFGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGYK 496
             G+I+ +  S      ++++  ++G+     W  I  +HLR R+A   QGRS++EL Y+
Sbjct: 387 ALGLISLMNVSVGAANAYSYIVNLSGVGVFIVWGVISYTHLRIRKAWVAQGRSIEELPYE 446

Query: 497 ATTGIWGSIYGVFFNILVFVAQFWVALAPLGNGGKCDAESFFQNYLAFPIWLAFYFGYMV 556
           A    W  +  +  NI + + Q W    P       DA +F   Y+  P+ +  Y G  V
Sbjct: 447 ALFYPWTPVLSLAANIFLALIQGWSYFVPF------DAGNFVDAYILLPVGILLYIGICV 500

Query: 557 YNRDFTLLNPLDKIDLDFHRRI-YDPELMRQEDE-ENKEKLRN 597
           +  +      L  I+LD  RR   + +L  QE    + E +++
Sbjct: 501 FKSNHFRTVDLRSINLDEGRRKDMEADLSDQESSLASSETMKD 543

>ACL135W [914] [Homologous to ScYPL265W (DIP5) - NSH]
           complement(115359..117125) [1767 bp, 588 aa]
          Length = 588

 Score =  245 bits (625), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 168/581 (28%), Positives = 286/581 (49%), Gaps = 34/581 (5%)

Query: 27  AGNNFQSSSSEKTYSKQKSGSDKLIHRFADSFKRAEGSTTRTKQ-INENTSDLEDGVESI 85
           A   F  +S   T  + K G            +    ST +  Q ++ N     +G+   
Sbjct: 2   AEEKFAQASEASTLDELK-GPKLAAAGEGRGLRHTHSSTDQEAQSVDWNYDGKHEGI--- 57

Query: 86  TSDSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALIIGYILVSFETYFMIQ 145
               +LKK +++RHV M+++G  +GTGLL+     L   GP +++I Y ++ +  + ++ 
Sbjct: 58  ----RLKKDLQARHVSMIAIGGSLGTGLLIGTGSSLMRAGPGSILIAYSIMGWVVFTVMS 113

Query: 146 AAGEMAVTYPTLPANFNAYSSIFISKSFGFATVWLYCFQWLTVLPLELITASMTIQF--G 203
             GEMA   P     F +Y++ +   + GFA  W Y F++L + P +L   ++ IQF   
Sbjct: 114 CLGEMAAYIPL--DGFTSYATRYADPALGFAVGWAYLFKYLVLTPNQLTAGALVIQFWIP 171

Query: 204 NDKINPDIYILIFYVFLVFIHFFGVKAYGETEFIFNCCKILMIAGFIILSIVINCGGAGN 263
             +++P ++I +    +V I+  GV+ +GE EF  +  K+L++   +IL +V+  GG   
Sbjct: 172 AARVSPGVWITVVLAVIVVINTVGVRFFGEFEFWLSSFKVLVMLCVMILLLVLALGGGPT 231

Query: 264 DGYIGATYWHNPGAFA----GDTSI----GRFKNVCYILVTAYFSFGGMELFALSVQEQS 315
              +G  YW +PGAF      DT I    G+F     + V A F++ G EL  +   E  
Sbjct: 232 HDRLGFRYWSDPGAFKEYSKKDTHIKGGLGKFVAFLSVFVYALFAYLGTELCGIVAAECK 291

Query: 316 NPRKSTPVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLM--GAGGSATHASPYVLAASI 373
           +PR++ P A K ++YRIVV YL+T+ L+G  V YND  LM   +   +  ASPYV+A   
Sbjct: 292 DPRRNVPRAIKLTLYRIVVFYLVTIFLLGMCVAYNDPLLMQASSAEVSAAASPYVVAIEN 351

Query: 374 HGVKIVPHIINAVILISVVSVANSSLYAGPRLICSLAQQGYAPKFLDYVDREGRPLRALI 433
             + ++P++ NA +L  V S  NS LY G R +  LA  G APK     ++ G P  AL 
Sbjct: 352 AVIPVLPNLFNACVLTFVFSACNSDLYVGSRSLYGLAIDGKAPKLFARTNKWGVPYNALA 411

Query: 434 VCCVFGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDEL 493
            C +F  +A+++ S      F +   +  +  L +W SI+++++ F +A + QG     L
Sbjct: 412 CCTLFCCLAYMSVSKSARTAFGYFVNVTSIFGLMSWVSILITYICFDRAFRAQGIPKSTL 471

Query: 494 GYKATTGIWGSIYGVFFNILVFVAQFWVALAPLGNGGKCDAESFFQNYLAFPIWLAFYFG 553
            Y A    +     + F I V + + + A      G + D  +F   Y+  PI++  + G
Sbjct: 472 SYVAPCQPYAGWVALIFCIFVALIKNFDAFI----GKEVDVPTFITGYIGLPIYIFCFIG 527

Query: 554 YMVYN-------RDFTLLNPLDKIDLDFHRRIYDPELMRQE 587
           Y + +       ++  L    + IDL+    I +  LM+++
Sbjct: 528 YKIVHKTKWIPSKEVDLFTFKEAIDLEEEECIRERALMKEQ 568

>Kwal_26.6940
          Length = 570

 Score =  241 bits (616), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 165/538 (30%), Positives = 272/538 (50%), Gaps = 51/538 (9%)

Query: 67  RTKQINENTSDLEDGVESITSDSK------LKKSMKSRHVVMMSLGTGIGTGLLVANAKG 120
           +T Q+ E  ++    + +  S+S+      LK+ ++SRH+ +++LG  IGTGL V  +  
Sbjct: 19  QTGQVFELDTESLSALNTGGSESQKREPHTLKQGLQSRHIQLIALGGVIGTGLFVGTSST 78

Query: 121 LHYGGPAALIIGYILVSFETYFMIQAAGEMAVTYPTLPANFNAYSSIFISK----SFGFA 176
           L   GPA L+  YI++S   Y ++ A GEM    P    +     S  +S+    S GFA
Sbjct: 79  LSTCGPAGLLTSYIIISLVIYPVMNALGEMVCYLPGSGTDSGGSISKLVSRYADPSLGFA 138

Query: 177 TVWLYCFQWLTVLPLELITASMTIQFGNDKINPDIYILIFYVFLVFIHFFGVKAYGETEF 236
           T W Y + ++ ++  E   AS  + +    +    +I IF   +  ++F  VK YGE+EF
Sbjct: 139 TGWNYYYCYVILIAAECTAASGVVTYWTTVVPKAAWITIFLGVVTMLNFGPVKFYGESEF 198

Query: 237 IFNCCKILMIAGFIILSIVINCGGAGNDGYIGATYWHNPGAFA-----GDTSIGRFKNVC 291
            F   KIL I G + +S ++  GG  +   +G  YW  PGAFA     G+T  GRF +V 
Sbjct: 199 WFAILKILCIVGLLFVSFILFWGGGPSHDRLGFRYWQKPGAFAYHITTGNT--GRFLDVW 256

Query: 292 YILVTAYFSF-GGMELFALSVQEQSNPRKSTPVAAKRSIYRIVVIYLLTMILIGFNVPYN 350
             ++   F+F  G EL A++  E  + R++   A++R  YR++  Y+ + + IG  V  N
Sbjct: 257 TGVIKGGFAFILGPELVAVTSSEAMDQRRNIEKASRRFAYRLIFFYVASALAIGVIVAQN 316

Query: 351 DDQL---MGAGGSATHASPYVLAASIHGVKIVPHIINAVILISVVSVANSSLYAGPRLIC 407
           D  L   + +G +   +SP+V+A     +KI+PHIINA IL S  S  NS ++A  R + 
Sbjct: 317 DPVLRDALASGKAGAASSPFVIAIQNAHIKILPHIINACILSSAWSSGNSFMFAASRSLL 376

Query: 408 SLAQQGYAPKFLDYVDREGRPLRALIVCCVFGVIAFVAASSKEEIVFTWLAAIAGLSELF 467
           S+A+ G APK    ++R G P  A+ V   F  +A++  SS     FTW + I+ +S   
Sbjct: 377 SMAEDGVAPKMFKKINRAGVPYNAVAVSAAFSCLAYLNVSSGSAKAFTWFSNISTISGFI 436

Query: 468 TWTSIMLSHLRFRQAMKVQGRSLDELGYKATTGIWGSIYGVFFNILV------------F 515
            W  I +++LRFR+A+  +G   D + +K+        YG +F I+V            F
Sbjct: 437 GWICIGVAYLRFRKAIFFRGL-YDRVPFKSPF----QPYGTYFFIIVVSIICLTNGYATF 491

Query: 516 VAQFWVALAPLGNGGKCDAESFFQNYLAFPIWLAFYFGYMVYNRDF-TLLNPLDKIDL 572
           + +FW                F   Y+  P+++  + G+ +Y R   T + P+ ++D+
Sbjct: 492 IPRFW------------KGADFVAAYITLPVFVVLWVGHKIYTRTLSTWVIPVAEVDV 537

>Kwal_23.2817
          Length = 580

 Score =  241 bits (616), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 169/559 (30%), Positives = 285/559 (50%), Gaps = 37/559 (6%)

Query: 57  SFKRAEGSTTRTKQ--INENTSDLEDG----VESITSDSKLKKSMKSRHVVMMSLGTGIG 110
           S    + ST + K   I     D+E G    +++I   +++ + +KSRHV  ++LG  IG
Sbjct: 24  SLTSRDHSTNQKKDAIITAVEQDIERGSLSDIDTIKPSTEVSRGLKSRHVQFIALGGAIG 83

Query: 111 TGLLVANAKGLHYGGPAALIIGYILVSFETYFMIQAAGEMAVTYP-TLPANFNAYSSIFI 169
           TGL + +   L   GPA L+I Y ++SF  + ++    EM V  P +  ++  + +  ++
Sbjct: 84  TGLFIGSGTALSSCGPAPLLISYSVMSFFVWAIMNQMTEMVVLIPLSGESSMASLAGTYL 143

Query: 170 SKSFGFATVWLYCFQWLT-VLPLELITASMTIQFGNDKINPDIYILIFYVFLVFIHFFGV 228
           ++   F   W  CF  ++ V+P E+   ++ I++  D  N  I++ IF +    +    V
Sbjct: 144 NRPSSFMCGW-NCFYAMSMVVPTEITACALLIEYWTDA-NAAIFVTIFMILATLLSLLPV 201

Query: 229 KAYGETEFIFNCCKILMIAGFIILSIVINCGGA-GNDGYIGATYWHNPGAFAG---DTSI 284
           K +GE+EF  +  KIL I G I++ +VI  GG       +G  YW+ PGAF       S 
Sbjct: 202 KIFGESEFCVSIIKILTILGLILVGVVIFFGGGPAQHKVLGFHYWNTPGAFNSYLVKGST 261

Query: 285 GRFKNVCYILVTAYFSFGGM-ELFALSVQEQSNPRKSTPVAAKRSIYRIVVIYLLTMILI 343
           G F  V   ++ + F+F  + E+ +    E + PRK+ P A +R +YR+ V Y+L  ++I
Sbjct: 262 GAFLAVWKAIIKSGFAFVMIPEITSSCSAEAAFPRKNMPRACQRFVYRLAVFYVLGCLVI 321

Query: 344 GFNVPYNDDQL---MGAGGSATHASPYVLAASIHGVKIVPHIINAVILISVVSVANSSLY 400
           G  V Y++  L   + +G +   ASP+V+     G++I+PHIINA IL S  S + S LY
Sbjct: 322 GVIVGYDNKTLNEAISSGKANAAASPFVIGIQEAGIRILPHIINACILTSAYSCSTSELY 381

Query: 401 AGPRLICSLAQQGYAPKFLDYVDREGRPLRALIVCCVFGVIAFVAASSKEEIVFTWLAAI 460
              R++ SLA +G APKF   V++ G P  ++    +FGV+A++  S    +VF WL+ I
Sbjct: 382 GASRVLHSLALRGDAPKFFSKVNKYGVPYYSVAATSLFGVLAYLNCSKSSLVVFNWLSNI 441

Query: 461 AGLSELFTWTSIMLSHLRFRQA---MKVQGR-SLDELGYKATTGIWGSIYGVFFNILVFV 516
           A +S    W  + +++LRFR+    +K+  R      G +A    + S   +FF +L   
Sbjct: 442 ATISGFVNWVFVSITYLRFRKITDYLKINDRVPYRRRGQRALA--YAS--AIFFALLAIT 497

Query: 517 AQFWVALAPLGNGGKCDAESFFQNYLAFPIWLAFYFGYMVYNRDFTLLNPLDKIDLDFHR 576
             F+V +A     G  +   FF  Y+        + G  +Y +++T        D+D   
Sbjct: 498 NGFYVFIA-----GNWNVSDFFTCYVTIGFVGVLFIGSSIYYKEWTFR------DMDVVG 546

Query: 577 RIYDPELMRQEDEENKEKL 595
           R   P++ + + EE +E L
Sbjct: 547 REIMPKIDQADQEEKEEYL 565

>CAGL0M00154g 22039..23691 similar to sp|P32487 Saccharomyces
           cerevisiae YNL268w LYP1 or sp|P04817 Saccharomyces
           cerevisiae YEL063c CAN1, hypothetical start
          Length = 550

 Score =  238 bits (607), Expect = 9e-71,   Method: Compositional matrix adjust.
 Identities = 166/548 (30%), Positives = 273/548 (49%), Gaps = 31/548 (5%)

Query: 56  DSFKRAEGSTTRTKQINENTSDLEDGVESITSDSKLKKSMKSRHVVMMSLGTGIGTGLLV 115
           DS K+     + +  I+E  SD  D  ++I  D  L +++  RH+ M+S+   IGTGL +
Sbjct: 14  DSGKQEIYEVSSSLDIDELRSDF-DPEQNIRED--LTRALSPRHINMISIAGIIGTGLYL 70

Query: 116 ANAKGLHYGGPAALIIGYILVSFETYFMIQAAGEMAVTYPTLPANFNAYSSIFISKSFGF 175
           + AK LH GGPA+L + Y ++    Y  +   GEM+   P +  +F +Y+  F S+SF  
Sbjct: 71  STAKSLHNGGPASLFMNYTIIGGVVYLTMLCLGEMSTFMP-ISGSFCSYARKFGSESFAC 129

Query: 176 ATVWLYCFQWLTVLPLELITASMTIQFGNDKINPDIYI---LIFYVFLVFIHFFGVKAYG 232
           A +W Y F     +  +L    + + + +   +   Y    LIF+ F++F++   V+ YG
Sbjct: 130 ALMWNYWFNDAVSVASDLTALQLVLDYWHTADHHFPYWGASLIFWFFVLFLNVIHVRIYG 189

Query: 233 ETEFIFNCCKILMIAGFIILSIVINCGGAGNDGYIGATYW-HNPGAFAGDTSIGRFKNVC 291
           E E+     K++ I  F I+SI++N G      YIG   W H    F     +  FK   
Sbjct: 190 EAEYWLAMLKVIAIVIFFIMSIIVNVGKNPQHEYIGFKNWTHGEAPF-----VNGFKGFA 244

Query: 292 YILVTAYFSFGGMELFALSVQEQSNPRKSTPVAAKRSIYRIVVIYLLTMILIGFNVPYND 351
            + V+A F++GG E   L+  E SNP ++TP   K   +RI++ Y+L+   IG N+PY+ 
Sbjct: 245 SLFVSACFAYGGTESITLTGGEASNPVRNTPKIVKTVFWRILIFYVLSTFFIGMNIPYD- 303

Query: 352 DQLMGAGGSATHASPYVLAASIHGVKIVPHIINAVILISVVSVANSSLYAGPRLICSLAQ 411
               G    +   SP+ L   + G +     +NAVIL SV+S  N +L+AG R++ ++A 
Sbjct: 304 --YPGLSTKSVMTSPFTLVFQMAGTRGAGSFMNAVILTSVISACNHALFAGSRIMYNMAL 361

Query: 412 QGYAP-KFLDYVDREGRPLRALIVCCVFGVIAFVAASSKEEIVFTWLAAIAGLSELFTWT 470
            GY P K +   +R   P  A+++    G +   A+      ++TWL  I G+S    W 
Sbjct: 362 DGYLPKKIVGRTNRYKAPYVAVLITWAVGGLCLGASFIGAGTLWTWLQNIVGVSNQIAWL 421

Query: 471 SIMLSHLRFRQAMKVQGRSLDELGYKATTGIWGSIYGVFFNILVFVAQFWVALAPLGNGG 530
            I ++ +RFR+ ++VQG++ D L +K  T  +G  + V F + + + Q W A  P     
Sbjct: 422 CIGITSIRFRKGLEVQGKT-DLLQFKNWTYPFGPYFLVIFTVFIILIQGWQAFDP----- 475

Query: 531 KCDAESFFQNYLAFPIWLAFYFGYMVYNRDFTLLNPLDKIDLDFHRRIYDPELMRQEDEE 590
                 FF  YL   ++   Y  + ++ RD+     +   D+DF    Y P    +E  E
Sbjct: 476 -WSVTDFFSVYLELFVFPFVYIIWWLWKRDWF----VKYEDMDFVTDRYIPT---KEIVE 527

Query: 591 NKEKLRNM 598
             E+L N+
Sbjct: 528 LNERLDNL 535

>KLLA0B14685g complement(1289025..1290740) similar to sp|P15380
           Saccharomyces cerevisiae YOR348c PUT4 proline and
           gamma-aminobutyrate permease P23. 1.f18.1, start by
           similarity
          Length = 571

 Score =  232 bits (592), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 141/429 (32%), Positives = 228/429 (53%), Gaps = 16/429 (3%)

Query: 70  QINENTSDLEDG----VESITSDSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGG 125
            +N+   D + G    +E+     K+ + +K+RH+ +++LG+ IGTGL + +   L   G
Sbjct: 30  SVNDVIGDSDQGSYSDIENFKPPQKIVRGLKTRHIQLIALGSAIGTGLFIGSGGALSVCG 89

Query: 126 PAALIIGYILVSFETYFMIQAAGEMAVTYPTLPANFNAYS--SIFISKSFGFATVWLYCF 183
           PA L+I YI++SF  + ++    EM    P LP   + YS    +++    F   W   +
Sbjct: 90  PAPLLIAYIIISFFVWSIMNQMTEMVCLIP-LPGEASLYSLAKTYLNSPISFMCGWNLFY 148

Query: 184 QWLTVLPLELITASMTIQFGNDKINPDIYILIFYVFLVFIHFFGVKAYGETEFIFNCCKI 243
               ++P E+   ++ +Q+  D  N  I+I IF V  + +    VK +GE+EF  +  KI
Sbjct: 149 AMAMIVPAEITACALLVQYWTDA-NSAIFISIFIVVSILLTMLPVKVFGESEFWVSSIKI 207

Query: 244 LMIAGFIILSIVINCGGA-GNDGYIGATYWHNPGAF---AGDTSIGRFKNVCYILVTAYF 299
           L I G II+ IVI  GG    D  +G  YW NPGAF     + + GRF  V   ++ + F
Sbjct: 208 LTIVGLIIVGIVIFFGGGPAQDHVLGFHYWKNPGAFNPHLAEGNTGRFLAVWTAIIKSGF 267

Query: 300 SFGGM-ELFALSVQEQSNPRKSTPVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLMGA- 357
           SF  + E       E   PR++ P A +R IYR+ + Y++  +++G  V +N+D+L+ A 
Sbjct: 268 SFVLVPETVTSCSAECIAPRRNMPKACQRFIYRLAIFYIVGTLVVGVIVGFNNDRLINAI 327

Query: 358 --GGSATHASPYVLAASIHGVKIVPHIINAVILISVVSVANSSLYAGPRLICSLAQQGYA 415
             G S   ASP+V+     G+KI+PHIINA IL S  S     LY   R + S+A +G A
Sbjct: 328 QSGKSDAAASPFVIGIQEAGIKILPHIINACILTSAYSCGTGLLYGSSRTLYSMALRGDA 387

Query: 416 PKFLDYVDREGRPLRALIVCCVFGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLS 475
           PK    V+R G P  +  +  +F  +A++  S    +VF WL+ IA +S   +W  + ++
Sbjct: 388 PKIFAKVNRFGTPYYSTGLASLFSFLAYLNCSKSASVVFNWLSNIATISGFVSWIFVSMT 447

Query: 476 HLRFRQAMK 484
           ++RFR+ + 
Sbjct: 448 YIRFRKVIN 456

>KLLA0F23419g complement(2187386..2189107) similar to sp|P15380
           Saccharomyces cerevisiae YOR348c PUT4 proline and
           gamma-aminobutyrate permease, start by similarity
          Length = 573

 Score =  229 bits (583), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 160/526 (30%), Positives = 258/526 (49%), Gaps = 37/526 (7%)

Query: 86  TSDSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALIIGYILVSFETYFMIQ 145
           + D  LKK +KS H+ ++++G  IGTGL V  +  L+  GPA L I Y ++S   Y ++ 
Sbjct: 47  SGDHNLKKGLKSAHIQLIAIGGCIGTGLFVGTSSTLYKCGPAGLFISYCIMSTIIYPVMN 106

Query: 146 AAGEMAVTYPTLPANFNAYSSI------FISKSFGFATVWLYCFQWLTVLPLELITASMT 199
           A  EM    P LP       SI      ++  S GFA  W Y + ++ ++  E   AS  
Sbjct: 107 ALAEMVCFLPGLPDENETGGSISTLCTRYVDSSLGFAVGWNYVYCYVILVAAECTAASGV 166

Query: 200 IQFGNDKINPDIYILIFYVFLVFIHFFGVKAYGETEFIFNCCKILMIAGFIILSIVINCG 259
           + +    +    +I IF   +V ++   V+ YG +E IF   KI  I G II+SIV+  G
Sbjct: 167 VTYWTTAVPKAAWITIFLGIIVVLNCTAVEFYGTSEAIFCSLKIFCILGIIIVSIVLFFG 226

Query: 260 GAGNDGYIGATYWHNPGAFA---GDTSIGRFKNVCYILVTAYFSF-GGMELFALSVQEQS 315
           G  N   +G  +W +PGA+A    D   GR  ++   ++ A F+F  G EL  L+  E  
Sbjct: 227 GGPNHDRLGFRFWKDPGAWAYHLADGGAGRLSDIITGVIRAGFAFILGPELVVLTSTEAQ 286

Query: 316 NPRKSTPVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLMGA---GGSATHASPYVLAAS 372
           + R++   AA+R ++R++  Y ++ +  G  V  ND  L+ A   G     +SP+V+   
Sbjct: 287 DSRRNIEKAARRFVWRLIFFYCVSSLCAGVIVSRNDPVLLNALSQGKPGAGSSPFVIGIQ 346

Query: 373 IHGVKIVPHIINAVILISVVSVANSSLYAGPRLICSLAQQGYAPKFLDYVDREGRPLRAL 432
             G+K++PHIIN  IL S  S  NS +YA  R + SL+Q+GYAPK  + V+R G P   +
Sbjct: 347 NAGIKVLPHIINVCILSSAWSSGNSFMYATTRSLLSLSQEGYAPKIFNRVNRWGVPYTGV 406

Query: 433 IVCCVFGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDE 492
                F  +A++  SS    VF W + I+ +S    W    +++LRFR+A+       D 
Sbjct: 407 AFATAFSCLAYLNVSSSTADVFNWFSNISTISGFLGWICSGVAYLRFRKAVFFNNL-YDR 465

Query: 493 LGYKATTGIWGSIYGVFFNILVFVAQFWVALAPLGNGGKC----DAESFFQNYLAFPIWL 548
           L +K            F     +     +A+  L NG +     + + F   Y+  P++L
Sbjct: 466 LPFKTP----------FQPYFTWFYIILIAIICLINGYESFVHWNYKDFIAAYITLPLFL 515

Query: 549 AFYFGYMVYNRDFT-LLNPLDKIDLDFHRRIYDPELMRQEDEENKE 593
             + G+  Y R ++  +  + +ID+           +R+ +EE KE
Sbjct: 516 ILWLGHKAYTRTWSQWMISVSEIDVTTG--------LREIEEETKE 553

>Kwal_8.590
          Length = 629

 Score =  223 bits (568), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 158/593 (26%), Positives = 275/593 (46%), Gaps = 48/593 (8%)

Query: 3   SSEDFGSSGKKETSP---DSISIRSFSAGNNFQSSSSEKTYSKQKSGSDK---------- 49
           +  D GSS +    P   ++  I S +A  + Q   S+ +  K+ +  D           
Sbjct: 4   AHSDAGSSQRINHLPYHENAKIIISVAASFSVQVQKSQGSAIKESTQRDHPGLHKTRTTC 63

Query: 50  --LIHRFADSFKRAEGSTTRTKQINENTSDLEDGV---------ESITSDSKL-KKSMKS 97
             ++ + + S K+       T      T+ ++D V         +S++ + ++ ++ +  
Sbjct: 64  FTIVSQMSVSGKKEAFELNVTSLEEGETATIDDFVLQNRDSPKSQSLSLEERIARRKLLP 123

Query: 98  RHVVMMSLGTGIGTGLLVANAKGLHYGGPAALIIGYILVSFETYFMIQAAGEMAVTYPTL 157
           R V M+ +G  IGT L V+    +  GGP +L+I + L S   +  +     + VTY  +
Sbjct: 124 RQVSMIGIGGAIGTALFVSIGTKIIQGGPGSLLIAFCLWSV-VFIGLSKCMCVMVTYLPV 182

Query: 158 PANFNAYSSIFISKSFGFATVWLYCFQWLTVLPLELITASMTIQFGNDKINPDIYILIFY 217
             +F  ++  F+ +S GFA  W Y       +  E+    + +++  DKI     I +  
Sbjct: 183 TGSFVHFTERFVDQSCGFAVGWTYFVCQAANVCFEITAVCLVVEYWTDKIPKAALISMLI 242

Query: 218 VFLVFIHFFGVKAYGETEFIFNCCKILMIAGFIILSIVINCGGAGNDGYIGATYWHNPGA 277
           +    ++ + V  +GE EF  +  K+++  G II ++V+  GG      +G   W NPGA
Sbjct: 243 ILFGSLNLYSVFFFGEGEFYLSIGKVVLAIGLIIFTVVVMAGGNPQHTVLGFKNWSNPGA 302

Query: 278 FA---GDTSIGRFKNVCYILVTAYFSFGGMELFALSVQEQSNPRKSTPVAAKRSIYRIVV 334
           FA    D S+GRF      LV A + F G++    +  E  NPRK  P + ++   R+++
Sbjct: 303 FAEYISDGSVGRFHGFMSCLVFALYVFWGVDYLGNAASEAMNPRKVIPSSFRKVFGRLII 362

Query: 335 IYLLTMILIGFNVPYNDDQLMGA---GGSATHASPYVLAASIHGVKIVPHIINAVILISV 391
            Y+   I +G  +PYND  ++ A   G     ASPYV A    G++++PHI+N +IL S+
Sbjct: 363 FYIGGAICVGILIPYNDPNMIRAIKEGAVGAGASPYVSAMKTLGIRVLPHIVNILILTSI 422

Query: 392 VSVANSSLYAGPRLICSLAQQGYAPKFLDYVDREGRPLRALIVCCVFGVIAFVAASSKEE 451
           +S  NSSLY+  R++  LA    AP+      ++G P+   I   V   +A+++ S+   
Sbjct: 423 ISAGNSSLYSASRVLHRLALDNQAPRIFKVTTKKGVPVYCCIAVLVICGLAYLSVSNSTN 482

Query: 452 IVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGYKATTGIWGSIYGVFFN 511
            V TW   +   +    +  I +S+L+FR+    Q   L  L Y +++            
Sbjct: 483 NVLTWFLNVETAAMAIVYIFICVSYLQFRKGCLAQNVDLKSLPYYSSS----------LP 532

Query: 512 ILVFVAQFWVALAPLGNG------GKCDAESFFQNYLAFPIWLAFYFGYMVYN 558
            L + + FW+ L  L NG      G  D +SF  +Y   P +L F FG+ +Y 
Sbjct: 533 YLAWHSLFWLVLMLLVNGYTVFLKGSWDTQSFVFSYFMIPFFLVFLFGHKLYK 585

>Scas_552.3
          Length = 558

 Score =  217 bits (552), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 157/533 (29%), Positives = 264/533 (49%), Gaps = 27/533 (5%)

Query: 70  QINENTSDLEDGVESITSDSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAAL 129
           +++ + +  ED          L++++K RH+ M+S+   IGTGL ++ AK L+ GGPA+L
Sbjct: 33  ELDPSLTTEEDYDPEANIREDLQRALKPRHINMISIAGVIGTGLYLSTAKSLYQGGPASL 92

Query: 130 IIGYILVSFETYFMIQAAGEMAVTYPTLPANFNAYSSIFISKSFGFATVWLYCFQWLTVL 189
            + Y ++    Y  +   GEM+ TY  +  +F +Y+  F S+SF  A +W Y F     +
Sbjct: 93  FMNYTIMGGVVYLTLLCLGEMS-TYMPISGSFCSYAKKFGSESFACALMWNYWFNDAVSV 151

Query: 190 PLELITASMTIQFGNDKINPDIYI---LIFYVFLVFIHFFGVKAYGETEFIFNCCKILMI 246
             ++    + + + + + +   Y    L+F+  +V ++   V+ YGE E+     K++ I
Sbjct: 152 ASDMTALQLVMDYWDTEASGFPYWAASLLFWFLVVLLNVIHVRFYGEAEYWLAMLKVIAI 211

Query: 247 AGFIILSIVINCGGAGNDGYIGATYW-HNPGAFAGDTSIGRFKNVCYILVTAYFSFGGME 305
             F ILSIV+N G      YIG   W H    F     +  FK    + V+A F++GG E
Sbjct: 212 IIFFILSIVVNVGHNPQHEYIGFKNWNHGEAPF-----VDGFKGFASLFVSASFAYGGTE 266

Query: 306 LFALSVQEQSNPRKSTPVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLMGAGGSATHAS 365
              L+  E +NP ++TP   K   +RI+V Y+ +   I  N+PY+     G    +   S
Sbjct: 267 SITLTNGEAANPLRNTPKIVKTVFWRILVFYVGSTFFIAMNIPYD---YPGLDTKSVVTS 323

Query: 366 PYVLAASIHGVKIVPHIINAVILISVVSVANSSLYAGPRLICSLAQQGYAP-KFLDYVDR 424
           P+ L   + G K     +NAVI+ SV+S  N +L+AG R++ ++  +G+ P K +   +R
Sbjct: 324 PFTLVFQMAGTKAAGSFMNAVIMTSVISACNHALFAGSRVMYNMGLEGFLPKKIVSRTNR 383

Query: 425 EGRPLRALIVCCVFGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMK 484
              P  ++++    G++ F A+      V+TWL  I G+S    W  I ++ +RFR+ ++
Sbjct: 384 YKVPYVSVLITSSIGLLCFGASFIGAGTVWTWLQNIVGVSNQIAWLCIGITSIRFRKGLE 443

Query: 485 VQGRSLDELGYKATTGIWGSIYGVFFNILVFVAQFWVALAPLGNGGKCDAESFFQNYLAF 544
            QG++  EL YK  T  +G  + V F   + + Q W A  P       D  +FF  YL  
Sbjct: 444 KQGKT-HELRYKNWTYPYGPYFLVIFVTFIILVQGWSAFDPW------DVTNFFSYYLDL 496

Query: 545 PIWLAFYFGYMVYNRD-FTLLNPLDKIDLDFHRRIYDPELMRQEDEENKEKLR 596
            ++   +  + +Y RD F  L      D+DF    Y P     E  EN + L+
Sbjct: 497 FVFPFCFIIWWLYKRDRFVKLE-----DMDFVTDRYIPTKEIIELNENLDHLK 544

>Kwal_26.8097
          Length = 544

 Score =  194 bits (494), Expect = 9e-55,   Method: Compositional matrix adjust.
 Identities = 155/551 (28%), Positives = 265/551 (48%), Gaps = 32/551 (5%)

Query: 57  SFKRAEGSTTRTKQI-NENTSDLE---DGVESITSDSKLKKSMKSRHVVMMSLGTGIGTG 112
           S+ + + S+    ++   ++SD++   +G E+      L +S+  RH+ M+S+   IGTG
Sbjct: 2   SYNKNDSSSIHVLKVARTSSSDVQYDSEGQEADHVREHLNRSLTPRHINMISIAGVIGTG 61

Query: 113 LLVANAKGLHYGGPAALIIGYILVSFETYFMIQAAGEMAVTYPTLPANFNAYSSIFISKS 172
           L +   K L  GGPA+L+I Y ++    Y  +   GEM+   P +  +F +Y+  F S S
Sbjct: 62  LYLGTGKALAKGGPASLVINYSIIGLVVYLTMLCLGEMSTFMP-ISGSFCSYAKKFGSGS 120

Query: 173 FGFATVWLYCFQWLTVLPLELITASMTIQFGNDKINPDIYI---LIFYVFLVFIHFFGVK 229
             F  +  Y F     +  +L    + + F         Y    LIF+  L+ ++   V+
Sbjct: 121 LAFTLMCNYWFNDAVSVASDLTALQLILDFWKTSDAHFPYWAASLIFWFVLLLLNVVHVR 180

Query: 230 AYGETEFIFNCCKILMIAGFIILSIVINCGGAGNDGYIGATYWHNPGAFAGDTS-IGRFK 288
            YGE E+     K++ I  F I+SIV+N G   +  YIG   W       G+   +  FK
Sbjct: 181 VYGEAEYWLAMLKVIAIIIFFIISIVVNAGHNQDHSYIGFKNWS-----VGEAPFVNGFK 235

Query: 289 NVCYILVTAYFSFGGMELFALSVQEQSNPRKSTPVAAKRSIYRIVVIYLLTMILIGFNVP 348
               + V++ F++GG E   L+  E  NP ++TP   K   +RI++ Y+ T   IG NVP
Sbjct: 236 GFASLFVSSSFAYGGTESITLTAGEAKNPIRNTPKIIKTVFWRILIFYVFTTFFIGMNVP 295

Query: 349 YNDDQLMGAGGSATHASPYVLAASIHGVKIVPHIINAVILISVVSVANSSLYAGPRLICS 408
           YN  +L      +   SP+ +   + G K     +NAVIL SV+S  N +L+AG R++ +
Sbjct: 296 YNYPKL---SEKSVMTSPFTIVFQMVGTKAAASFMNAVILTSVISAGNHALFAGSRVLFN 352

Query: 409 LAQQGY-APKFLDYVDREGRPLRALIVCCVFGVIAFVAASSKEEIVFTWLAAIAGLSELF 467
           L  +GY  P  +   +R   P  A+++    G + F ++      ++TWL  I G+S   
Sbjct: 353 LGLEGYFFPSIITKTNRYQIPYVAVLITWAAGGLCFGSSFVGAGTLWTWLQNIVGVSNQI 412

Query: 468 TWTSIMLSHLRFRQAMKVQGRSLDELGYKATTGIWGSIYGVFFNILVFVAQFWVALAPLG 527
            W  I +  +RFR+ +  QG++  EL +   T  +G  + V F   + + Q W + AP  
Sbjct: 413 AWLCISIVSIRFRRGLAKQGKT-HELQFSNWTYPYGPYFLVLFVSFIILVQGWSSFAP-- 469

Query: 528 NGGKCDAESFFQNYLAFPIWLAFYFGYMVYNRDFTLLNPLDKIDLDFHRRIYDPELMRQE 587
                +   FF  Y+   +++A Y  + ++ RD  + +     D+DF   + D  +   E
Sbjct: 470 ----WNVTDFFSYYIELIVFVALYVFWWLWKRDAFVRSE----DMDF---VTDKYISPHE 518

Query: 588 DEENKEKLRNM 598
           +    E+L N+
Sbjct: 519 EVLLNEELDNL 529

>Kwal_23.4026
          Length = 534

 Score =  189 bits (479), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 131/486 (26%), Positives = 240/486 (49%), Gaps = 26/486 (5%)

Query: 57  SFKRAEGSTTRTKQINENTSDLE--------DGVESITSDSK-LKKSMKSRHVVMMSLGT 107
           S K A G   R   ++   SD +        D  E+I   S+ L++  K RHV M+++  
Sbjct: 3   SVKGATGFVKRVDTLDTGNSDTQQNGEVYELDFQEAIGESSQTLQRGFKQRHVDMLAIAG 62

Query: 108 GIGTGLLVANAKGLHYGGPAALIIGYILVSFETYFMIQAAGEMAVTYPTLPANFNAYSSI 167
            IGTGL++     L  GGP +L+I +I        ++ +  EMA ++  +  +F+ Y++ 
Sbjct: 63  AIGTGLVIGTGTALKRGGPGSLLIAFIFTGSLLIGVLMSLAEMA-SFAPMDKSFSGYATR 121

Query: 168 FISKSFGFATVWLYCFQWLTVLPLELITASMTIQFGNDKINPDIYILIFYVFLVFIHFFG 227
           ++  + GFAT W Y  ++   L  EL    + +Q+  + ++  I+I++F V L+ ++F  
Sbjct: 122 YVDPALGFATGWNYFLKYAIALASELSAIGLLVQYWREDLSIAIFIVVFLVVLLSLNFMN 181

Query: 228 VKAYGETEFIFNCCKILMIAGFIILSIVINCGGAGNDGYIGATYWHN----PGAFAGDTS 283
           +K YGE EF     K L++    +  +V+ CGG  +   IG  YW      P    G T 
Sbjct: 182 IKFYGEVEFWSALLKFLVLIICFVTGLVLTCGGGPSKETIGFRYWREYAFVPYLVKGTT- 240

Query: 284 IGRFKNVCYILVTAYFSFGGMELFALSVQEQSNPRKSTPVAAKRSIYRIVVIYLLTMILI 343
            GRF      ++ + +++ G E   +   E  NP+K+ P A +  I+RI   Y++ ++++
Sbjct: 241 -GRFLGWWACVIQSCYAYIGSETIGVVFGEAPNPKKTIPAATRNVIFRITGFYIVGVLIL 299

Query: 344 GFNVPYNDDQLMGAGGSATHASPYVLAASIHGVKIVPHIINAVILISVVSVANSSLYAGP 403
           G  +  +D  L  A  S    SP+V+A +  G+K +P  INA++++ + S AN++LY   
Sbjct: 300 GLIISPHDKTLANAKTSDASGSPFVIAFTNAGIKGLPSFINAMLIMFIASAANTALYVCS 359

Query: 404 RLICSLAQQGYAPKFLDYVDREGRPLRALIVCCVFGVIAFVAASSKEEIVFTWLAAIAGL 463
           R    LA+ G APK     +R G P    ++  +  +++F+  S+   ++F +L +   +
Sbjct: 360 RTAYGLAKDGMAPKIFLAQNRYGVPFNGCLLAGLISLLSFMNISNSSSVIFGYLTSSVTV 419

Query: 464 SELFTWTSIMLSHLRFRQAMKVQGRSLDELGYKATTGIWGSIYGVFFNILVFVAQFWVAL 523
                W S+++S++ + +A        D + ++    +W   Y        +V  F+V+L
Sbjct: 420 FGTLNWLSVLISYIGYERARVFHDVPRDRIPFR----MWFQPYS------AYVCLFFVSL 469

Query: 524 APLGNG 529
               NG
Sbjct: 470 IIFFNG 475

>Sklu_2365.9 YDR160W, Contig c2365 13522-15939
          Length = 805

 Score =  188 bits (477), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 156/570 (27%), Positives = 249/570 (43%), Gaps = 84/570 (14%)

Query: 91  LKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALIIGYILVSFETYFMIQAAGEM 150
           +++ +K RH+ M+SLG  IG GL + + K     GP    +GY+  +      + +  E+
Sbjct: 229 IQRKLKVRHLQMISLGATIGVGLFLNSGKAFSIAGPLGTFLGYLFGALTILATLLSFAEI 288

Query: 151 AVTYPTLPANFNAYSSIFISKSFGFATVWLYCFQWLTVLPLELITASMTIQF-------G 203
               P L    +   S FI  +FGF+  W +   +    P ELI  ++ + +        
Sbjct: 289 VALIP-LITGISGLCSRFIGDAFGFSVGWCHWASYAFGFPSELIATAIMLSYYTNLQSIS 347

Query: 204 NDKINPDIYILIFYVFLVFIHFFGVKAYGETEFIFNCCKILMIAGFIILSIVINCGGAGN 263
            ++ +    I+I    L  ++   V+ YGE E+  +  K++++A  IIL IV+NCGG  N
Sbjct: 348 TNQGSMASAIVIMIAALTVLNLMDVRVYGELEYFASTIKLIVVALLIILMIVVNCGGL-N 406

Query: 264 DGYIGATYWHNP---------GAF--------AGD---TSIGRFKNVCYILV----TAYF 299
           +GYIG  YW            GAF         GD     IG F  V    +     A F
Sbjct: 407 NGYIGFRYWDKNKSKSEHITFGAFRPTFDLKDTGDGARNGIGGFGGVLLSCIASTLVAVF 466

Query: 300 SFGGMELFALSVQEQSNPRKSTPVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLM---- 355
           S+ G E+  ++  E  NPRK+ P   KR   R+VV YLL++ ++G N    D +L+    
Sbjct: 467 SYVGSEIGFIAAGEAQNPRKAVPSVTKRIFTRVVVFYLLSIFVVGLNFYSGDPRLLRYYS 526

Query: 356 -------------------GAGG--------------SATHASPYVLAASIHGVKIVPHI 382
                                GG               +++ SP+V+A        +  I
Sbjct: 527 PEDNQMLIEKFEGYKDLIDSLGGLNCNTVLTEQNFVNESSNQSPWVIALKSFKQCTLSSI 586

Query: 383 INAVILISVVSVANSSLYAGPRLICSLAQQGYAPKFLDYVDREGRPLRALIVCCVFGVIA 442
           +N V +    S A+S LYA  R + S+A Q  AP    + +R G P  ++I C   G ++
Sbjct: 587 VNGVFVAIGFSAASSQLYASSRTLYSMATQQKAPSVFTWCNRHGVPYMSVIFCAFLGFLS 646

Query: 443 FVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMK----VQGRSLDELGYKAT 498
            +  + K   VF     I  +  +  W S+ LS LRF  A+K    +  R   E  YK+ 
Sbjct: 647 LLCLNMKSTDVFIMFINIGAMGSVIMWFSMNLSFLRFYYALKRRPDIISRDSKEYPYKSP 706

Query: 499 TGIWGSIYG-VFFNILVFVAQFWVALAPLGNGGKCDAESFFQNYLAFPIWLAFYFGYMVY 557
              + SI+G V   ILV    F        N    + ++F  +Y    +++  YFGY  +
Sbjct: 707 LQPYLSIFGMVSTAILVLFNGF-------QNFFYWNTKNFISSYCTVVLFVVLYFGYNWF 759

Query: 558 NRDFTLLNPLDKIDLDFHRRIYDPELMRQE 587
               + +N L+ IDLD  RR  D  + +++
Sbjct: 760 KH--SQINKLENIDLDSGRREMDSIIWKED 787

>Scas_460.3
          Length = 584

 Score =  182 bits (461), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 142/551 (25%), Positives = 250/551 (45%), Gaps = 39/551 (7%)

Query: 61  AEGSTTRTKQINENTSDLEDGVESITSDSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKG 120
           + G+T+ + Q N++ + L   V S T+    K+++ +RHV ++++   IGT + VA  K 
Sbjct: 50  SRGTTSVSSQDNDSKTFL---VASHTT----KRNLVNRHVQLIAISGVIGTAIFVAIGKP 102

Query: 121 LHYGGPAALIIGYILVSFETYFMIQAAGEMAVTYPTLPANFNAYSSIFISKSFGFATVWL 180
           L+ GGPA L++ + +       +  +  EM    P + + F   ++  +  S      W 
Sbjct: 103 LYRGGPAFLLLAFAIWCIPILCITVSTAEMVCFMP-VSSPFLRLATKCVDDSLAVMASWN 161

Query: 181 YCFQWLTVLPLELITASMTIQFGNDKINPDIYILIFYVFLVFIHFFGVKAYGETEFIFNC 240
           + F     +P E++T +  I +  D  +  I ++I  +  + I    VK YGE EF    
Sbjct: 162 FWFLECVQIPYEIVTVNTIIHYWRDDYSAAIPLVIQSLLYLLISLAAVKWYGEMEFWLAS 221

Query: 241 CKILMIAGFIILSIVINCGGAGNDGYIGATYWHN-------PGAFAGDTSIGRFKNVCYI 293
            KI++  G    + +   GG       G  Y+H+       P      +S G F+     
Sbjct: 222 FKIVLAMGLFCFTFITMLGGNPKKDRFGFRYFHDTPFKKYFPDGIDRGSSAGYFQGFFIC 281

Query: 294 LVTAYFSFGGMELFALSVQEQSNPRKSTPVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQ 353
           L+ A F+  G E  ++   E   PR+  P A K+   R+ +++L + + +G     ND  
Sbjct: 282 LIQASFTIAGGEYISMLAGEIEIPRRVLPRAFKQVFMRLTILFLGSCLCVGILCSPNDSS 341

Query: 354 LMGAGGSATH---ASPYVLAASIHGVKIVPHIINAVILISVVSVANSSLYAGPRLICSLA 410
           L  A   A     +SPYV+A +  G++I+P I+N  ++ +  S  N+  Y   R +  +A
Sbjct: 342 LTAAINEARPGAGSSPYVIAMNNLGIRILPDIVNITLITAAFSSGNAYTYCSSRTLYGMA 401

Query: 411 QQGYAPKFLDYVDREGRPLRALIVCCVFGVIAFVAASSKEEIVFTWLAAIAGLSELFTWT 470
             GYAPK     +++G P+ A+ V  ++  I+ +  +S   IV  WL  I   S+L  + 
Sbjct: 402 LDGYAPKIFTRCNKQGVPIYAVGVSLLWAFISLLQLNSNSAIVLNWLINIITASQLINFA 461

Query: 471 SIMLSHLRFRQAMKVQGRSLDELGYKATTGIWGSIYGVFFNILVFVAQFWVALAPLGNGG 530
            + +++L FR+A  +Q   L EL +K+    + +I+G+   +++ + Q +    P     
Sbjct: 462 ILCITYLFFRRAYLLQKDKLPELPFKSWWQPYTAIFGLVCAMVMMIVQGYTVFFP----K 517

Query: 531 KCDAESFFQNYLAFPIWLAFYFGYMVYNRDFTLLNPLDKIDLDFHRRIYDPELMRQEDE- 589
             + + F   YL   I +  Y  Y    R       L K       +I DP  +  EDE 
Sbjct: 518 NWNVQDFLFCYLMIFINIGIYIFYKFIWR-------LGK------DKIKDPATISFEDEL 564

Query: 590 ---ENKEKLRN 597
              EN E   N
Sbjct: 565 REIENHELEHN 575

>Scas_377.1
          Length = 148

 Score =  166 bits (419), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 73/137 (53%), Positives = 103/137 (75%), Gaps = 1/137 (0%)

Query: 461 AGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGYKATTGIWGSIYGVFFNILVFVAQFW 520
           +GLS+LFTW SI LSHLRFR+AM+VQGRS+ E+G+K+  GI+GS+Y     +L+ +AQFW
Sbjct: 1   SGLSQLFTWFSICLSHLRFRRAMRVQGRSMGEVGFKSQVGIYGSLYSCVMMVLILIAQFW 60

Query: 521 VALAPLGNGGKCDAESFFQNYLAFPIWLAFYFGYMVYNRDFTLLNPLDKIDLDFHRRIYD 580
            AL P+G  GK D ++FF+NYLA PI++  YFG+ ++ +D+ L    + IDL  HR I+D
Sbjct: 61  TALVPVGE-GKPDVQAFFENYLAMPIFIVLYFGFKIWKKDWRLFIRAEDIDLVSHREIFD 119

Query: 581 PELMRQEDEENKEKLRN 597
            EL++QEDEE + KLR+
Sbjct: 120 EELLKQEDEEYRRKLRD 136

>AAR038W [224] [Homologous to ScYBR132C (AGP2) - SH]
           complement(409071..410771) [1701 bp, 566 aa]
          Length = 566

 Score =  176 bits (447), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 137/516 (26%), Positives = 239/516 (46%), Gaps = 21/516 (4%)

Query: 72  NENTSDLEDGVESITSDSKLK---KSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAA 128
           +E++S++ D   S     K     + +++RHV ++ +   IGT L V+  K L+ GG  +
Sbjct: 31  SEHSSEVGDEASSAGFAGKYHSTYRKLENRHVQLIGISGVIGTALFVSIGKALYRGGSVS 90

Query: 129 LIIGYILVSFETYFMIQAAGEMAVTYPTLPANFNAYSSIFISKSFGFATVWLYCFQWLTV 188
           L++G+ L       +  +  EM V Y  L + F   +S  ++ S      W + F     
Sbjct: 91  LLLGFALWCVPILCITVSTAEM-VCYLPLNSPFLRLASRCVNDSLTVMAGWNFWFLECVQ 149

Query: 189 LPLELITASMTIQFGNDKINPDIYILIFYVFLVFIHFFGVKAYGETEFIFNCCKILMIAG 248
           +P E++  +  I +  D  +  I +++  +  + I  F V+ YGE EF     K+L+  G
Sbjct: 150 IPFEIVAVNSIIHYWRDDYSAAITLVVQVMLYLLISLFAVRYYGEIEFWLASFKVLLAVG 209

Query: 249 FIILSIVINCGGAGNDGYIGATY-------WHNPGAFAGDTSIGRFKNVCYILVTAYFSF 301
               + V   GG       G  Y        ++P      +S G F+     L+ A F+ 
Sbjct: 210 LFCFTFVTMVGGNPKRDRYGFRYIGEAPFKQYSPTMEPISSSAGYFQGFLACLIQASFTI 269

Query: 302 GGMELFALSVQEQSNPRKSTPVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQL---MGAG 358
            G +  ++   E   PRK  PVA K+   R+ V++L   + +G     ND  L   + A 
Sbjct: 270 AGPDYVSMIAGETKLPRKVLPVAFKQVFIRLTVLFLGGCLCVGIVCSANDPDLTAAINAS 329

Query: 359 GSATHASPYVLAASIHGVKIVPHIINAVILISVVSVANSSLYAGPRLICSLAQQGYAPKF 418
                +SPYV+A +  G+KI+P I+NA ++ +  S  N+  Y   R +  LA  GYAP  
Sbjct: 330 RPGAGSSPYVIAMNHLGIKILPDIVNAALVTAAFSAGNAYTYCSSRSLYGLALDGYAPAI 389

Query: 419 LDYVDREGRPLRALIVCCVFGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLR 478
               +R G P+ A+ V  ++ V++ +  +S   +V  WL ++   S+L  +  + + +L 
Sbjct: 390 FKRCNRFGVPIYAVSVSVMWSVLSLLQLNSNSAVVLNWLISLITASQLINFGVLCVVYLY 449

Query: 479 FRQAMKVQGRSLDELGYKATTGIWGSIYGVFFNILVFVAQ-FWVALAPLGNGGKCDAESF 537
           FR+A   Q  +L EL +K+    + +  G+   +L+ V Q + V  + L N      + F
Sbjct: 450 FRRAYLAQQDNLPELSFKSWWQPYTAYVGLTCVLLIVVVQGYTVFYSALWN-----VKDF 504

Query: 538 FQNYLAFPIWLAFYFGYM-VYNRDFTLLNPLDKIDL 572
              YL   I +A Y GY  ++ R    + P  ++DL
Sbjct: 505 LFCYLMVFIDIAIYLGYRYIWRRGKDAVIPPTEVDL 540

>YBR132C (AGP2) [319] chr2 complement(499608..501398) Plasma
           membrane carnitine transporter, required for the
           carnitine-dependent pathway for transport of acetyl-CoA
           from peroxisomes to mitochondria, member of the amino
           acid-polyamine-choline (APC) family of membrane
           transporters [1791 bp, 596 aa]
          Length = 596

 Score =  177 bits (449), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 144/575 (25%), Positives = 254/575 (44%), Gaps = 46/575 (8%)

Query: 55  ADSFKRAEGSTTRTKQINE----NTSDLEDGVESITSDSKL--------KKSMKSRHVVM 102
           ++ +    GS      I E    +  + ED   SI  DS+         ++ +++RHV +
Sbjct: 36  SEGWLEPSGSVGHINTIPEAGDVHVDEHEDRGSSIDDDSRTYLLYFTETRRKLENRHVQL 95

Query: 103 MSLGTGIGTGLLVANAKGLHYGGPAALIIGYILVSFETYFMIQAAGEMAVTYPTLPANFN 162
           +++   IGT L VA  K L+ GGPA+L++ + L       +  +  EM   +P + + F 
Sbjct: 96  IAISGVIGTALFVAIGKALYRGGPASLLLAFALWCVPILCITVSTAEMVCFFP-VSSPFL 154

Query: 163 AYSSIFISKSFGFATVWLYCFQWLTVLPLELITASMTIQFGNDKINPDIYILIFYVFLVF 222
             ++  +  S      W + F     +P E+++ +  I +  D  +  I + +  V  + 
Sbjct: 155 RLATKCVDDSLAVMASWNFWFLECVQIPFEIVSVNTIIHYWRDDYSAGIPLAVQVVLYLL 214

Query: 223 IHFFGVKAYGETEFIFNCCKILMIAGFIILSIVINCGG-AGNDGYIGATYWHNP------ 275
           I    VK YGE EF     KI++  G    + +   GG   +D Y    Y  +P      
Sbjct: 215 ISICAVKYYGEMEFWLASFKIILALGLFTFTFITMLGGNPEHDRYGFRNYGESPFKKYFP 274

Query: 276 -GAFAGDTSIGRFKNVCYILVTAYFSFGGMELFALSVQEQSNPRKSTPVAAKRSIYRIVV 334
            G   G +S G F+     L+ A F+  G E  ++   E   PRK  P A K+   R+  
Sbjct: 275 DGNDVGKSS-GYFQGFLACLIQASFTIAGGEYISMLAGEVKRPRKVLPKAFKQVFVRLTF 333

Query: 335 IYLLTMILIGFNVPYNDDQLMGAGGSA---THASPYVLAASIHGVKIVPHIINAVILISV 391
           ++L + + +G     ND  L  A   A     +SPYV+A +   ++I+P I+N  ++ + 
Sbjct: 334 LFLGSCLCVGIVCSPNDPDLTAAINEARPGAGSSPYVIAMNNLKIRILPDIVNIALITAA 393

Query: 392 VSVANSSLYAGPRLICSLAQQGYAPKFLDYVDREGRPLRALIVCCVFGVIAFVAASSKEE 451
            S  N+  Y   R    +A  GYAPK     +R G P+ ++ +  V+ +++ +  +S   
Sbjct: 394 FSAGNAYTYCSSRTFYGMALDGYAPKIFTRCNRHGVPIYSVAISLVWALVSLLQLNSNSA 453

Query: 452 IVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGYKATTGIWGSIYGVFFN 511
           +V  WL  +   S+L  +  + + +L FR+A  VQ  SL +L +++    WG  Y     
Sbjct: 454 VVLNWLINLITASQLINFVVLCIVYLFFRRAYHVQQDSLPKLPFRS----WGQPYTAIIG 509

Query: 512 I-----LVFVAQFWVALAPLGNGGKCDAESFFQNYLAFPIWLAFYFGY-MVYNR-DFTLL 564
           +     ++ +  + V    L N      + F  +YL   I +  Y GY  ++ R      
Sbjct: 510 LVSCSAMILIQGYTVFFPKLWN-----TQDFLFSYLMVFINIGIYVGYKFIWKRGKDHFK 564

Query: 565 NPLDKIDLDFHRRIYDPELMRQEDEENKEKLRNMS 599
           NP    ++DF + +   E+   E E + EK +  S
Sbjct: 565 NPH---EIDFSKEL--TEIENHEIESSFEKFQYYS 594

>KLLA0C15873g 1381699..1383405 similar to sp|P38090 Saccharomyces
           cerevisiae YBR132c AGP2 amino-acid permease, start by
           similarity
          Length = 568

 Score =  175 bits (444), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 131/506 (25%), Positives = 226/506 (44%), Gaps = 28/506 (5%)

Query: 88  DSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALIIGYILVSFETYFMIQAA 147
           ++   + +++RHV ++ +   IGT L V+  K L+ GGP +LI+G+ L       +  + 
Sbjct: 50  NNSTSRKLQNRHVQLIGISGVIGTALFVSIGKALYRGGPVSLILGFSLWCIPILCITVST 109

Query: 148 GEMAVTYPTLPANFNAYSSIFISKSFGFATVWLYCFQWLTVLPLELITASMTIQFGNDKI 207
            EM V Y  + + F   +    + S      W + F     +P E++  +  + +  D  
Sbjct: 110 AEM-VCYLPISSPFLRMAKRCCNDSLAVTAGWNFWFLECVQIPFEIVAVNTILHYWRDDF 168

Query: 208 NPDIYILIFYVFLVFIHFFGVKAYGETEFIFNCCKILMIAGFIILSIVINCGGAGNDGYI 267
           +P I + +  +  + I  F V+ YGETE      KIL+  G  + + +   GG       
Sbjct: 169 SPAIPLCVQVLLYIGISLFAVRCYGETEAFLASFKILLAIGLFLFTFITMLGGNPKHDRY 228

Query: 268 GATYWHN-------PGAFAGDTSIGRFKNVCYILVTAYFSFGGMELFALSVQEQSNPRKS 320
           G  Y  +       P    G +S+G F+     ++ A F+  G +  A+   E   PRK 
Sbjct: 229 GFRYITDTKFKQYFPNN-EGSSSMGYFQGFLACVIQASFTIAGPDYVAMIAGECKLPRKV 287

Query: 321 TPVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLMGAGGS---ATHASPYVLAASIHGVK 377
            PVA K+   R+ V++L   + +G     ND  L     +      +SPYV+A +  G+K
Sbjct: 288 LPVAFKQVFIRLTVLFLGGCLCVGIVCSSNDPNLTAVINNPRPGAGSSPYVIAMNNLGIK 347

Query: 378 IVPHIINAVILISVVSVANSSLYAGPRLICSLAQQGYAPKFLDYVDREGRPLRALIVCCV 437
           ++P ++NA ++ +  S  N+  Y   R +  L+  GYAPK   Y  + G P+ A++V   
Sbjct: 348 VLPDVVNAALVTAAFSAGNAYTYCSSRTLYGLSLDGYAPKLFQYCTKSGVPINAVLVSLA 407

Query: 438 FGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRS--LDELGY 495
           +  I+ +   S   +V  WL  +   S+L  ++ + + +L FR+A   Q  S  L EL +
Sbjct: 408 WAFISLLQLGSNSAVVLNWLINLITASQLINFSILCVIYLSFRRAYIKQHPSGELPELPF 467

Query: 496 KATTGIWGSIYGVFFNILVFVAQFWVALAPLGNGGKCDAESFFQNYLAFPIWLA-FYFGY 554
           K+    WG  Y  +  +        V    +   G  + +SF   YL   I L  F   +
Sbjct: 468 KS----WGQPYTAYCGLFAVTLMIGVQGYTVFLHGSWEVQSFLFCYLMVFIDLGIFLLCF 523

Query: 555 MVYNR---------DFTLLNPLDKID 571
            VY R         D  LL  +D+++
Sbjct: 524 FVYKRTRDPWVKPEDADLLTGMDEVE 549

>Kwal_23.3847
          Length = 579

 Score =  170 bits (431), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 115/449 (25%), Positives = 211/449 (46%), Gaps = 12/449 (2%)

Query: 80  DGVESITSDSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALIIGYILVSFE 139
           +G +S+ +D+  +K +  RHV+++ +   IGT L V+  K L++GG A L++G  +    
Sbjct: 53  EGKQSLDTDATHRK-LHERHVMLIGISGVIGTALFVSIGKALYHGGSAFLLLGMAVWCIP 111

Query: 140 TYFMIQAAGEMAVTYPTLPANFNAYSSIFISKSFGFATVWLYCFQWLTVLPLELITASMT 199
              +  +  EM V Y  L + F   ++  +  S   A  W + F     +P E++  +  
Sbjct: 112 MLCITVSTAEM-VCYLPLDSPFLRLTARCVDDSVAVAAGWNFWFLECVQIPFEIVAVNTI 170

Query: 200 IQFGNDKINPDIYILIFYVFLVFIHFFGVKAYGETEFIFNCCKILMIAGFIILSIVINCG 259
           I +  D  +  I +++  V    I  F V+ YGE EF     KI++  G    ++V   G
Sbjct: 171 IHYWRDDYSAAIPLVVQVVLYFGISVFAVRYYGEMEFWLASFKIILALGLFTFTLVAMLG 230

Query: 260 GAGNDGYIGATYWHN-------PGAFAGDTSIGRFKNVCYILVTAYFSFGGMELFALSVQ 312
           G  +    G   + +       P    G  S G F+     L+ A F+  G +  ++   
Sbjct: 231 GNPHKDRFGFRNFGDAPFKQYFPSGVVGTPSAGYFQGFLACLIQASFTIAGPDYVSMIAG 290

Query: 313 EQSNPRKSTPVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLMGAGGSA---THASPYVL 369
           E   PRK  PVA K    R+ V++L + + +G     ND  L  A   A     +SPYV+
Sbjct: 291 ETHLPRKVLPVAFKHVFNRLTVLFLGSSLCVGILCSANDPDLTAAINEARPGAGSSPYVI 350

Query: 370 AASIHGVKIVPHIINAVILISVVSVANSSLYAGPRLICSLAQQGYAPKFLDYVDREGRPL 429
           A    G++ +P ++NA ++ +  S  N+  +   R +  +A  G AP+     +R G P+
Sbjct: 351 AMKNLGIRALPDVVNAALITAAFSAGNAYTFCSSRTLHGMALDGNAPRIFRRCNRHGVPI 410

Query: 430 RALIVCCVFGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRS 489
            A+ V   + +++ +  +    +V  WL  +   S+L  +  + L++L FR+A   Q  +
Sbjct: 411 YAVAVSLTWALLSLLQLNKNSAVVLNWLINLITASQLINFACLCLTYLYFRRAYLSQQHN 470

Query: 490 LDELGYKATTGIWGSIYGVFFNILVFVAQ 518
           L  L +K+    + ++ G+F ++L+ + Q
Sbjct: 471 LPSLPFKSWGQPYTALLGLFASLLMALVQ 499

>CAGL0C00539g 57784..59502 highly similar to sp|P38090 Saccharomyces
           cerevisiae YBR132c AGP2 amino-acid permease,
           hypothetical start
          Length = 572

 Score =  170 bits (430), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 129/500 (25%), Positives = 225/500 (45%), Gaps = 18/500 (3%)

Query: 42  KQKSGSDKLIHRFADSFKRAEGSTTRTKQINENTSDLEDGVESITSDSKLKKSMKSRHVV 101
           K  +  + +  RF +S        TR+   +E+     D    +   +   + + +RHV 
Sbjct: 13  KNSAFEEGIEERFFES-----DDVTRSISFDEDERSSNDSRTQLIESTSTHRKLLNRHVQ 67

Query: 102 MMSLGTGIGTGLLVANAKGLHYGGPAALIIGYILVSFETYFMIQAAGEMAVTYPTLPANF 161
            +++   IGT L VA  K L+ GGPA L++ + L       +  +  EM V++  + + F
Sbjct: 68  FIAISGVIGTALFVAIGKPLYRGGPANLLLAFALWCIPILCITVSTAEM-VSFMPVSSPF 126

Query: 162 NAYSSIFISKSFGFATVWLYCFQWLTVLPLELITASMTIQFGNDKINPDIYILIFYVFLV 221
              +   + +S G    W + F     +P E+++ +  I +  D  +P I ++I  V  V
Sbjct: 127 LRLAKKCVDESLGVTASWNFWFLECVQIPYEIVSVNTIIHYWRDDYSPAIPLVIQVVLYV 186

Query: 222 FIHFFGVKAYGETEFIFNCCKILMIAGFIILSIVINCGG-AGNDGYIGATYWHNP----- 275
            I    VK YGE EF     KI++  G    + +   GG   +D Y    Y  +P     
Sbjct: 187 LISVCAVKYYGEMEFWLASFKIILAVGLFCFTFITMLGGNPKHDRYGFRYYGESPFKKYF 246

Query: 276 --GAFAGDTSIGRFKNVCYILVTAYFSFGGMELFALSVQEQSNPRKSTPVAAKRSIYRIV 333
             G      S G F+     L+ A F+  G E  ++   E   PRK  P A K+   R+ 
Sbjct: 247 PDGNEGAGKSAGYFQGFLTCLIQAAFTIAGGEYISMLAGEVKLPRKVLPKAFKQVFVRLT 306

Query: 334 VIYLLTMILIGFNVPYNDDQLMGAGGSATH---ASPYVLAASIHGVKIVPHIINAVILIS 390
           VI+L + + +G     ND  L  A   A     +SPYV+A +   ++++P I+N  ++ +
Sbjct: 307 VIFLGSCLCVGIVCSPNDSALTAAINEARPGAGSSPYVIAMNNLQIRVLPDIVNIALITA 366

Query: 391 VVSVANSSLYAGPRLICSLAQQGYAPKFLDYVDREGRPLRALIVCCVFGVIAFVAASSKE 450
             S  N+  Y   R +  +A  GYAPK     ++ G P+ A+ V   + +++ +  +S  
Sbjct: 367 AFSAGNAYTYCSSRTLYGMALDGYAPKIFTKCNKYGVPIYAVGVSLCWALLSLLQLNSNS 426

Query: 451 EIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGYKATTGIWGSIYGVFF 510
            +V  WL  +   S+L  +  + + +L FR+A   Q   L EL +K+    +  I G+  
Sbjct: 427 AVVLNWLINLITASQLINFVFLCVIYLFFRRAYMTQKERLPELPFKSWWQPYTVIVGLVS 486

Query: 511 NILVFVAQFWVALAP-LGNG 529
            +++ + Q +    P L NG
Sbjct: 487 VLIMILLQGYTVFFPKLWNG 506

>KLLA0D16830g 1426856..1429354 similar to sp|Q03770 Saccharomyces
           cerevisiae YDR160w SSY1 transcriptional regulator of
           several transporter genes, start by similarity
          Length = 832

 Score =  167 bits (422), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 143/586 (24%), Positives = 264/586 (45%), Gaps = 85/586 (14%)

Query: 87  SDSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALIIGYILVSFETYFMIQA 146
           S   +++ +++RH+ M++ G+ +G GL + + K     GP   ++GY+L          +
Sbjct: 253 SHHSVQRKLEARHIQMIASGSSLGVGLFLTSGKAFTIAGPFGALLGYVLCGSIVMASTLS 312

Query: 147 AGEMAVTYPTLPANFNAYSSIFISKSFGFATVWLYCFQWLTVLPLELITASM------TI 200
             E+    P L + F+  +S F+  +FGFA  WLY F ++  +P +++ ++M      ++
Sbjct: 313 FTELCALIP-LTSGFSGLASRFVEDAFGFALGWLYWFSFIIAVPSQVVASTMLLNYYQSL 371

Query: 201 QFGNDKINPDIYILIFYVFLVFIHFFGVKAYGETEFIFNCCKILMIAGFIILSIVINCGG 260
              + KI    ++ +F VF +FI+   V+ +G   +     KI+     I + IV+N GG
Sbjct: 372 NLSSGKIAG--FVTLFLVFAIFINLCDVRIFGNFVYFVTIIKIIFTIVMIFVMIVLNSGG 429

Query: 261 A--GNDGYIGATYWHN----PGAFAG-------------------DTSIGRFKNVCYILV 295
           A  G+D  +G  +W      PG F G                     + GR   +   ++
Sbjct: 430 AALGHD-RVGFRFWDAGKSAPGLFYGLFRPTFNLKDEGSEIISGISGAKGRLLAIFLSML 488

Query: 296 TAYFSFGGMELFALSVQEQSNPRKSTPVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQL- 354
            A F++ G+E+  ++  E  NP+K+ P A K+++Y +++IY +++ ++G N+   D +L 
Sbjct: 489 IAAFTYSGIEMTFVASCEVRNPKKALPSAMKKTLYIMLLIYTISIFVVGLNIYSGDPRLP 548

Query: 355 -----------------MGAGGS-ATHA----------------SPYVLAASIHGVKIVP 380
                            +G     +TH                 S +V+A    G     
Sbjct: 549 RFYTYSQDSSNYNIMHNIGMNWQVSTHCQSTLLSSGSLLSDGNRSAWVIALRSFGRCTFA 608

Query: 381 HIINAVILISVVSVANSSLYAGPRLICSLAQQGYAPKFLDYVDREGRPLRALIVCCVFGV 440
            ++N +++    +   SSLY     + S+A QG AP+        G P  A++V  +FGV
Sbjct: 609 SVLNGILIFYGATSGCSSLYGASHTLYSMAIQGKAPRICKACTSYGVPWIAVLVSGIFGV 668

Query: 441 IAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQ----GRSLDELGYK 496
           I+++A        F  LA I+  +    W  + +S LRF  A+K++     R      Y+
Sbjct: 669 ISYMAVDQSSLNNFQILANISSATICIIWAGMNVSFLRFFYALKIRPDIMSRDDPMFPYR 728

Query: 497 ATTGIWGSIYGVFFN-ILVFVAQFWVALAPLGNGGKCDAESFFQNYLAFPIWLAFYFGYM 555
           +    + S YG+F + +++F A F          G  + + FF  Y     ++  Y GY 
Sbjct: 729 SPFQPYLSYYGLFGSLVMIFFAGFTSFFH-----GFWNIKIFFSCYGGLVFFIVLYIGYK 783

Query: 556 VYNRDFTLLNPLDKIDLDFHRRIYDPELMRQEDEEN---KEKLRNM 598
           ++    + L  LD+ID+D  R   D  +  Q+ E     KE+L ++
Sbjct: 784 LFGT--SKLQRLDQIDMDIGRIELDRTIWNQQTEYQGNWKERLSSL 827

>Kwal_53.19461
          Length = 565

 Score =  157 bits (398), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 141/569 (24%), Positives = 253/569 (44%), Gaps = 81/569 (14%)

Query: 102 MMSLGTGIGTGLLVANAKGLHYGGPAALIIGYILVSFETYFMIQAAGEMAVTYPTLPANF 161
           M++ G  +G GL + + K L  GGP   ++G+ +        + +  E+A   P L +  
Sbjct: 1   MIATGAAMGVGLFLNSGKALSIGGPFGFLLGFSICGSIVLATMLSFTEIATLIP-LSSGI 59

Query: 162 NAYSSIFISKSFGFATVWLYCFQWLTVLPLELITASMTIQFGND---KINPDI-YILIFY 217
           +  +S F+  +FGFA  W Y   +   L  +++ ++  + +      +    + ++  F 
Sbjct: 60  SGLASRFVEDAFGFALGWSYWLTYAITLANQIVASNFMLSYYGTMPARTGSTVGFVTFFL 119

Query: 218 VFLVFIHFFGVKAYGETEFIFNCCKILMIAGFIILSIVINCG-GAGNDGYIGATYW---H 273
           VF +  +   V    E  + F   KI++ A  I   +++N G G      +G  +W    
Sbjct: 120 VFAIAGNLLDVNILAELAYGFTFFKIVITATMIFAMVILNAGAGRHKHPRVGFRFWDASK 179

Query: 274 NP-----GAF--------AGDTSI-------GRFKNVCYILVTAYFSFGGMELFALSVQE 313
           +P     G F         GD +        GRF +V  +++ + FSF G+E+  ++  E
Sbjct: 180 SPENLTYGLFRPTFDLQDVGDGAKNGIPGAKGRFLSVLVVIIVSSFSFSGVEVGFVACGE 239

Query: 314 QSNPRKSTPVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLMGAGGSATH---------- 363
            +NPR+S P A KR+I  ++++Y++++ +I  NV   D +L+    +AT           
Sbjct: 240 AANPRRSLPSATKRTIMTVIILYVVSIFVISLNVYSGDSRLLRYYTAATQEPTQSSVRAF 299

Query: 364 -------------------------ASPYVLAASIHGVKIVPHIINAVILISVVSVANSS 398
                                     SP+VLA    G+     + NA+++I  V+   SS
Sbjct: 300 NNNWQTDQVCTAHEIVSTTDFTNGSQSPWVLALESFGLCTFSSVFNAMLVIFGVTSELSS 359

Query: 399 LYAGPRLICSLAQQGYAPKFLDYVDREGRPLRALIVCCVFGVIAFVAASSKEEIVFTWLA 458
           LYA  R + S++ QG AP       R+G P  A+I   +FG +A++  ++K   +F  LA
Sbjct: 360 LYASSRTLYSMSIQGKAPPIFKICSRKGVPYVAVIFSGLFGALAYLTVNAKALEIFQALA 419

Query: 459 AIAGLSELFTWTSIMLSHLRFRQAMK----VQGRSLDELGYKATTGIWGSIYGVFFNILV 514
            I+G +    W    LS LRF  A+K    +  R      Y++    + + YG+F + L+
Sbjct: 420 NISGATISIIWFGFNLSFLRFYYALKRRPDIISREDPSFPYRSPLQPFLACYGLFGSFLI 479

Query: 515 FVAQFWVALAPLGN--GGKCDAESFFQNYLAFPIWLAFYFGYMVYNRDFTLLNPLDKIDL 572
                 V L    N   G  + + FF +Y    +++  Y GY +     + +  LD++DL
Sbjct: 480 ------VVLMGFSNFLDGFWNTKMFFSSYGGLIVFILCYAGYRLLGT--SKIQRLDQLDL 531

Query: 573 DFHRRIYDPELMRQEDEEN---KEKLRNM 598
           D  RR  D  +  +  E     +E++R +
Sbjct: 532 DSGRREMDRMIWTEHREYTNSVRERIRKL 560

>KLLA0B09922g complement(867748..870141) weakly similar to sp|Q03770
           Saccharomyces cerevisiae YDR160w SSY1 transcriptional
           regulator of several transporter genes P23.1.f18.1,
           hypothetical start
          Length = 797

 Score =  158 bits (399), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 150/616 (24%), Positives = 259/616 (42%), Gaps = 88/616 (14%)

Query: 48  DKLIHRFADSFKRAEGSTTRTKQINENTSDLEDGVESITSDSKLKKSMKSRHVVMMSLGT 107
           D +  +F D+        T +  I+E   D     +S   ++ L++ +K RH+ M+SLG 
Sbjct: 180 DFIDFKFEDNDIMKIQEVTVSDNIDEVPIDNHHRRKS-RHNTSLQRKLKIRHLQMISLGA 238

Query: 108 GIGTGLLVANAKGLHYGGPAALIIGYI---LVSFETYFMIQAAGEMAVTYPTLPANFNAY 164
            IG GL + + +     GP    IG++   LV   T F   +  EM    P L    +  
Sbjct: 239 TIGVGLFLNSGRAFSIAGPMGAFIGFLYGALVILATLF---SFAEMVAFIP-LITGISGL 294

Query: 165 SSIFISKSFGFATVWLYCFQWLTVLPLELITASMTIQF-------GNDKINPDIYILIFY 217
            S F+  SFGF   W +   +    P ELI +++ I +         D +   + + I  
Sbjct: 295 CSRFVGDSFGFTVGWCHWLSYAVAFPSELIASAIMISYYTPFEKVATDNLYLGLTVTILI 354

Query: 218 VFLVFIHFFGVKAYGETEFIFNCCKILMIAGFIILSIVINCGGAGNDGYIGATYWHNPGA 277
           + L  I+   V+ Y E E+I +  K+ ++   ++L +++NCGG  N GY+G  +W    +
Sbjct: 355 IVLTGINLLDVRIYAELEYIMSVFKLAVVLFLLVLVLILNCGGFRN-GYLGFKFWTKDRS 413

Query: 278 FAGDTSIGRFKNV-----------------------CYIL-VTAYFSFGGMELFALSVQE 313
            + D + G F+                         C    V++ FS+ G E+  ++  E
Sbjct: 414 PSPDVTFGPFRPTFDLNDYGSGSKQGIGGFGGVLLSCITCSVSSIFSYIGSEIGFIAAPE 473

Query: 314 QSNPRKSTPVAAKRSIYRIVVIYLLTMILIGFNVPYND---------------------- 351
             NPRK+ P   KR   R+V+ YLL++ ++G  +   D                      
Sbjct: 474 AENPRKAVPSVTKRIFVRVVLFYLLSIFMVGTVIYAGDPRLLRIISDNSKVTDQNLEKFM 533

Query: 352 ---DQLMGAGGS-----------ATHASPYVLAASIHGVKIVPHIINAVILISVVSVANS 397
              DQL G   +           +++ SP+V+A        + ++IN V +   +S A+S
Sbjct: 534 LIIDQLGGMNCNTRLQNDNIFQESSNQSPWVIAFKAVKQCDLANVINGVFVCIGISAASS 593

Query: 398 SLYAGPRLICSLAQQGYAPKFLDYVDREGRPLRALIVCCVFGVIAFVAASSKEEIVFTWL 457
            LYA  R + S+A Q  AP    +    G P  +++ C   G ++ +    +        
Sbjct: 594 QLYASSRTLYSMATQNKAPSVFTWCTNGGVPYVSILFCGSLGFLSLLCFDLRSTEALLLF 653

Query: 458 AAIAGLSELFTWTSIMLSHLRFRQAMK----VQGRSLDELGYKATTGIWGSIYGVFFNIL 513
            +I     +  W  + LS LRF  A+K    +  R+  E  YK+    +  I+G      
Sbjct: 654 ISIGITGSVVMWFGMNLSFLRFYMALKRRPDIIDRNSKEYPYKSPFQPYLCIFG------ 707

Query: 514 VFVAQFWVALAPLGNGGKCDAESFFQNYLAFPIWLAFYFGYMVYNRDFTLLNPLDKIDLD 573
           +    F + +  + N       +F  +YL   I++  Y GY V     + +N L++IDLD
Sbjct: 708 MASTTFLLLMNGIQNFFVWKTANFISSYLIIVIFIVLYSGYNVVRT--STINRLEQIDLD 765

Query: 574 FHRRIYDPELMRQEDE 589
             RR  D  L ++  +
Sbjct: 766 SGRREMDRVLWKENAD 781

>Kwal_27.11900
          Length = 726

 Score =  155 bits (392), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 138/582 (23%), Positives = 248/582 (42%), Gaps = 85/582 (14%)

Query: 11  GKKETSPDSISIRSFSAGNNFQSSSSEKTYSKQKSGSDKLIHRFADSFKRAEG-----ST 65
           G+++ +P +        G++ Q+S+        K   D +   F  +F   +      ST
Sbjct: 151 GRRKKNPATREELELGVGSH-QASNFTAVIDNTKPECDFIDGNFDKNFTVVQEELEPLST 209

Query: 66  TRTKQINENTSDLEDGVESITSDSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGG 125
                ++EN+       +S+   S +++ ++ RH+ M+SLG  IG GL + + K     G
Sbjct: 210 LTVDVLDENSPPSN---KSVPQQSTIQRKLRVRHLQMISLGATIGVGLFLNSGKAFSIAG 266

Query: 126 PAALIIGYILVSFETYFMIQAAGEMAVTYPTLPANFNAYSSIFISKSFGFATVWLYCFQW 185
           P   +IG+ +        + +  EM    P L    +   S F+  +FGF+  W +   +
Sbjct: 267 PMGALIGFTIGGTLILATLFSFAEMVALIP-LITGISGLCSRFVGDAFGFSVGWCHWLSY 325

Query: 186 LTVLPLELITASMTI-------QFGNDKINPDIYILIFYVFLVFIHFFGVKAYGETEFIF 238
               P E+I +++ +       Q   ++    + I    V L  I+   V+ YGE E+  
Sbjct: 326 AVGFPSEVIASTIMLSYYKNLEQIATNRYYTALTITGIVVGLTLINLMDVRIYGELEYCS 385

Query: 239 NCCKILMIAGFIILSIVINCGGAGNDGYIGATYWHNPGAFAGDTSIGRFKN--------- 289
           +  K+ ++   IIL IV+N GG  ND YIG  YW+   +   +T+ G F+          
Sbjct: 386 SVFKLAIVVFLIILMIVMNVGGLHND-YIGFRYWNRHKSPLEETTFGLFRPTFDMEDGGH 444

Query: 290 ----------------VCYILVTAYFSFGGMELFALSVQEQSNPRKSTPVAAKRSIYRIV 333
                           +   LV+  F++ G E+  ++  E  NPRK+ P   KR   R++
Sbjct: 445 GSRGGVPGFGGVLLSCIASTLVSV-FAYVGSEIGFIAAGEAKNPRKAVPSVTKRIFTRVI 503

Query: 334 VIYLLTMILIGFNVPYNDDQLM-----------------------GAGGSAT-------- 362
           + YLL++ ++G N+   D +L+                         GGS          
Sbjct: 504 MFYLLSIFVVGLNIYSGDPRLLRYDAGSNIAVTDNDETGVQAIINALGGSNCQQSRTENI 563

Query: 363 ------HASPYVLAASIHGVKIVPHIINAVILISVVSVANSSLYAGPRLICSLAQQGYAP 416
                 + SP+V+A        +  +IN V +   +S A+S LYA  R + S+A Q  AP
Sbjct: 564 FLVDNPNQSPWVIAMQSLNQCTLSSVINGVFVSIGISAASSQLYASSRTLYSMATQQKAP 623

Query: 417 KFLDYVDREGRPLRALIVCCVFGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSH 476
               +  + G P   ++ C + G ++ +  +     VF    +I  +  +  W  + LS+
Sbjct: 624 ALFTWCTKGGVPYMCVLFCGLLGFLSLLCLNMDSAEVFFIFVSIGAMGSVIVWFGMNLSY 683

Query: 477 LRFRQAMKVQ----GRSLDELGYKATTGIWGSIYGVFFNILV 514
           LRF  A+KV+     R+  E  Y++    + +IYG+   +L+
Sbjct: 684 LRFYYALKVRPDILSRNAKEFPYRSPCQPYLAIYGMVLAVLL 725

>CAGL0E01089g complement(96582..99143) similar to sp|Q03770
           Saccharomyces cerevisiae YDR160w SSY1 transcriptional
           regulator of several transporter genes, start by
           similarity
          Length = 853

 Score =  150 bits (378), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 160/668 (23%), Positives = 286/668 (42%), Gaps = 108/668 (16%)

Query: 18  DSISIRSF-----SAGNNFQSSSSEKTYSKQKSGSDKLIH-RFADSFKRAEGSTTRTKQI 71
           D++S R++     S GN     + +    K+    D  +H  F DS +  +G     ++I
Sbjct: 202 DNMSSRTYVIDNASDGNVAIDENIDYETMKRSVSIDGNVHSNFYDSDQEKKGKRYIHEKI 261

Query: 72  NENTSDLEDGVESITSDSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALII 131
           N+   D      S    ++L++++K RH+ M+++   +  G+ + + K     GP   ++
Sbjct: 262 NKYLHD------STRRRNQLQRNLKVRHIQMLAISACLSAGIFMTSGKAFSIAGPFGCLL 315

Query: 132 GYILVSFETYFMIQAAGEMAVTYPTLPANFNAYSSIFISKSFGFATVWLYCFQWLTVLPL 191
           G+I+        + +  E+A   P + + F+  +S F+  +FGFA  W Y F  +  LP 
Sbjct: 316 GFIITGTVVIATMMSFAELATLIP-VSSGFSGLASRFVEDAFGFALGWTYWFSSMVALPA 374

Query: 192 ELITASMTI-QFGNDKIN---PDIYILIFYVFLVFIHFFGVKAYGETEFIFNCCKILMIA 247
           ++++++     + + K+       ++ +F +F + ++ F V+  GE  +I    K+L+  
Sbjct: 375 QVVSSTFYFSHYDHLKLTRGGTAGFVTLFSLFPLVLNLFDVRFLGEFVYIVGLSKVLITI 434

Query: 248 GFIILSIVINCG-GAGNDGYIGATYWHNP----------GAF--------AGDTSI---- 284
             +I+ +V+N G G    G +   YW             G F        AG  SI    
Sbjct: 435 MIVIVMLVLNAGHGFDVHGRVSFRYWDAEKSRNLKDITYGLFRPTFDLSDAGLGSINGIG 494

Query: 285 ---GRFKNVCYILVTAYFSFGGMELFALSVQEQSNPRKSTPVAAKRSIYRIVVIYLLTMI 341
              GRF  V  +++ + F+F G+E+  ++  E  NPRK+ P A KR+   I  IY   + 
Sbjct: 495 GNRGRFIAVVSVMLVSTFAFSGVEMTFVASGEAKNPRKTIPSAMKRTFIFIFTIYFFLIF 554

Query: 342 LIGFNVPYNDDQLM----GAGGSATH--------------------------------AS 365
            +  N+   D +L+    GA  S  H                                +S
Sbjct: 555 SVSINIYTGDPRLLSYYTGALESRYHNIENKVSNEWQVSYRCEEVLHGVNPGDVQAGFSS 614

Query: 366 PYVLAASIHGVKIVPHIINAVILISVVSVANSSLYAGPRLICSLAQQGYAPKFLDYVDRE 425
           P+VLA    G        NAV++    S   SSLYA  R + +++ Q  AP      DR 
Sbjct: 615 PWVLALENFGFCSFAAGFNAVLIFFTSSATASSLYASSRTLYAMSIQRKAPAVFRLCDRR 674

Query: 426 GRPLRALIVCCVFGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKV 485
           G P  A+    +F ++A++A        F  L  I+  +    W  + ++ LRF  A+K 
Sbjct: 675 GVPYVAIGFSSLFAIVAYLAVDDAAISNFDVLMNISSAATSIIWLGLNVAFLRFYYALKK 734

Query: 486 QGR--SLDELGYKATT---------GIWG-SIYGVFFNILVFVAQFWVALAPLGNGGKCD 533
           +    S D++ Y   +         G+ G SI+ +F   + F+  +W            +
Sbjct: 735 RRDIISRDDVFYPYRSPFQPYLSMFGLLGCSIFVLFMGFINFIHGYW------------N 782

Query: 534 AESFFQNYLAFPIWLAFYFGYMVYNRDFTLLNPLDKIDLDFHRRIYDPEL---MRQEDEE 590
            +SFF +Y    ++   Y GY + +   + +  LD++DLD  RR  D  L    RQ    
Sbjct: 783 TKSFFSSYGGLILFGVCYLGYKLIST--SKIQRLDQLDLDTGRREIDRILWTEHRQYRGP 840

Query: 591 NKEKLRNM 598
             E+L+ +
Sbjct: 841 YSERLKKL 848

>Scas_619.2*
          Length = 471

 Score =  145 bits (367), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 130/470 (27%), Positives = 226/470 (48%), Gaps = 36/470 (7%)

Query: 144 IQAAGEMAVTYP---TLPANFNAY-SSIFISKSFGFATVWLYCFQWLTVLPLELITASMT 199
           + A GEM    P   +  A  +AY    ++ +S GFA+ W Y + ++ ++  E   A+  
Sbjct: 1   MNAFGEMVCYLPGNGSDSAGSSAYLVEKYVDRSLGFASSWNYYYCFVILVATECTAAAGV 60

Query: 200 IQFGND--KINPDIYILIFYVFLVFIHFFGVKAYGETEFIFNCCKILMIAGFIILSIVIN 257
           +++     K+    +I IF   +V ++   V  YGE+EF F   KIL I G IILS ++ 
Sbjct: 61  VEYWAWALKVPKGAWITIFLFCVVALNMLPVNFYGESEFWFASIKILCILGLIILSFILF 120

Query: 258 CGGAGNDGYIGATYWHNPGAFAG---DTSIGRFKNVCYILVTAYFSFG-GMELFALSVQE 313
            GG  +   +G  YW  PGAFA    D + G F +V   ++   F+F  G EL +L+  E
Sbjct: 121 WGGGPSHDRLGFRYWQRPGAFADHITDGTGGNFLDVYTGVIKGGFAFVLGPELVSLTSSE 180

Query: 314 QSNPRKSTPVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLMGA---GGSATHASPYVLA 370
             + R++   A++R ++R+++ Y+L  + I   V YND  L  A         +SP+V+ 
Sbjct: 181 CHDQRRNIAKASRRFVWRLMIFYVLGSLSISVIVAYNDPNLQNALAQSKPGAGSSPFVIG 240

Query: 371 ASIHGVKIVPHIINAVILISVVSVANSSLYAGPRLICSLAQQGYAPKFLDYVDREGRPLR 430
               G+K++PHIIN  I+ S  S  N+ ++A  R + ++A  G+APKF   ++R    +R
Sbjct: 241 IQNAGIKVLPHIINVCIMTSAWSAGNAYMFASSRSLLTMASHGHAPKFFSKINRLRCSIR 300

Query: 431 ALIVCCVFGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSL 490
              +  +  + + +     +   F  +   + +S    W    ++++RFR+A+ +     
Sbjct: 301 GSWLFLLILLFSLLKRLLIDSKRFQLVFKHSTISGFIGWICACVAYIRFRKAI-IFNDLY 359

Query: 491 DELGYKATTG---IWGSIYGVFFNIL-----VFVAQFWVALAPLGNGGKCDAESFFQNYL 542
           D L YK       IW S++ V    L     +F+ +FW            D + F   Y+
Sbjct: 360 DRLPYKGFAQKYLIWYSLFMVSLITLTNGYQIFIPRFW------------DYKDFIAAYI 407

Query: 543 AFPIWLAFYFGYMVYNRDFTLLN-PLDKIDLDFHRRIYDPELMRQEDEEN 591
             P+++  + G+ +  R +     P+DKID+ F       EL  + DE+ 
Sbjct: 408 TLPVFIVLWIGHKLVTRSWRQWYIPVDKIDV-FTGLEEIEELTNELDEKR 456

>YDR160W (SSY1) [1002] chr4 (776157..778715) Component of an
           extracellular amino acid sensor comprised of Ptr3p,
           Ssy1p, and Ssy5p, member of the amino
           acid-polyamine-choline (APC) family of membrane
           transporters [2559 bp, 852 aa]
          Length = 852

 Score =  147 bits (371), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 140/616 (22%), Positives = 263/616 (42%), Gaps = 103/616 (16%)

Query: 62  EGSTTRTKQINENTSDLEDGVESITSDSK------LKKSMKSRHVVMMSLGTGIGTGLLV 115
           E   + ++ + E  S L D +E + + S+      +++ +K RH+ M+S+G     GL +
Sbjct: 243 EQGASGSESVVEGGSLLHD-IEKVFNRSRATRKYHIQRKLKVRHIQMLSIGACFSVGLFL 301

Query: 116 ANAKGLHYGGPAALIIGYILVSFETYFMIQAAGEMAVTYPTLPANFNAYSSIFISKSFGF 175
            + K     GP   ++G+ L        + +  E++   P + + F+  +S F+  +FGF
Sbjct: 302 TSGKAFSIAGPFGTLLGFGLTGSIILATMLSFTELSTLIP-VSSGFSGLASRFVEDAFGF 360

Query: 176 ATVWLYCFQWLTVLPLELITASMTIQFGND-KINPDI---YILIFYVFLVFIHFFGVKAY 231
           A  W Y    +  LP ++ +++  + + N+  I+  +   +I +F  F + ++   V   
Sbjct: 361 ALGWTYWISCMLALPAQVSSSTFYLSYYNNVNISKGVTAGFITLFSAFSIVVNLLDVSIM 420

Query: 232 GETEFIFNCCKILMIAGFIILSIVINCGGAGNDGY--IGATYWHNPG------------- 276
           GE  ++    K++ IA  ++ +++I   G GND +  +G  YW +               
Sbjct: 421 GEIVYVAGISKVI-IAILMVFTMIILNAGHGNDIHEGVGFRYWDSSKSVRNLTYGLYRPT 479

Query: 277 ---AFAGDTSI-------GRFKNVCYILVTAYFSFGGMELFALSVQEQSNPRKSTPVAAK 326
              A AG+ S        GRF     +++ + F+F G+E+  L+  E  NPRK+ P A K
Sbjct: 480 FDLADAGEGSKKGISGPKGRFLATASVMLISTFAFSGVEMTFLASGEAINPRKTIPSATK 539

Query: 327 RSIYRIVVIYLLTMILIGFNVPYNDDQLMG---------------------------AGG 359
           R+   +++ Y+  +  +G N+   D +L+                             GG
Sbjct: 540 RTFSIVLISYVFLIFSVGINIYSGDPRLLSYFPGISEKRYEAIIKGTGMDWRLRTNCRGG 599

Query: 360 --------SATHASPYVLAASIHGVKIVPHIINAVILISVVSVANSSLYAGPRLICSLAQ 411
                      ++SP+V+A    G+       NA+++    +   SSL++  R + +++ 
Sbjct: 600 IDYRQISVGTGYSSPWVVALQNFGLCTFASAFNAILIFFTATAGISSLFSCSRTLYAMSV 659

Query: 412 QGYAPKFLDYVDREGRPLRALIVCCVFGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTS 471
           Q  AP   +   + G P  ++I   +F VIA++A        F  LA ++  S    W  
Sbjct: 660 QRKAPPVFEICSKRGVPYVSVIFSSLFSVIAYIAVDQTAIENFDVLANVSSASTSIIWMG 719

Query: 472 IMLSHLRFRQAMKVQ----GRSLDELGYKATTGIWGSIYG--------VFFNILVFVAQF 519
           + LS LRF  A+K +     R+     YK+    + +IYG        +F     F+  F
Sbjct: 720 LNLSFLRFYYALKQRKDIISRNDSSYPYKSPFQPYLAIYGLVGCSLFVIFMGYPNFIHHF 779

Query: 520 WVALAPLGNGGKCDAESFFQNYLAFPIWLAFYFGYMVYNRDFTLLNPLDKIDLDFHRRIY 579
           W              ++FF  Y     +   Y  Y V     + +  LD++D+D  RR  
Sbjct: 780 W------------STKAFFSAYGGLMFFFISYTAYKVLGT--SKIQRLDQLDMDSGRR-- 823

Query: 580 DPELMRQEDEENKEKL 595
             E+ R +  E+ + L
Sbjct: 824 --EMDRTDWTEHSQYL 837

>AGL171W [4141] [Homologous to ScYDR160W (SSY1) - SH]
           complement(377256..379811) [2556 bp, 851 aa]
          Length = 851

 Score =  145 bits (365), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 129/562 (22%), Positives = 241/562 (42%), Gaps = 87/562 (15%)

Query: 91  LKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALIIGYILVSFETYFMIQAAGEM 150
           +++ +K RH+ M+++G  IG GL + +       GP   ++G+ +        + +  E+
Sbjct: 279 IQRKLKVRHLQMIAIGASIGVGLFLTSGNAFAVAGPFGTLLGFSICGTVCLATMLSFTEL 338

Query: 151 AVTYPTLPANFNAYSSIFISKSFGFATVWLYCFQWLTVLPLELITASMTIQFGNDKINPD 210
           +   P + + F+  +S F+  +FGFA  W Y   +    P ++I +   + +    +   
Sbjct: 339 STLIP-ISSGFSGLASRFVEDAFGFALGWSYWLSFTVTFPSQIIASVFMLSYYEKVVATR 397

Query: 211 I----YILIFYVFLVFIHFFGVKAYGETEFIFNCCKILMIAGFIILSIVINCGGA-GNDG 265
           I     + +F+++    +   V+ + E  +I    K+L+    +IL + +N  G  G  G
Sbjct: 398 ISTAGLVTVFWLYATAANLLDVRLFAEVNYISAFVKVLITILAMILMLFLNVRGVDGKSG 457

Query: 266 YIGATYWHNP--------GAF--------AGDTSI-------GRFKNVCYILVTAYFSFG 302
            IG  +W++         G F         G  S+       GRF  +  +++ + +SF 
Sbjct: 458 AIGFRFWNSSSSETELTYGLFRPTFDLHDTGQGSLNGIGGARGRFLAIILVVLISTYSFN 517

Query: 303 GMELFALSVQEQSNPRKSTPVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLMGAGGSAT 362
           G+E+  ++  E  NPRK+ P A KR+  +IV +Y+L++  +G N+   D +L+  G    
Sbjct: 518 GVEMAFVASGEAINPRKTLPSATKRAFTKIVTLYILSITFVGLNMYSGDPRLLRYGVDVP 577

Query: 363 --------------------------------HASPYVLAASIHGVKIVPHIINAVILIS 390
                                           + SP++LA    G+  +    N V++  
Sbjct: 578 TVVYRNTPGLQWQRDYSCMEQDIMQLHNMENGNRSPWILALQSFGLCSLASAFNGVLVFF 637

Query: 391 VVSVANSSLYAGPRLICSLAQQGYAPKFLDYVDREGRPLRALIVCCVFGVIAFVAASSKE 450
            +S A+SSL+A  R + S+A Q  APK        G P  A++    FG+IA+++ +   
Sbjct: 638 GISAASSSLFASSRTLYSMATQQKAPKLFQTCTSYGVPWIAILFSGSFGIIAYISVAESS 697

Query: 451 EIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMK----VQGRSLDELGYKATTGIWGSIY 506
              F  L++IA  +    W  + +S LRF  A+K    +  R      Y++    + S Y
Sbjct: 698 MANFQTLSSIASGTNAIIWLGLNVSFLRFYYALKRRPDIISRDDPTYPYRSPMQPFLSFY 757

Query: 507 G--------VFFNILVFVAQFWVALAPLGNGGKCDAESFFQNYLAFPIWLAFYFGYMVYN 558
           G        +F     F+  FW               SF  +Y     ++  YF Y ++ 
Sbjct: 758 GLIGSGLVVIFMGFTNFLHGFW------------STRSFLSSYGGLIFFITSYFAYKLFG 805

Query: 559 RDFTLLNPLDKIDLDFHRRIYD 580
              + +  L+++D+D  RR  D
Sbjct: 806 A--SKIQSLEQLDMDTGRREMD 825

>Scas_682.30
          Length = 845

 Score =  143 bits (361), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 133/568 (23%), Positives = 243/568 (42%), Gaps = 77/568 (13%)

Query: 91  LKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALIIGYILVSFETYFMIQAAGEM 150
           +++ ++ RH+ M+S+GT    G  + + +     GP   ++G+ L        + +  E+
Sbjct: 269 VQRKLRVRHIQMLSIGTCFSVGFFLTSGRAFSIAGPFGTLLGFALAGSIVLATLLSFTEL 328

Query: 151 AVTYPTLPANFNAYSSIFISKSFGFATVWLYCFQWLTVLPLELITASMTIQFGNDKINPD 210
           +   P + + F+  +S F+  +FGF   W Y F  +   P E+ +++  + +    +N  
Sbjct: 329 STLIP-VSSGFSGLASRFVEDAFGFGLGWTYWFSCMIAFPSEVASSTFYLSY-YQHLNLT 386

Query: 211 I-----YILIFYVFLVFIHFFGVKAYGETEFIFNCCKILMIAGFIILSIVINCG-GAGND 264
                 ++ +F  + + I+   V+  GE  +I    KIL+    I + ++IN G G    
Sbjct: 387 RGAIAGFVTLFSSYSIIINLLDVRILGEATYIIGLSKILITIVIIFVMVIINAGHGYKIH 446

Query: 265 GYIGATYWHN-------------PGAFAGDT----------SIGRFKNVCYILVTAYFSF 301
             +G  +W +             P    GD           + GRF  V  +++ + F+F
Sbjct: 447 NQVGFRFWDSSKSVGDLTYGLFRPTFDLGDVGRGSTNGIPGATGRFLAVILVMLISTFAF 506

Query: 302 GGMELFALSVQEQSNPRKSTPVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLM------ 355
            G+E+  ++  E  NPRK+ P + KR+   ++ +Y+L +  +G N+   D +L+      
Sbjct: 507 SGVEMTFMASGEAINPRKTIPSSIKRTFSIVLTVYMLAIFAVGINIYSGDPRLLSYFAKY 566

Query: 356 ----------GAGG-----------------SATHA---SPYVLAASIHGVKIVPHIINA 385
                     G G                  S +HA   SP+VLA    G+      +N 
Sbjct: 567 SSERYTSTINGIGTDWQLSDRCKGVYTEREHSTSHAIYTSPWVLALQSFGLCTFASALNG 626

Query: 386 VILISVVSVANSSLYAGPRLICSLAQQGYAPKFLDYVDREGRPLRALIVCCVFGVIAFVA 445
           +++    +   SSLY   R I +++ Q  AP      ++ G P  A+I   VF +IA++A
Sbjct: 627 ILIFFTSTAGVSSLYNSSRTIYAMSVQRKAPLIFQRCNKRGVPYVAVIFSGVFYIIAYLA 686

Query: 446 ASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQ----GRSLDELGYKATTGI 501
            +      F  L  I+  S    W+ + +S +RF  A+K +     R+     YK+    
Sbjct: 687 VNVGSSRNFDVLVNISSASTSIIWSGLNISFIRFYFALKQRKDLISRNDKTYPYKSPFQP 746

Query: 502 WGSIYGVFFNILVFVAQFWVALAPLGNGGKCDAESFFQNYLAFPIWLAFYFGYMVYNRDF 561
           + S YG+ F  L+FV        P    G+    SFF  Y    ++   Y G+ +     
Sbjct: 747 YLSFYGL-FGCLIFVIFMGF---PNFIKGQWSTRSFFSAYGGLFLFAILYAGFKIIGT-- 800

Query: 562 TLLNPLDKIDLDFHRRIYDPELMRQEDE 589
           + +  LD+ID+D  RR  D  +  +  E
Sbjct: 801 SKIQRLDQIDMDTGRREMDRIVWTEHSE 828

>Scas_485.4*
          Length = 237

 Score =  122 bits (307), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 72/208 (34%), Positives = 112/208 (53%), Gaps = 6/208 (2%)

Query: 71  INENTSDLEDGVESITSDSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALI 130
           + E   ++   VE+ T    +++ +K RH+ M++LG  IGTGL +  +  L   GP   +
Sbjct: 1   MKEEIREISVEVEAET----VRRELKQRHMGMIALGGTIGTGLFIGVSTPLMNAGPVGAL 56

Query: 131 IGYILVSFETYFMIQAAGEMAVTYPTLPANFNAYSSIFISKSFGFATVWLYCFQWLTVLP 190
           I Y+ ++   Y + Q+ GEMA T+  + ++F  +S  F+S +FG A  ++Y F W     
Sbjct: 57  IAYLFMATLAYSVTQSLGEMA-TFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFA 115

Query: 191 LELITASMTIQFGNDKINPDIYILIFYVFLVFIHFFGVKAYGETEFIFNCCKILMIAGFI 250
           LEL      IQF    +    +I IF++ L  ++ F VK YGE EF     K++ I GF+
Sbjct: 116 LELSVVGQVIQFWTFAVPLAAWISIFWMLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFL 175

Query: 251 ILSIVINCGGAGNDGYIGATYWHNPGAF 278
           I    + C GAG  G +G  YW +PGAF
Sbjct: 176 IYCFCMVC-GAGVTGPVGFRYWRHPGAF 202

>Scas_476.4
          Length = 237

 Score =  122 bits (307), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 72/208 (34%), Positives = 112/208 (53%), Gaps = 6/208 (2%)

Query: 71  INENTSDLEDGVESITSDSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALI 130
           + E   ++   VE+ T    +++ +K RH+ M++LG  IGTGL +  +  L   GP   +
Sbjct: 1   MKEEIREISVEVEAET----VRRELKQRHMGMIALGGTIGTGLFIGVSTPLMNAGPVGAL 56

Query: 131 IGYILVSFETYFMIQAAGEMAVTYPTLPANFNAYSSIFISKSFGFATVWLYCFQWLTVLP 190
           I Y+ ++   Y + Q+ GEMA T+  + ++F  +S  F+S +FG A  ++Y F W     
Sbjct: 57  IAYLFMATLAYSVTQSLGEMA-TFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFA 115

Query: 191 LELITASMTIQFGNDKINPDIYILIFYVFLVFIHFFGVKAYGETEFIFNCCKILMIAGFI 250
           LEL      IQF    +    +I IF++ L  ++ F VK YGE EF     K++ I GF+
Sbjct: 116 LELSVVGQVIQFWTFAVPLAAWISIFWMLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFL 175

Query: 251 ILSIVINCGGAGNDGYIGATYWHNPGAF 278
           I    + C GAG  G +G  YW +PGAF
Sbjct: 176 IYCFCMVC-GAGVTGPVGFRYWRHPGAF 202

>Scas_642.22
          Length = 237

 Score =  121 bits (303), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 72/208 (34%), Positives = 111/208 (53%), Gaps = 6/208 (2%)

Query: 71  INENTSDLEDGVESITSDSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALI 130
           + E   ++   VE+ T    +++ +K RH+ M++LG  IGTGL +  +  L   GP   +
Sbjct: 1   MKEEIREISVEVEAET----VRRELKQRHMGMIALGGTIGTGLFIGVSTPLMNAGPVGAL 56

Query: 131 IGYILVSFETYFMIQAAGEMAVTYPTLPANFNAYSSIFISKSFGFATVWLYCFQWLTVLP 190
           I Y+ ++   Y + Q+ GEMA T+  + ++F  +S  F+S +FG A  ++Y F W     
Sbjct: 57  IAYLFMATLAYSVTQSLGEMA-TFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFA 115

Query: 191 LELITASMTIQFGNDKINPDIYILIFYVFLVFIHFFGVKAYGETEFIFNCCKILMIAGFI 250
           LEL      IQF    +    +I IF+V L  ++ F VK YGE EF     K++ I GF+
Sbjct: 116 LELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFL 175

Query: 251 ILSIVINCGGAGNDGYIGATYWHNPGAF 278
           I    + C GAG  G +   YW +PGAF
Sbjct: 176 IYCFCMVC-GAGVTGPMSFRYWRHPGAF 202

>Sklu_2147.4 YKL174C, Contig c2147 6541-8247 reverse complement
          Length = 568

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 69/316 (21%), Positives = 124/316 (39%), Gaps = 46/316 (14%)

Query: 71  INENTSDLEDG---VESITSDSKLKKSMKSRHVVMMSLGTGIGT---GLLVANAKGLHYG 124
           + EN  D  DG   VE    + KL KS+ SR  V+  LG G+ +   G+    + GL  G
Sbjct: 31  MQENDED--DGPEVVEQFQYEQKLDKSLLSRGSVI-GLGFGLMSPVLGMSTTMSIGLLNG 87

Query: 125 GPAALIIGYILVSFETYFMIQAAGEMAVTYPTLPANFNAYSSIFISKS----FGFATVWL 180
           GP  ++ G+++V F T+    + GE+   +P      +  S++  +K     F + T WL
Sbjct: 88  GPLTIVAGFMVVGFATWLCSLSLGEIVSKFPI---ELHGGSAMLAAKKHRLVFSWYTGWL 144

Query: 181 YCF-QWLTVLPLELITASMT---IQFGNDKINPD-----IYILIFYVFLVFIHFFGVKAY 231
                W     +    A +    I   ND + P        +++FY  +  +    +K  
Sbjct: 145 MLLGNWTMSTSITFAGAQLVISLISLANDSLVPKDSVIFYTVVVFYAIVTVVGVVNLKFA 204

Query: 232 GETEFIFNCCKILMIAGFI---ILSIVINCGGAGNDGYIGATYWHNPGAFAGDTSIGRFK 288
              E I   C   +I   I   IL ++ + G   +  Y  A +         D S+  ++
Sbjct: 205 RFIETINKVCVYWIIYAIIFTDILLLLFHTGEYRSLKYALAHF---------DNSLSGYR 255

Query: 289 NVCYILVTAY----FSFGGMELFALSVQEQSNPRKSTPVAAKRSIYR-----IVVIYLLT 339
           +     +  +    F+  G  +      E   P +  P     S+       +V +  + 
Sbjct: 256 SAALSFMIGFQQSNFTLQGFSMLPALADEVKEPERDIPRGMSLSVVLSALSGLVFLLPIM 315

Query: 340 MILIGFNVPYNDDQLM 355
           +IL   +   N+D++M
Sbjct: 316 LILPDTSAILNNDRVM 331

>Scas_622.10
          Length = 562

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 50/209 (23%), Positives = 90/209 (43%), Gaps = 17/209 (8%)

Query: 260 GAGNDGYIGATYWHNPGAFAGDTSIGRFKNVCYILVTAYFSFGGMELFALSVQEQSNPRK 319
           G G DG I    W+ P     D ++    ++   L++++F F G +       E  NP +
Sbjct: 248 GNGPDGVIEPVAWNAPLTHFQDQTVLSLSSIASALISSFFCFSGWDSVHAVASEIKNPTR 307

Query: 320 STPVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLMGAGGSATHASPY---VLAASIHGV 376
           +  +A   S+   +V Y++  +     + Y + +          A P    VL + I G 
Sbjct: 308 TLKIAGPFSLIICLVCYVMMNMAYLKILTYEEIK---------QAGPLIGSVLFSKIFGA 358

Query: 377 KIVPHIINAVILISVVSVANSSLYAGPRLICSLAQQGYAPKFLDYVDR---EGRPLRALI 433
           KI   +++  I +S VS     +Y   R+   + ++GY P F D + R      PL A++
Sbjct: 359 KIGSKLVSMSIALSAVSNIMVVVYGTSRMNQEIFREGYFP-FSDKLVRNWPHDAPLPAIL 417

Query: 434 VCCVFGVIAFVAASSKEEIVFTWLAAIAG 462
           VC +   I ++     E   F +L ++ G
Sbjct: 418 VCGLL-TITWIIILPGEGSSFDYLISMEG 445

>Kwal_33.13806
          Length = 549

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 55/300 (18%), Positives = 124/300 (41%), Gaps = 37/300 (12%)

Query: 47  SDKLIHRFADSFKRAEGST-TRTKQINENTSDLEDGVESITSDSKLKKSMKSRHVV---- 101
           S ++   F D F+R   S       I ++  D ++ V++   + +L +S  S+  +    
Sbjct: 4   SVRVPQSFRDGFQRLPQSVWANWDSILQDGDDEQEEVQAFKYEQQLDRSFLSKGSIIGLG 63

Query: 102 --MMSLGTGIGTGLLVANAKGLHYGGPAALIIGYILVSFETYFMIQAAGEMAVTYPTLPA 159
             +MS   G+ T + +    GL  GGP  +++G+++    T+    + GE+   +P    
Sbjct: 64  FALMSPVLGMSTTMNI----GLLNGGPMTILLGFLINGLATWLCSLSLGEIVSRFPI--- 116

Query: 160 NFNAYSSIFISKSFGFATVWLYCFQWLTVLPLELITASMT----------IQFGNDKINP 209
             +  S++    ++  +  W     WL +L    ++ S+T          +   ND++  
Sbjct: 117 ELHGGSAMLAPYNYQLSCSWFT--GWLMLLGNWTMSTSITFAGAQLVISLVTMANDQLIG 174

Query: 210 DIYILI-----FYVFLVFIHFFGVKAYGETEFIFNCCKILMIAGFIILSIVINCGGAGND 264
           + YI++     FY+ +  +    ++     E +   C   +I   I + I++    +G+ 
Sbjct: 175 EKYIVLFTVLAFYIIVTIVGLINLRFASFIEAVNKVCVYWIIYAVIFIDILLLLFHSGSY 234

Query: 265 GYIGATYWHNPGAFAGDTSIGRFKNVCYIL--VTAYFSFGGMELFALSVQEQSNPRKSTP 322
             +    +H   +F+G +S    K + +++    + F+  G  +      E   P +  P
Sbjct: 235 RSLKYALFHFDNSFSGYSS----KALSFMIGFQQSSFTLQGFSMLPALADEVKRPERDIP 290

>Scas_233.1
          Length = 141

 Score = 40.0 bits (92), Expect = 0.001,   Method: Composition-based stats.
 Identities = 26/90 (28%), Positives = 46/90 (51%), Gaps = 10/90 (11%)

Query: 30  NFQSSS----SEKTYSKQKSGSDKLIHRFADSFKRAEGSTTRTKQINENTSDLEDGVESI 85
           N QSS     S  +++     S     +F DSFK+AE       +++ N ++ E  +   
Sbjct: 58  NIQSSITHTISNPSFTSTTQPSTTRWQKFKDSFKKAEDV-----ELDPNLTEAER-IAQA 111

Query: 86  TSDSKLKKSMKSRHVVMMSLGTGIGTGLLV 115
           T+ + L+ ++K R   M+++G  IG+GL V
Sbjct: 112 TAKAPLQHTLKGRQQTMIAIGGAIGSGLFV 141

>Scas_689.19
          Length = 612

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 60/273 (21%), Positives = 108/273 (39%), Gaps = 34/273 (12%)

Query: 72  NENTSDLEDGVESITSDSKLKKSMKSRHVVMMSLGTGIGT---GLLVANAKGLHYGGPAA 128
            E+ +D  + VE    + +L KS+ SR  V+  LG G+ +   G+  + A GL  GGPA 
Sbjct: 33  EESDTDEVESVEHFKYNQELDKSLLSRSSVV-GLGFGLMSPVLGMSTSMAIGLINGGPAT 91

Query: 129 LIIGYILVSFETYFMIQAAGEMAVTYPTLPANFNAYSSIFISKSFGFATVWLYCFQWLTV 188
           ++ G+I+     +F   + GE+   +P      +  S++   K       W     WL +
Sbjct: 92  ILWGFIISGICIWFCSLSLGEVVSKFPM---ELHVSSAMLAPKDAKLICSWYT--GWLML 146

Query: 189 LPLELITASMT----------IQFGNDKINPDIY-----ILIFYVFLVFIHFFGVKAYGE 233
           L    ++ S+T          I      +  + Y     ++IFY+ +  +    +K    
Sbjct: 147 LGNWTMSTSITFAGAQLTISLILMAKSDLIAEKYMIGFTVIIFYLVVTLVGLINLKFARF 206

Query: 234 TEFIFNCCKILMIAGFIILSIVINCGGAGNDGYIGATYWHNPGAFAGDTSIGRFKN--VC 291
            E I   C + +I    ++ I++     G   Y    +      F  D S+  + N  V 
Sbjct: 207 IETINKVCVVWIIYAICVIDILLLIFHQGK--YRSLKF----ALFNFDNSLSGYSNFFVS 260

Query: 292 YIL--VTAYFSFGGMELFALSVQEQSNPRKSTP 322
           +I+    + F+  G  +      E   P K  P
Sbjct: 261 FIIGFQQSNFTLQGFSMLPALADEVKVPEKDIP 293

>Sklu_2305.6 YGL077C, Contig c2305 10656-12281
          Length = 541

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 89/416 (21%), Positives = 162/416 (38%), Gaps = 70/416 (16%)

Query: 60  RAEGSTTRTKQINENTSDLEDGVESITSDSKLKKSMKSRHVVMMSLGTGIGT-----GLL 114
           + E     T  +   T + E G E       L+KS     +    LG G G      G+ 
Sbjct: 23  KEEDQLQHTNTVKSCTLEGERGAE-------LRKSFSLWSI----LGVGFGLTNSWFGIS 71

Query: 115 VANAKGLHYGGPAALIIGYILVSFETYFMIQAAGEMAVTYPTLPANFNAYSSIFISKSFG 174
            +   G+  GGP  ++ G I+++  +  +  + GE++  YP     F     +   K   
Sbjct: 72  ASMVTGISSGGPMMIVYGIIIIALVSVCIGISLGELSSAYPHAGGQFWWSLKLAPPKYRR 131

Query: 175 FATVWLYCFQWLTVLPLELITASMTIQFGNDKI------NPDIYILIFYVFLVF--IHFF 226
           FA      F W   +     +AS T+    + +      +PD  +  +++F+ F  +H F
Sbjct: 132 FAAYMCGSFAWAGSV---FTSASTTLSVATELVGMYALTHPDFEVKRWHIFVCFELLHLF 188

Query: 227 GVKAYGETEFIFNC---------CKILMIAGFIILSI---VINCG-GAGNDG-YIGATYW 272
                     IFNC            L I+ F  ++I   V+ C  G  ND  ++ AT++
Sbjct: 189 --------LMIFNCSGKSLPLISSSALYISLFSFITITITVLACSHGQYNDAKFVFATFY 240

Query: 273 HNPGAFAGDTSIGRFKN--VCYI--LVTAYFSFGGMELFALSVQEQSNPRKSTPVAAKRS 328
           +  G          +KN  + +I  L+   +SF  ++       E   P +  P++   +
Sbjct: 241 NETG----------WKNSGIAFIVGLINPAWSFSCLDCATHMAFEVEKPERVIPISIMGT 290

Query: 329 IYRIVVIYLLTMILIGFNVPYNDDQLMGAGGSATHASPYVLAASIHGVKIVPHIINAVIL 388
           +    +     +I + F++ +N D++M +   A     Y  A       IV   +  +IL
Sbjct: 291 VAIGFITSFCYVIAMFFSL-HNLDEIMSSNTGAPILDIYYQALQSKAGAIV---LGCLIL 346

Query: 389 ISVVSVANSSLYAGPRLICSLAQQGYAP--KFLDYVDRE-GRPLRALIVCCVFGVI 441
            +      +      RL  S A+    P  ++   V+ E G PL A ++ C + V+
Sbjct: 347 FTSFGCVIACHTWQARLCWSFARDNGLPYSRYWSKVNPELGVPLNAHLMSCAWIVL 402

>KLLA0A06666g complement(603169..604851) similar to sp|P36029
           Saccharomyces cerevisiae YKL174c, start by similarity
          Length = 560

 Score = 39.7 bits (91), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 35/142 (24%), Positives = 62/142 (43%), Gaps = 16/142 (11%)

Query: 29  NNFQSSSSEKTYSKQKSGSDKLIHRFADSFKRAE--------GSTTRTKQI----NENTS 76
            +F  + +E+    +K    K  HR    F+  E        G+    +++    NE   
Sbjct: 7   RHFAKTDAERVLGNKKGELTKGSHRAELHFEMPEYIWLSNLNGNIHIPERLLSLLNEEDQ 66

Query: 77  DLEDGVESITSDSKLKKSMKSRHVVMMSLGTGIGT---GLLVANAKGLHYGGPAALIIGY 133
           D+ D V+  T   +L K++ SR  V+  LG G+ +   G+    + GL  GG  ++I GY
Sbjct: 67  DIPDEVKEFTYVQQLDKNLLSRTSVI-GLGFGLMSPVLGMSTTMSIGLLNGGSPSIIFGY 125

Query: 134 ILVSFETYFMIQAAGEMAVTYP 155
           ++    T+    +  E+   YP
Sbjct: 126 LICGIMTWISSLSLSEIVSKYP 147

>YKL174C (YKL174C) [3097] chr11 complement(120385..122241) Member of
           the amino acid permease family of membrane transporters
           [1857 bp, 618 aa]
          Length = 618

 Score = 37.4 bits (85), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 45/88 (51%), Gaps = 4/88 (4%)

Query: 71  INENTSDLEDGVESITSDSKLKKSMKSRHVVMMSLGTGIGT---GLLVANAKGLHYGGPA 127
           ++E+ S   +  E    D  L KS+ SR  ++  LG G+ +   G+  + A GL  GGP 
Sbjct: 31  VHEDDSQENEEAEHFNYDQVLDKSLLSRGSIV-GLGLGLMSPVLGMCTSMAIGLINGGPL 89

Query: 128 ALIIGYILVSFETYFMIQAAGEMAVTYP 155
            +++G+++     +F   + GE+   +P
Sbjct: 90  TIMLGFLISGVCIWFSSLSLGEIVSKFP 117

>Scas_670.14
          Length = 585

 Score = 37.4 bits (85), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 91/439 (20%), Positives = 172/439 (39%), Gaps = 52/439 (11%)

Query: 35  SSEKTYSKQKSGSDKLIHRFADSFKRAEGSTTRTKQINENTSDLEDGVESITSDSKLKKS 94
           S  K +  Q +  +K  ++F  S K ++  ++ T    E  SD+E G + +T   + +K 
Sbjct: 2   SGSKGFISQLNVFNKDNYQFGSSDKTSKAKSSTTATSEEVGSDVEAGQQFVTELDQGEKK 61

Query: 95  MKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALIIGYILVSFETYFMIQAAG-----E 149
           +     + +     +GTG+   ++      G     IG  L+ +    +I  +G     E
Sbjct: 62  LGLVSCIGLICNRMLGTGVFAVSSTIYTLCGS----IGLALIMWAVGAIIAISGLYVYME 117

Query: 150 MAVTYPTLPANFNAYSSIFISKSFGFATV---WLYCFQW-----LTVLPLELITASMTIQ 201
                P      N   +IF    F   ++   +++   W     +    + L  A   + 
Sbjct: 118 FGTAIPKNGGEKNYLEAIFKKPRFFITSMYAAYVFFLGWAAGNSVNTAVMFLTAAGADVT 177

Query: 202 FGNDKINPDIYILIFYVFLVFIHFFGVKAYGETEFIFNCCKILMIAGFIILSIVINCGGA 261
             N +    I + + + F  FI+   VK     +      KI ++  FI ++  +  GG 
Sbjct: 178 TWNQR---GIAVAVIF-FAFFINSVSVKTGLYIQNALGIFKIFIVL-FISVTGWVALGGG 232

Query: 262 GNDGYIGATYWHNPGAFAGDTSIGRFKNVCYILVTAYFSFGGMELFALSVQEQSNPRKST 321
             DGY    + H+  AFAG  +   +  +   L    +SF G      ++ E  +P ++ 
Sbjct: 233 LKDGYQTHNF-HD--AFAGTENATAY-GIVTALYNVIWSFVGYSNVNYALGEVKDPVRTL 288

Query: 322 PVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLMGAGGSATHASPYVLAASI-------H 374
            +A   S+  I ++Y+   +     VP   ++L+        +S  VLAA         H
Sbjct: 289 KIAGPTSMVFIAIVYIFVNVAYFAVVP--KEKLI--------SSKLVLAADFFDIVFGEH 338

Query: 375 GVKIVPHIINAVILISVVSVANSSLYAGPRLICSLAQQGYAP--KFLDYVDREGRPLRAL 432
           G K     +    L +V+SV    +++  R+I  L ++G  P   F         P+  L
Sbjct: 339 GKKAAAAFVGLSALGNVLSV----IFSQGRIIQQLGREGVLPFSNFFASSKPFDSPMVGL 394

Query: 433 ---IVCCVFGVIAFVAASS 448
              ++ C+   +AF A  +
Sbjct: 395 FQHMIICLITFLAFPAGDA 413

>CAGL0M08272g complement(823019..824884) highly similar to sp|P36029
           Saccharomyces cerevisiae YKL174c, start by similarity
          Length = 621

 Score = 35.4 bits (80), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 44/86 (51%), Gaps = 4/86 (4%)

Query: 73  ENTSDLEDGVESITSDSKLKKSMKSRHVVMMSLGTGIGT---GLLVANAKGLHYGGPAAL 129
           +  +D  + VE      +L KS+ SR+ V+  LG G+ +   G+  +   G+  GGP ++
Sbjct: 39  DEVTDEPEEVEHFNYKQELDKSLLSRNSVI-GLGFGLMSPVLGMCTSMGIGMLNGGPLSI 97

Query: 130 IIGYILVSFETYFMIQAAGEMAVTYP 155
           ++G+ +     +F   + GE+   +P
Sbjct: 98  MLGFFISGILIWFSSLSLGEIVSKFP 123

>YHL036W (MUP3) [2250] chr8 (26239..27879) Low affinity methionine
           amino acid permease, member of the amino
           acid-polyamine-choline (APC) family of membrane
           transporters [1641 bp, 546 aa]
          Length = 546

 Score = 35.0 bits (79), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 64/279 (22%), Positives = 110/279 (39%), Gaps = 25/279 (8%)

Query: 216 FYVFLVFIHFFGVKAYGETEFIFNCCKILMIAGFIILSIVINCGGAGNDGYI----GATY 271
           F +F V IH   V+      FI N      + G  ++ IV+ C       +     G   
Sbjct: 191 FIIFAVLIHGVSVR---HGVFIQNA-----LGGLKLIMIVLMCFAGLYTLFFYKSTGQVA 242

Query: 272 WHNPGAFAGDTSIGRFKNVCYILVTAYFSFGGMELFALSVQEQSNPRKSTPVAAKRSIYR 331
           W  P       S+    ++    ++++F F G +       E  NP K+  V+   S+  
Sbjct: 243 WDLPVTQVEKDSLLSVSSIATAFISSFFCFSGWDTVHTVTSEIKNPVKTLKVSGPLSLII 302

Query: 332 IVVIYLLTMILIGFNVPYNDDQLMGAGGSATHASPYVLAASIHGVKIVPHIINAVILISV 391
             V Y  TM+ + +      ++++ AG         VL   + G ++    I   I IS 
Sbjct: 303 CFVCY--TMMNVAYLKVLTYEEIVSAGPLVGS----VLFTKLFGPRVGGKFIAFSIAISA 356

Query: 392 VSVANSSLYAGPRLICSLAQQGYAPKFLDYVDRE---GRPLRALIVCCVFGVIAFVAASS 448
            S     +Y+  R+   + ++GY P F  ++ +      PL + I  C F  IA++    
Sbjct: 357 ASNILVVIYSISRVNQEIFKEGYLP-FSIHMSKNWPFDAPLPS-ISLCGFITIAWILILP 414

Query: 449 KEEIVFTWLAAIAGLSELF--TWTSIMLSHLRFRQAMKV 485
           KE   F +L ++ G    F     +I L   RF+   +V
Sbjct: 415 KEGESFNYLVSMDGYGNQFFLLLVAIGLFIWRFKHKNEV 453

>KLLA0C15521g complement(1347098..1348741) similar to sp|P19807
           Saccharomyces cerevisiae YGL077c HNM1 choline permease,
           start by similarity
          Length = 547

 Score = 34.3 bits (77), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 89/406 (21%), Positives = 162/406 (39%), Gaps = 69/406 (16%)

Query: 69  KQINENTSDLEDGVESI--TSDSKLKKSMKSRHVVMMSLG-TGIGTGLLVANAKGLHYGG 125
            ++ E +   +D  ++   T +  L+KS     ++ +  G T    G+ V+   G++ GG
Sbjct: 33  SKLEEQSISSKDAYDAYGGTGEGHLRKSFSLWSILGVGFGLTNSWFGISVSMVTGIYSGG 92

Query: 126 PAALIIGYILVSFETYFMIQAAGEMAVTYPTLPANFNAYSSIFISKSFGFATVWLYCFQW 185
           P  ++ G I+++  +  +    GE++  +P     F     +   K    A      F W
Sbjct: 93  PMMVVYGIIIIALISICIAVTLGELSSAFPHAGGQFWWSLQLAPPKYRRLAAYLCGSFAW 152

Query: 186 LTVLPLELITASMTIQFGNDKI------NPDIYILIFYVFLVF--IHFFGVKAYGETEFI 237
              +     +AS T+   ++ +      +PD  +  ++VF+ F  +H F          +
Sbjct: 153 AGAI---FSSASTTLSVASELVGMYALTHPDFEVKRWHVFVCFQILHLF--------LMM 201

Query: 238 FNCCK------------ILMIAGFIILSIVINCG-GAGNDG-YIGATYWHNPGAFAGDTS 283
           FNC              I +I+ F I   V+ C  G  ND  ++ AT+++  G       
Sbjct: 202 FNCSGKALPVISQSSLYISLISFFTITVTVLACSHGKYNDAKFVFATFYNETG------- 254

Query: 284 IGRFKN--VCYI--LVTAYFSFGGMELFALSVQEQSNPRKSTPVAAKRSIYRIVVIYLLT 339
              +KN  + +I  L+   +SF  ++       E  NP +  P+    SI   V I  LT
Sbjct: 255 ---WKNGVIAFIVGLINPAWSFSCLDCATHMAFEVENPERVIPI----SILCTVGIGFLT 307

Query: 340 ----MILIGFNVPYNDDQLMGAGGSATHASPYVLAASIHGVKIVPH--IINAVILISVVS 393
               +I + F++     Q + A  S+    P +L       K  P   ++  +IL +   
Sbjct: 308 SFSYVIAMFFSL-----QDLEAVASSNTGMP-ILEIFRQATKSTPGAVVLGCLILFTSFG 361

Query: 394 VANSSLYAGPRLICSLAQQGYAP--KFLDYVDRE-GRPLRALIVCC 436
              +      RL  S A+    P  K+   +D E G PL A ++ C
Sbjct: 362 CVIACHTWQARLCWSFARDNGIPYSKYWAKIDPELGVPLNAHLLSC 407

>CAGL0H03399g complement(316110..317780) highly similar to sp|P19807
           Saccharomyces cerevisiae YGL077c HNM1 choline permease,
           hypothetical start
          Length = 556

 Score = 33.5 bits (75), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 59/280 (21%), Positives = 118/280 (42%), Gaps = 40/280 (14%)

Query: 73  ENTSDLEDGVESITSDSKLKKSMKSRHVVMMSLGTGIGT-----GLLVANAKGLHYGGPA 127
           +N   + +  +SI  +  L+KS     +    LG G G      G+  +   G++ GGP 
Sbjct: 26  KNGKKIIEQEQSIDGEVHLRKSFSLWSI----LGVGFGLTNSWFGISASMVTGINSGGPM 81

Query: 128 ALIIGYILVSFETYFMIQAAGEMAVTYPTLPANFNAYSSIFISKSFGFATVWLYCFQWLT 187
            ++ G I+++  +  +  + GE++  YP     F     +  +K   FA      F +  
Sbjct: 82  MIVYGIIIIALISVCIGVSLGELSSAYPHAGGQFWWSLKLAPTKHKRFAAYLCGSFAYAG 141

Query: 188 VLPLELITASMTIQFGNDKI------NPDIYILIFYVFLVF--IHFFGV--KAYGETEFI 237
            L     +AS T+    + +      +P+     +++F+ F  +H F +    YG++  +
Sbjct: 142 SL---FTSASTTLSAATELVGMYVLTHPEFTPKRWHIFVCFELLHLFLMLFNCYGKSLPL 198

Query: 238 FNCCK--ILMIAGFIILSIVINC-GGAGNDG-YIGATYWHNPGAFAGDTSIGRFKN--VC 291
            +     I + + F+I   V+ C  G  ND  ++ AT+++  G          +KN  + 
Sbjct: 199 ISASSLYISLTSFFVITVTVLACSSGKFNDAKFVFATFYNETG----------WKNSVIA 248

Query: 292 YI--LVTAYFSFGGMELFALSVQEQSNPRKSTPVAAKRSI 329
           +I  L+   +SF  ++       E   P +  P+A   +I
Sbjct: 249 FIVGLINPAWSFSCLDCATHMAFEVEKPERVIPIAIMGTI 288

>CAGL0B02838g complement(274984..276762) highly similar to sp|P50276
           Saccharomyces cerevisiae YGR055w MUP1, High-affinity
           methionine permease, hypothetical start
          Length = 592

 Score = 32.7 bits (73), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 84/399 (21%), Positives = 150/399 (37%), Gaps = 37/399 (9%)

Query: 36  SEKTYSKQKSGSDKLIHRFAD------SFKRAEGSTTRTKQINENTSDLEDGVESITSDS 89
            EK          K +H  +D       F +     + +++  ++TSD E G +  T   
Sbjct: 6   EEKDNIVNSKTEQKTVHTMSDFLSQLNIFNKENYKFSSSEKSEDDTSDFETGQQFATELD 65

Query: 90  KLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALIIGYILVSFETYFMIQAAG- 148
           + +K +     + +     +GTG+   ++      G     IG  L+ +    +I  AG 
Sbjct: 66  QGEKRLGLISCIGLICNRMLGTGVFAVSSTIYTLSGS----IGLALILWAVGALIALAGL 121

Query: 149 ----EMAVTYPTLPANFNAYSSIFISKSFGFATVWL-YCFQWLTVLPLELITASMTIQFG 203
               E     P      N   +IF    F    ++  Y F         + TA M +   
Sbjct: 122 YVYMEFGTAIPRNGGEKNYLEAIFKKPKFFITCMYASYVFFLGWAAGNSVNTAVMFLTAA 181

Query: 204 NDKINP--DIYILIFYVFLVF-IHFFGVKAYGETEFIFNCCKILMIAGFIILSIVINCGG 260
           N ++       I +  VF  F ++   V+A    + +    K L I  FI ++  +   G
Sbjct: 182 NTEVTKWNQRGIGVAVVFFCFAVNSINVRAGLYIQNVLGVFK-LGIVIFISITGWVALAG 240

Query: 261 AGNDGYIGATYWHNPGAFAGDTSIGRFKNVCYILVTAYFSFGGMELFALSVQEQSNPRKS 320
               GY    + HN  AF G      +  V   L    +SF G      ++ E  NP ++
Sbjct: 241 GLKHGYQSHNF-HN--AFEGTNKATAY-GVVNALYNVIWSFVGYSNVNYALGEVKNPVRT 296

Query: 321 TPVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLMGAGGSATHASPYVLAASIHGVKIVP 380
             +A   S+  + +IY+   I     VP   D+L+        +S  +LAA    +    
Sbjct: 297 LKIAGPTSLICLAIIYIFVNIAYFAVVP--KDKLI--------SSKLILAADFFDICFGG 346

Query: 381 H---IINAVILISVVSVANSSLYAGPRLICSLAQQGYAP 416
           H   +  A++ +S +    S +++  R+I  L ++G  P
Sbjct: 347 HAKRVAAALVGLSALGNVMSVIFSQGRIIQQLGREGVLP 385

>AFR326W [3518] [Homologous to ScYDR011W (SNQ2 ) - NSH; ScYNR070W -
           NSH] complement(1025594..1029523) [3930 bp, 1309 aa]
          Length = 1309

 Score = 32.7 bits (73), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 34/147 (23%), Positives = 63/147 (42%), Gaps = 18/147 (12%)

Query: 457 LAAIAGLSELFTWTSIM-----LSHLRFRQAMKVQGRSLDELGYKATTGIWGSIYGVFFN 511
           + A  G + L+ W +       ++ +   Q +K+  R    +     T   G + G    
Sbjct: 164 IEAFLGNASLYLWDNCTNGLDSMTAMDIIQGLKLMARVTKTVNLFGCTQANGILLGQVDK 223

Query: 512 ILVFVAQFWVALAPLGNGGKCDAESFFQNYLAFP----IWLAFYFGYMVYNRDFTLLNPL 567
           +LV +  + V       G   D   FF++ L FP    +  + YF  ++Y    ++ +PL
Sbjct: 224 VLVLIGDYQVFY-----GSYQDCILFFES-LYFPKDPNLLDSEYFSAVIYG---SIQSPL 274

Query: 568 DKIDLDFHRRIYDPELMRQEDEENKEK 594
            K D DFHR+       R+ ++E++ K
Sbjct: 275 IKTDSDFHRQWIHSSYYRKVNDESQIK 301

>YGL077C (HNM1) [1905] chr7 complement(362226..363917) Choline
           permease, member of the amino acid permease family of
           membrane transporters [1692 bp, 563 aa]
          Length = 563

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 23/100 (23%), Positives = 44/100 (44%), Gaps = 5/100 (5%)

Query: 67  RTKQINENTSDLED----GVESITSDSKLKKSMKSRHVVMMSLG-TGIGTGLLVANAKGL 121
           R  ++ E    L+D    G  +   +  L+KS     ++ +  G T    G+  +   G+
Sbjct: 26  RDLRVEEEIKPLDDMDSKGAVAADGEVHLRKSFSLWSILGVGFGLTNSWFGISTSMVAGI 85

Query: 122 HYGGPAALIIGYILVSFETYFMIQAAGEMAVTYPTLPANF 161
             GGP  ++ G I+V+  +  +  + GE++  YP     F
Sbjct: 86  SSGGPMMIVYGIIIVALISICIGTSLGELSSAYPHAGGQF 125

>Scas_720.18
          Length = 569

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 62/318 (19%), Positives = 120/318 (37%), Gaps = 58/318 (18%)

Query: 39  TYSKQKSGSDKLIHRFADSFKRAEGSTTRTKQINENTSDLEDGVESITSDSKLKKSMKSR 98
           TY++    +  L  R  D+F + + ST         T +L+    +   +  L+KS    
Sbjct: 13  TYNQDIDSNTSLHQR--DTFDKNKLST--------KTQELDGDANNNNGEVHLRKSFS-- 60

Query: 99  HVVMMSLGTGIGT-----GLLVANAKGLHYGGPAALIIGYILVSFETYFMIQAAGEMAVT 153
             V   LG G G      G+  +   G+  GGP  ++ G I+++  +  +  +  E++  
Sbjct: 61  --VWSILGVGFGLTNSWFGISASMVTGISSGGPMMVVYGIIIIALVSICIGTSLSELSSA 118

Query: 154 YPTLPANFNAYSSIFISKSFGFATVWLYCFQWLTVLPLELITASMTIQFGNDKI------ 207
           YP     F     +   K   FA      F +   +     +AS T+    + +      
Sbjct: 119 YPHAGGQFFWSLKLAPPKHKRFAAYLCGSFAYAGSV---FTSASTTLSVATEVVGMYALT 175

Query: 208 NPDIYILIFYVFLVFIHFFGVKAYGETEFIFNC------------CKILMIAGFIILSIV 255
           +PD  +  +++F+ F      +       +FNC              I +++ F I   V
Sbjct: 176 HPDFKVQRWHIFVCF------ELLHLLLMLFNCYGKSLPFISASSLYISLVSFFTITVTV 229

Query: 256 INC--GGAGNDGYIGATYWHNPGAFAGDTSIGRFKNVCYI--LVTAYFSFGGMELFALSV 311
           + C  G   +  ++ AT+++  G   G         + +I  L+   +SF  ++      
Sbjct: 230 LACSHGNFNDPKFVFATFYNETGWKNG--------GIAFIVGLINPAWSFSCLDCATHMA 281

Query: 312 QEQSNPRKSTPVAAKRSI 329
            E   P +  P+A   +I
Sbjct: 282 FEVEKPERVIPIAIMGTI 299

>AEL125C [2381] [Homologous to ScYKL174C - SH] (387763..389490)
           [1728 bp, 575 aa]
          Length = 575

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 37/77 (48%), Gaps = 4/77 (5%)

Query: 82  VESITSDSKLKKSMKSRHVVMMSLGTGIGT---GLLVANAKGLHYGGPAALIIGYILVSF 138
           VE    + KL +++ SR  V+  LG G+ +   G+      GL +GGP  ++  + L   
Sbjct: 41  VEHFQYEQKLDRTLLSRRSVI-GLGFGLMSPVLGMSTTLGIGLVHGGPPTILGAFALCGL 99

Query: 139 ETYFMIQAAGEMAVTYP 155
            ++    A GE+   YP
Sbjct: 100 MSWLTALAIGEVVSKYP 116

>YGR055W (MUP1) [2018] chr7 (599419..601143) High-affinity
           methionine permease [1725 bp, 574 aa]
          Length = 574

 Score = 30.8 bits (68), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 93/428 (21%), Positives = 165/428 (38%), Gaps = 52/428 (12%)

Query: 35  SSEKTYSKQKSGSDKLIHRFADSFKRAEGSTTRTKQINENTSDLEDGVESITSDSKLKKS 94
           S  +T+  Q +  +K  ++F+ S  + E S + T   +   SD E G +  T   + +K 
Sbjct: 2   SEGRTFLSQLNVFNKENYQFSSSTTKKEVSNS-TVDADNGASDFEAGQQFATELDQGEKQ 60

Query: 95  MKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALIIGYILVSFETYFMIQAAG-----E 149
           +     + +     +GTG+   ++      G     +G  L+ +    +I  +G     E
Sbjct: 61  LGILSCIGLICNRMLGTGVFAVSSTIYTLCGS----VGLALIMWAVGAIIAISGLYVYME 116

Query: 150 MAVTYPTLPANFNAYSSIFISKSFGFAT----VWLYCFQW-----LTVLPLELITASMTI 200
                P      N   +IF    F F T     +++   W     +    + L  A   +
Sbjct: 117 FGTAIPKNGGEKNYLEAIFRKPKF-FITCMYAAYIFFLGWAAGNSINTAIMFLTAADTEV 175

Query: 201 QFGNDKINPDIYI-LIFYVFLVFIHFFGVKAYGETEFIFNCCKILMIAGFIILSIVINCG 259
              N +    I + ++F+ FL  I+   VK     + I    KI ++  FI ++  +  G
Sbjct: 176 TKWNQR---GIGVAVVFFAFL--INSLNVKIGLYLQNILGIFKIGIVL-FISITGWVALG 229

Query: 260 GAGNDGYIGATYWHN-PGAFAGDTSIGRFKNVCYILVTAYFSFGGMELFALSVQEQSNPR 318
           G   DGY      HN   AF G T       +   L +  +SF G      ++ E  NP 
Sbjct: 230 GGLKDGYQS----HNFRNAFEG-TETATAYGIVNALYSVIWSFVGYSNVNYALGEVKNPV 284

Query: 319 KSTPVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLMGAGGSATHASPYVLAASIHGVKI 378
           ++  +A   S+  + +IY+   I     VP   D+L+        +S  +LAA    +  
Sbjct: 285 RTLKIAGPTSMVFLAIIYIFVNIAYFAVVP--KDKLI--------SSKLILAADFFDIVF 334

Query: 379 ---VPHIINAVILISVVSVANSSLYAGPRLICSLAQQGYAP--KFLDYVDREGRPLRAL- 432
                    A++ +S +    S +++  R+I  L ++G  P   F         P+  L 
Sbjct: 335 GGQAKRAAAALVGLSALGNVLSVIFSQGRIIQQLGREGVLPFSNFFASSKPFNSPMVGLF 394

Query: 433 ---IVCCV 437
              IVC V
Sbjct: 395 QHFIVCTV 402

>CAGL0E04004g complement(383385..384968) similar to sp|P38734
           Saccharomyces cerevisiae YHL036w MUP3 very low affinity
           methionine permease, hypothetical start
          Length = 527

 Score = 30.4 bits (67), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 40/199 (20%), Positives = 81/199 (40%), Gaps = 17/199 (8%)

Query: 270 TYWHNPGAFAGDTSIGRFKNVCYILVTAYFSFGGMELFALSVQEQSNPRKSTPVAAKRSI 329
           T W +P     D S     ++    ++A+F F G +       E  NP ++  ++   S+
Sbjct: 223 TQWDSPFFSFQDKSAFSLNSLASAFISAFFCFAGWDSVHSVTSEVKNPARTLKISGLCSL 282

Query: 330 YRIVVIYLLTMILIGFNVPYNDDQLMGAG---GSATHASPYVLAASIHGVKIVPHIINAV 386
               + Y  T++ + +    + +++  AG   GS       VL   + G ++   ++   
Sbjct: 283 AICALCY--TLMNVAYTKVLSYEEIANAGPLVGS-------VLFKKLFGAQVGGALMTGS 333

Query: 387 ILISVVSVANSSLYAGPRLICSLAQQGYAPKFLDYVDRE---GRPLRALIVCCVFGVIAF 443
           + +S  S     +Y   R+   + ++GY P F   + R      PL +L+ C +      
Sbjct: 334 VAVSAASNVIVVIYGISRVNQEIFREGYLP-FSKVLARNWPWDAPLFSLLTCALLTCTWI 392

Query: 444 VAASSKEEIVFTWLAAIAG 462
           +   S E   F +L ++ G
Sbjct: 393 IILPS-EGSSFNYLISVEG 410

>ACL073W [976] [Homologous to ScYHL036W (MUP3) - SH]
           complement(222802..224379) [1578 bp, 525 aa]
          Length = 525

 Score = 30.0 bits (66), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 45/221 (20%), Positives = 89/221 (40%), Gaps = 20/221 (9%)

Query: 266 YIGATYWHNPGAFAGDTSIGRFKNVCYILVTAYFSFGGMELFALSVQEQSNPRKSTPVAA 325
           Y+ + +W +      D+S+    ++    + A+F F G +     V E  +P ++  +A 
Sbjct: 231 YVKSHFWESR-----DSSLITASSLTASFMQAFFCFSGWDGVHSVVSEVKDPVRTMRIAG 285

Query: 326 KRSIYRIVVIYLLTMILIGFNVPYNDDQLMGAG---GSATHASPYVLAASIHGVKIVPHI 382
             S+   +  Y+L      F + + + Q  GAG   GS       +L + ++G  +    
Sbjct: 286 PFSLLIALGCYMLLNFAYLFVLSWEEIQ--GAGPLIGS-------ILFSKLYGPTLGGKF 336

Query: 383 INAVILISVVSVANSSLYAGPRLICSLAQQGYAP--KFLDYVDREGRPLRALIVCCVFGV 440
           +   + +S  S     +Y   R+     ++GY P  K +      G PL +L+ CC    
Sbjct: 337 VTLCVAVSTASNLFVVIYGTSRMNQEFFREGYLPFSKQMASNWPWGSPLPSLL-CCGLIT 395

Query: 441 IAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQ 481
           +A++         + +L    G S+ F    I +    +R 
Sbjct: 396 VAWLCFLPPSGAAYDYLVNFEGYSKQFFLMLIAIGLFIYRH 436

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.324    0.139    0.417 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 19,028,814
Number of extensions: 809967
Number of successful extensions: 4278
Number of sequences better than 10.0: 190
Number of HSP's gapped: 3928
Number of HSP's successfully gapped: 242
Length of query: 599
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 492
Effective length of database: 12,891,983
Effective search space: 6342855636
Effective search space used: 6342855636
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)
S2: 64 (29.3 bits)