Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YBR067C (TIP1)2101045535e-72
Scas_718.432141023679e-44
CAGL0L07502g228992792e-30
Sklu_2257.2231942382e-24
YIL011W (TIR3)269892132e-20
Scas_643.22521052086e-20
CAGL0F01463g2211082022e-19
Scas_717.7247761806e-16
CAGL0C03872g255791762e-15
Scas_614.13737981714e-14
Scas_436.1216871647e-14
CAGL0F01485g337781661e-13
YOR009W (TIR4)487861671e-13
CAGL0H09592g236811622e-13
CAGL0H09614g236811622e-13
YER011W (TIR1)254771561e-12
YOR010C (TIR2)251841394e-10
Scas_692.28d148901179e-08
YLL025W124771081e-06
YLR037C (DAN2)124771072e-06
YFL020C (PAU5)122771062e-06
YOL161C120771053e-06
YNR076W (PAU6)120771044e-06
YLL064C120771044e-06
YEL049W (PAU2)120771036e-06
Scas_692.19429771077e-06
YJL223C (PAU1)120771028e-06
YIL176C120771028e-06
YIR041W124771011e-05
YDR542W120771011e-05
YBR301W (DAN3)120771011e-05
YGR294W120771011e-05
YKL224C123771011e-05
Scas_614.12224731041e-05
YLR461W (PAU4)120771011e-05
YGL261C120771011e-05
YAL068C120771011e-05
YHL046C120771001e-05
YMR325W124771002e-05
YCR104W (PAU3)12477992e-05
YPL282C16477994e-05
YOR394W16477994e-05
YJR150C (DAN1)298771006e-05
CAGL0G10175g577731007e-05
CAGL0C00209g43773935e-04
YJR151C (DAN4)116177900.001
ADR019C21082770.042
Scas_692.28*21877760.057
Scas_644.1127289680.58
Scas_676.30267105615.1
AGR050W45748606.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YBR067C
         (207 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YBR067C (TIP1) [257] chr2 complement(372063..372695) Cold- and h...   217   5e-72
Scas_718.43                                                           145   9e-44
CAGL0L07502g complement(826383..827069) similar to sp|P33890 Sac...   112   2e-30
Sklu_2257.2 YIL011W, Contig c2257 1749-2444                            96   2e-24
YIL011W (TIR3) [2653] chr9 (333724..334533) Member of the seripa...    87   2e-20
Scas_643.2                                                             85   6e-20
CAGL0F01463g 149905..150570 similar to sp|P10863 Saccharomyces c...    82   2e-19
Scas_717.7                                                             74   6e-16
CAGL0C03872g complement(379501..380268) similar to sp|P40552 Sac...    72   2e-15
Scas_614.13                                                            70   4e-14
Scas_436.1                                                             68   7e-14
CAGL0F01485g complement(151321..152334) similar to sp|P10863 Sac...    69   1e-13
YOR009W (TIR4) [4824] chr15 (344334..345797) Member of the serip...    69   1e-13
CAGL0H09592g 937859..938569 highly similar to sp|P10863 Saccharo...    67   2e-13
CAGL0H09614g complement(939286..939996) highly similar to sp|P10...    67   2e-13
YER011W (TIR1) [1434] chr5 (175247..176011) Stress-induced cell ...    65   1e-12
YOR010C (TIR2) [4825] chr15 complement(346194..346949) Cold-shoc...    58   4e-10
Scas_692.28d                                                           50   9e-08
YLL025W (YLL025W) [3394] chr12 (94746..95120) Protein with stron...    46   1e-06
YLR037C (DAN2) [3455] chr12 complement(222686..223060) Member of...    46   2e-06
YFL020C (PAU5) [1663] chr6 complement(99225..99593) Member of th...    45   2e-06
YOL161C (YOL161C) [4664] chr15 complement(11548..11910) Member o...    45   3e-06
YNR076W (PAU6) [4659] chr14 (781915..782277) Protein with strong...    45   4e-06
YLL064C (YLL064C) [3360] chr12 complement(13083..13445) Protein ...    45   4e-06
YEL049W (PAU2) [1379] chr5 (63728..64090) Member of the seripaup...    44   6e-06
Scas_692.19                                                            46   7e-06
YJL223C (PAU1) [2708] chr10 complement(8776..9138) Member of the...    44   8e-06
YIL176C (YIL176C) [2504] chr9 complement(8793..9155) Member of t...    44   8e-06
YIR041W (YIR041W) [2704] chr9 (433925..434299) Protein with stro...    44   1e-05
YDR542W (YDR542W) [1351] chr4 (1523230..1523592) Protein with st...    44   1e-05
YBR301W (DAN3) [477] chr2 (809013..809375) Protein with strong s...    44   1e-05
YGR294W (YGR294W) [2236] chr7 (1080311..1080673) Protein with st...    44   1e-05
YKL224C (YKL224C) [3052] chr11 complement(1811..2182) Protein wi...    44   1e-05
Scas_614.12                                                            45   1e-05
YLR461W (PAU4) [3834] chr12 (1062916..1063278) Member of the ser...    44   1e-05
YGL261C (YGL261C) [1739] chr7 complement(6290..6652) Protein wit...    44   1e-05
YAL068C (YAL068C) [1] chr1 complement(1807..2169) Protein possib...    44   1e-05
YHL046C (YHL046C) [2243] chr8 complement(11921..12283) Member of...    43   1e-05
YMR325W (YMR325W) [4277] chr13 (922639..923013) Protein with ver...    43   2e-05
YCR104W (PAU3) [625] chr3 (307797..308171) Protein involved in t...    43   2e-05
YPL282C (YPL282C) [5169] chr16 complement(7933..8427) Protein wi...    43   4e-05
YOR394W (YOR394W) [5166] chr15 (1082714..1083208) Protein with h...    43   4e-05
YJR150C (DAN1) [3041] chr10 complement(708726..709622) Cell wall...    43   6e-05
CAGL0G10175g 977483..979216 some similarities with sp|P47179 Sac...    43   7e-05
CAGL0C00209g complement(11626..12939) some similarities with sp|...    40   5e-04
YJR151C (DAN4) [3042] chr10 complement(712170..715655) Member of...    39   0.001
ADR019C [1760] [Homologous to ScYER011W (TIR1) - SH] (739207..73...    34   0.042
Scas_692.28*                                                           34   0.057
Scas_644.11                                                            31   0.58 
Scas_676.30                                                            28   5.1  
AGR050W [4360] [Homologous to ScYDR132C - SH; ScYLR108C - SH] co...    28   6.6  

>YBR067C (TIP1) [257] chr2 complement(372063..372695) Cold- and
           heat-shock induced mannoprotein of the cell wall, member
           of the seripauperin (PAU) family [633 bp, 210 aa]
          Length = 210

 Score =  217 bits (553), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 104/104 (100%), Positives = 104/104 (100%)

Query: 1   MSVSKIAFVLSAIASLAVADTSAAETAELQAIIGDINSHLSDYLGLETGNSGFQIPSDVL 60
           MSVSKIAFVLSAIASLAVADTSAAETAELQAIIGDINSHLSDYLGLETGNSGFQIPSDVL
Sbjct: 1   MSVSKIAFVLSAIASLAVADTSAAETAELQAIIGDINSHLSDYLGLETGNSGFQIPSDVL 60

Query: 61  SVYQQVMTYTDDAYTTLFSELDFDAITKTIVKLPWYTTRLSSEI 104
           SVYQQVMTYTDDAYTTLFSELDFDAITKTIVKLPWYTTRLSSEI
Sbjct: 61  SVYQQVMTYTDDAYTTLFSELDFDAITKTIVKLPWYTTRLSSEI 104

>Scas_718.43
          Length = 214

 Score =  145 bits (367), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 72/102 (70%), Positives = 88/102 (86%), Gaps = 4/102 (3%)

Query: 3   VSKIAFVLSAIA--SLAVADTSAAETAELQAIIGDINSHLSDYLGLETGNSGFQIPSDVL 60
           +SK++ +L+A+A  S+  A  +A +TAELQAII DINSHLS+YLGL+TGNSGFQIP+DVL
Sbjct: 1   MSKLSILLAAVATASMVSALDTAQQTAELQAIIEDINSHLSEYLGLQTGNSGFQIPADVL 60

Query: 61  SVYQQVMTYT--DDAYTTLFSELDFDAITKTIVKLPWYTTRL 100
            VYQQVMTY   DD+YTTLFSEL+FD IT+TIVKLPWY+TRL
Sbjct: 61  KVYQQVMTYKAGDDSYTTLFSELNFDEITQTIVKLPWYSTRL 102

>CAGL0L07502g complement(826383..827069) similar to sp|P33890
           Saccharomyces cerevisiae YOR010c TIR2 or sp|P27654
           Saccharomyces cerevisiae YBR067c TIP1, start by
           similarity
          Length = 228

 Score =  112 bits (279), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 53/99 (53%), Positives = 76/99 (76%), Gaps = 1/99 (1%)

Query: 3   VSKIAFVLSAIASLAVADTSAAETAELQAIIGDINSHLSDYLGLETG-NSGFQIPSDVLS 61
           +SK A +++AIA+  V   +A E AE+Q ++ DINS+L+ YL LET  +SGFQIP ++LS
Sbjct: 1   MSKFAVLIAAIAATLVNAQNAVEVAEIQVLVNDINSNLAQYLSLETNPDSGFQIPDNLLS 60

Query: 62  VYQQVMTYTDDAYTTLFSELDFDAITKTIVKLPWYTTRL 100
           +Y+ V TYTDD+++TL S ++FD IT TIV LPWY++RL
Sbjct: 61  LYRNVATYTDDSFSTLLSGVNFDEITSTIVGLPWYSSRL 99

>Sklu_2257.2 YIL011W, Contig c2257 1749-2444
          Length = 231

 Score = 96.3 bits (238), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 44/94 (46%), Positives = 66/94 (70%), Gaps = 4/94 (4%)

Query: 7   AFVLSAIASLAVADTSAAETAELQAIIGDINSHLSDYLGLETGNSGFQIPSDVLSVYQQV 66
           A +L+AIASL  A     +  E+Q ++ D+++HLSDY+ L   N  F IPS VL VY+Q+
Sbjct: 6   AALLTAIASLVAAQ----DVQEIQLLLSDVSNHLSDYISLAYNNPDFSIPSGVLGVYEQM 61

Query: 67  MTYTDDAYTTLFSELDFDAITKTIVKLPWYTTRL 100
            TYTDD+YT+LFS++D  A++  +  LPWY++R+
Sbjct: 62  TTYTDDSYTSLFSQIDMTAVSTIVTALPWYSSRI 95

>YIL011W (TIR3) [2653] chr9 (333724..334533) Member of the
           seripauperin (PAU) family of possible cell wall
           mannoproteins [810 bp, 269 aa]
          Length = 269

 Score = 86.7 bits (213), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 39/89 (43%), Positives = 56/89 (62%)

Query: 16  LAVADTSAAETAELQAIIGDINSHLSDYLGLETGNSGFQIPSDVLSVYQQVMTYTDDAYT 75
           L  A+    E  E  AI+ D+ ++L  Y+ L   N  F +PS VL VYQ + T TDD+YT
Sbjct: 19  LVSAEVGQYEIVEFDAILADVKANLEQYMSLAMNNPDFTLPSGVLDVYQHMTTATDDSYT 78

Query: 76  TLFSELDFDAITKTIVKLPWYTTRLSSEI 104
           + F+E+DF  IT  +V++PWY++RL  EI
Sbjct: 79  SYFTEMDFAQITTAMVQVPWYSSRLEPEI 107

>Scas_643.2
          Length = 252

 Score = 84.7 bits (208), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 48/105 (45%), Positives = 72/105 (68%), Gaps = 6/105 (5%)

Query: 4   SKIAFVLSAIASLAVADTSAAETAELQAIIGDINSHLSDYLGLET-GNSGFQI---PSDV 59
           SKIA +L+A A  A A TS  + AEL  ++ D++S+L+DY+ L T   +GF +   PS V
Sbjct: 3   SKIALLLTA-AVFASAQTST-QVAELSVLLQDVSSNLADYMSLATTPGTGFSLEDMPSGV 60

Query: 60  LSVYQQVMTYTDDAYTTLFSELDFDAITKTIVKLPWYTTRLSSEI 104
           LS+   + T TDD+YT+++SE+DF  I+  + +LPWYT+RL S+I
Sbjct: 61  LSIGMALATATDDSYTSMYSEVDFAGISSMLTELPWYTSRLKSQI 105

>CAGL0F01463g 149905..150570 similar to sp|P10863 Saccharomyces
           cerevisiae YER011w TIR1, start by similarity
          Length = 221

 Score = 82.4 bits (202), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 47/108 (43%), Positives = 67/108 (62%), Gaps = 5/108 (4%)

Query: 1   MSVSKIAFVLSAIASLAVADTSAAETAELQAIIGDINSHLSDYLGL-ETGNSGF---QIP 56
           M+ +K A ++SA+A+ AVA   A + AEL AI+ D +SHLSDY GL    NSG     +P
Sbjct: 1   MAYTKTALLVSALAAFAVAQ-DATQLAELNAILQDFSSHLSDYTGLLANPNSGITAADLP 59

Query: 57  SDVLSVYQQVMTYTDDAYTTLFSELDFDAITKTIVKLPWYTTRLSSEI 104
           + VL +   + T TD +YT+L+  +DF  I   + KLPWY++RL   I
Sbjct: 60  AGVLQLGLAIQTATDKSYTSLYPSVDFKGIEALLPKLPWYSSRLLPAI 107

>Scas_717.7
          Length = 247

 Score = 73.9 bits (180), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 54/76 (71%)

Query: 25  ETAELQAIIGDINSHLSDYLGLETGNSGFQIPSDVLSVYQQVMTYTDDAYTTLFSELDFD 84
           E AE  AI+ D+ +HL DY+ L   N  F IPS VLSVY+++ TYTDD YT+LFS +DF 
Sbjct: 24  EVAEFNAILVDVQAHLEDYMSLAMNNPDFTIPSGVLSVYEELTTYTDDTYTSLFSAIDFA 83

Query: 85  AITKTIVKLPWYTTRL 100
            +T  + ++PWY++RL
Sbjct: 84  QVTTVMHQVPWYSSRL 99

>CAGL0C03872g complement(379501..380268) similar to sp|P40552
           Saccharomyces cerevisiae YIL011w TIR3, start by
           similarity
          Length = 255

 Score = 72.4 bits (176), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 49/79 (62%)

Query: 22  SAAETAELQAIIGDINSHLSDYLGLETGNSGFQIPSDVLSVYQQVMTYTDDAYTTLFSEL 81
           S  E +E   I+ D+  HL+DY+     +  F +P  VL +Y  + T TDD+YTT++ ++
Sbjct: 23  SNNEISEFNVILSDVMGHLTDYISYAENDPNFTLPDHVLDLYMAMTTATDDSYTTMYDQI 82

Query: 82  DFDAITKTIVKLPWYTTRL 100
           +F  +T  + +LPWY++R+
Sbjct: 83  NFSQVTDAMTRLPWYSSRI 101

>Scas_614.13
          Length = 737

 Score = 70.5 bits (171), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 43/98 (43%), Positives = 65/98 (66%), Gaps = 6/98 (6%)

Query: 1  MSVSKIAFVLSAIASLAVADT-SAAETAELQAIIGDINSHLSDYLGLETGNSGFQIPSDV 59
          M +S  A +LSA AS+A+A+T + AE AELQ ++ D+N +L +Y+ L T  SGF +P ++
Sbjct: 1  MKLSTSATLLSA-ASVALANTITPAENAELQVVLADVNDNLGNYMNLLTV-SGFTLPDNI 58

Query: 60 LSVYQQVMTYTDD-AYTTLFSELDFDAITKTIVKLPWY 96
          + +Y  +   TD  +YTTLF+ELD   I+  +  LPWY
Sbjct: 59 IDIY--IGMGTDPVSYTTLFTELDMGQISAMLTWLPWY 94

 Score = 67.0 bits (162), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 55/83 (66%), Gaps = 3/83 (3%)

Query: 15  SLAVADT-SAAETAELQAIIGDINSHLSDYLGLETGNSGFQIPSDVLSVYQQVMTYTDDA 73
           S+A+A+T + AE AELQ ++ D+N +L +Y+ L T  SGF +P ++++VY   M     +
Sbjct: 352 SVALANTITPAENAELQVVLADVNDNLGNYMNLLTV-SGFSLPDNIVNVYMG-MGADPVS 409

Query: 74  YTTLFSELDFDAITKTIVKLPWY 96
           YTTLF+ELD   I+  +  LPWY
Sbjct: 410 YTTLFTELDMGQISAMLTWLPWY 432

 Score = 65.9 bits (159), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 55/83 (66%), Gaps = 3/83 (3%)

Query: 15  SLAVADT-SAAETAELQAIIGDINSHLSDYLGLETGNSGFQIPSDVLSVYQQVMTYTDDA 73
           S+A+A+T + AE AELQ ++ D+N +L +Y+ L T  SGF +P ++++VY   M     +
Sbjct: 194 SVALANTITPAENAELQVVLADVNDNLGNYMNLLTV-SGFSLPDNIVNVYFG-MGADPVS 251

Query: 74  YTTLFSELDFDAITKTIVKLPWY 96
           YTTLF+ELD   I+  +  LPWY
Sbjct: 252 YTTLFTELDMGQISAMLTWLPWY 274

>Scas_436.1
          Length = 216

 Score = 67.8 bits (164), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 32/87 (36%), Positives = 57/87 (65%), Gaps = 4/87 (4%)

Query: 22  SAAETAELQAIIGDINSHLSDYLGLET-GNSGF---QIPSDVLSVYQQVMTYTDDAYTTL 77
           SA + AEL  ++ D++S+L DY+ L T   +GF    +P+ VLS+   +   TD +YT++
Sbjct: 19  SATQIAELNVLLQDVSSNLGDYMSLATTPGTGFTLDDMPAGVLSIGMALAGATDHSYTSM 78

Query: 78  FSELDFDAITKTIVKLPWYTTRLSSEI 104
           +SE+D   ++  + +LPWY++RL ++I
Sbjct: 79  YSEVDMAGVSSMLTQLPWYSSRLKAQI 105

>CAGL0F01485g complement(151321..152334) similar to sp|P10863
           Saccharomyces cerevisiae YER011w TIR1 or tr|Q12218
           Saccharomyces cerevisiae YOR009w, hypothetical start
          Length = 337

 Score = 68.6 bits (166), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 31/78 (39%), Positives = 52/78 (66%), Gaps = 4/78 (5%)

Query: 27  AELQAIIGDINSHLSDYLGLET-GNSGFQI---PSDVLSVYQQVMTYTDDAYTTLFSELD 82
           AEL A++ D+ ++L DY+ L    NSGF +   PS ++ +   V T TDD+YT+++S++D
Sbjct: 27  AELNAVMEDLKTNLQDYMNLAMDPNSGFSLADMPSGLIQLGMAVGTATDDSYTSMYSDVD 86

Query: 83  FDAITKTIVKLPWYTTRL 100
           F  + K +  +PWY++RL
Sbjct: 87  FAGVDKMVTMVPWYSSRL 104

>YOR009W (TIR4) [4824] chr15 (344334..345797) Member of the
           seripauperin (PAU) family of possible cell wall
           mannoproteins [1464 bp, 487 aa]
          Length = 487

 Score = 68.9 bits (167), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 57/86 (66%), Gaps = 5/86 (5%)

Query: 24  AETAELQAIIGDINSHLSDYLGLE-TGNSGF---QIPSDVLSVYQQ-VMTYTDDAYTTLF 78
           A+  EL  ++ D+ ++++DY+ L  T NSGF   Q+P+ ++ +  Q V   +DD+YTTL+
Sbjct: 22  AQINELNVVLDDVKTNIADYITLSYTPNSGFSLDQMPAGIMDIAAQLVANPSDDSYTTLY 81

Query: 79  SELDFDAITKTIVKLPWYTTRLSSEI 104
           SE+DF A+   +  +PWY++RL  E+
Sbjct: 82  SEVDFSAVEHMLTMVPWYSSRLLPEL 107

>CAGL0H09592g 937859..938569 highly similar to sp|P10863
           Saccharomyces cerevisiae YER011w TIR1 or sp|P33890
           Saccharomyces cerevisiae YOR010c TIR2, start by
           similarity
          Length = 236

 Score = 67.0 bits (162), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 32/81 (39%), Positives = 53/81 (65%), Gaps = 4/81 (4%)

Query: 28  ELQAIIGDINSHLSDYLGL-ETGNSGF---QIPSDVLSVYQQVMTYTDDAYTTLFSELDF 83
           EL  I+ D+ S+LS Y+ L +  +SG     +P+ VL++   + + TDD+YTTL+ ++DF
Sbjct: 27  ELNVILDDVKSNLSSYMSLVQDPSSGITLANLPAGVLNLGMALASATDDSYTTLYKDIDF 86

Query: 84  DAITKTIVKLPWYTTRLSSEI 104
           D I   + KLPWY+ RL+ ++
Sbjct: 87  DGIVPFLSKLPWYSERLAGKL 107

>CAGL0H09614g complement(939286..939996) highly similar to sp|P10863
           Saccharomyces cerevisiae YER011w TIR1 or sp|P33890
           Saccharomyces cerevisiae YOR010c TIR2, start by
           similarity
          Length = 236

 Score = 67.0 bits (162), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 32/81 (39%), Positives = 53/81 (65%), Gaps = 4/81 (4%)

Query: 28  ELQAIIGDINSHLSDYLGL-ETGNSGF---QIPSDVLSVYQQVMTYTDDAYTTLFSELDF 83
           EL  I+ D+ S+LS Y+ L +  +SG     +P+ VL++   + + TDD+YTTL+ ++DF
Sbjct: 27  ELNVILDDVKSNLSSYMSLVQDPSSGITLANLPAGVLNLGMALASATDDSYTTLYKDIDF 86

Query: 84  DAITKTIVKLPWYTTRLSSEI 104
           D I   + KLPWY+ RL+ ++
Sbjct: 87  DGIVPFLSKLPWYSERLAGKL 107

>YER011W (TIR1) [1434] chr5 (175247..176011) Stress-induced cell
           wall mannoprotein, member of the seripauperin (PAU)
           family [765 bp, 254 aa]
          Length = 254

 Score = 64.7 bits (156), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 50/77 (64%), Gaps = 4/77 (5%)

Query: 28  ELQAIIGDINSHLSDYLGL----ETGNSGFQIPSDVLSVYQQVMTYTDDAYTTLFSELDF 83
           EL  I+ D+ SHL +Y+ L     +G S   +P+ VL +   + + TDD+YTTL+SE+DF
Sbjct: 26  ELNVILNDVKSHLQEYISLASDSSSGFSLSSMPAGVLDIGMALASATDDSYTTLYSEVDF 85

Query: 84  DAITKTIVKLPWYTTRL 100
             ++K +  +PWY++RL
Sbjct: 86  AGVSKMLTMVPWYSSRL 102

>YOR010C (TIR2) [4825] chr15 complement(346194..346949) Cold-shock
           induced protein, member of the seripauperin (PAU) family
           [756 bp, 251 aa]
          Length = 251

 Score = 58.2 bits (139), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 54/84 (64%), Gaps = 4/84 (4%)

Query: 25  ETAELQAIIGDINSHLSDYLGL----ETGNSGFQIPSDVLSVYQQVMTYTDDAYTTLFSE 80
           E  EL  I+ D+ S+L +Y+ L     +G S   +PS VL +   + + TDD+YTTL+SE
Sbjct: 23  EIDELNVILNDVKSNLQEYISLAEDSSSGFSLSSLPSGVLDIGLALASATDDSYTTLYSE 82

Query: 81  LDFDAITKTIVKLPWYTTRLSSEI 104
           +DF A++K +  +PWY++RL  E+
Sbjct: 83  VDFAAVSKMLTMVPWYSSRLLPEL 106

>Scas_692.28d
          Length = 148

 Score = 49.7 bits (117), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 51/90 (56%), Gaps = 3/90 (3%)

Query: 11  SAIASLAVADTSAAETAELQAIIGDINSHLSDYLGLETGNSGFQIPSDVLSVYQQVMTYT 70
           +A+ +L+ +D +     EL   + DI SH+ DYL ++  N   + P D++     +  Y+
Sbjct: 19  NALTTLSASDETV-NLIELAVYVHDIKSHMLDYLKMQMANPSQKYP-DIIET-AVLHNYS 75

Query: 71  DDAYTTLFSELDFDAITKTIVKLPWYTTRL 100
           +D +TTLF ++D   +T  +  + WY+TRL
Sbjct: 76  NDDFTTLFLDIDGAEVTSMLTGVSWYSTRL 105

>YLL025W (YLL025W) [3394] chr12 (94746..95120) Protein with strong
           similarity to S. cerevisiae Yir041p, which is involved
           in phosphatidylinositol-3,4,5-triphosphate binding,
           member of the seripauperin and TIP1 family [375 bp, 124
           aa]
          Length = 124

 Score = 46.2 bits (108), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 28  ELQAIIGDINSHLSDYLGLETGNSGFQIPSDVLSVYQQVMTYTDDAYTTLFSELDFDAIT 87
           EL   + DI +HL++Y   +  +     P ++    + V  Y D  +TT+ + +  D +T
Sbjct: 38  ELGVYVSDIRAHLAEYYMFQAAHPTETYPVEIA---EAVFNYGD--FTTMLTGIPADQVT 92

Query: 88  KTIVKLPWYTTRLSSEI 104
           + I  +PWY+TRL   I
Sbjct: 93  RVITGVPWYSTRLRPAI 109

>YLR037C (DAN2) [3455] chr12 complement(222686..223060) Member of
           the seripauperin (PAU) family [375 bp, 124 aa]
          Length = 124

 Score = 45.8 bits (107), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 28  ELQAIIGDINSHLSDYLGLETGNSGFQIPSDVLSVYQQVMTYTDDAYTTLFSELDFDAIT 87
           EL   + DI +HL++Y   +  +     P ++    + V  Y D  +TT+ + +  D +T
Sbjct: 38  ELGVYVSDIRAHLAEYYMFQAAHPTETYPVEIA---EAVFNYGD--FTTMLTGIPADQVT 92

Query: 88  KTIVKLPWYTTRLSSEI 104
           + I  +PWY+TRL   I
Sbjct: 93  RVITGVPWYSTRLRPAI 109

>YFL020C (PAU5) [1663] chr6 complement(99225..99593) Member of the
           seripauperin (PAU) family [369 bp, 122 aa]
          Length = 122

 Score = 45.4 bits (106), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 28  ELQAIIGDINSHLSDYLGLETGNSGFQIPSDVLSVYQQVMTYTDDAYTTLFSELDFDAIT 87
           EL   + DI +HL++Y   +  +     P ++    + V  Y D  +TT+ + +  D +T
Sbjct: 37  ELGVYVSDIRAHLAEYYSFQAAHPTETYPVEIA---EAVFNYGD--FTTMLTGIPADQVT 91

Query: 88  KTIVKLPWYTTRLSSEI 104
           + I  +PWY++RL   I
Sbjct: 92  RVITGVPWYSSRLKPAI 108

>YOL161C (YOL161C) [4664] chr15 complement(11548..11910) Member of
           the seripauperin (PAU) family; subtelomerically-encoded
           [363 bp, 120 aa]
          Length = 120

 Score = 45.1 bits (105), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 28  ELQAIIGDINSHLSDYLGLETGNSGFQIPSDVLSVYQQVMTYTDDAYTTLFSELDFDAIT 87
           EL   + DI +HL+ Y   +  +     P +V    + V  Y D  +TT+ + +  D +T
Sbjct: 35  ELGVYVSDIRAHLAQYYMFQAAHPTETYPVEVA---EAVFNYGD--FTTMLTGISPDQVT 89

Query: 88  KTIVKLPWYTTRLSSEI 104
           + I  +PWY+TRL   I
Sbjct: 90  RMITGVPWYSTRLKPAI 106

>YNR076W (PAU6) [4659] chr14 (781915..782277) Protein with strong
           similarity to S. cerevisiae Pau5p, which is involved in
           phosphatidylinositol binding, member of the seripauperin
           and TIP1 family [363 bp, 120 aa]
          Length = 120

 Score = 44.7 bits (104), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 28  ELQAIIGDINSHLSDYLGLETGNSGFQIPSDVLSVYQQVMTYTDDAYTTLFSELDFDAIT 87
           EL   + DI +HL+ Y   +  +     P +V    + V  Y D  +TT+ + +  D +T
Sbjct: 35  ELGVYVSDIRAHLAQYYMFQAAHPTETYPVEVA---EAVFNYGD--FTTMLTGIAPDQVT 89

Query: 88  KTIVKLPWYTTRLSSEI 104
           + I  +PWY+TRL   I
Sbjct: 90  RMITGVPWYSTRLKPAI 106

>YLL064C (YLL064C) [3360] chr12 complement(13083..13445) Protein
           with strong similarity to S. cerevisiae Pau5p, which is
           a phosphatidylinositol binding protein, member of the
           seripauperin and TIP1 family [363 bp, 120 aa]
          Length = 120

 Score = 44.7 bits (104), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 28  ELQAIIGDINSHLSDYLGLETGNSGFQIPSDVLSVYQQVMTYTDDAYTTLFSELDFDAIT 87
           EL   + DI +HL+ Y   +  +     P +V    + V  Y D  +TT+ + +  D +T
Sbjct: 35  ELGVYVSDIRAHLAQYYMFQAAHPTETYPVEVA---EAVFNYGD--FTTMLTGIAPDQVT 89

Query: 88  KTIVKLPWYTTRLSSEI 104
           + I  +PWY+TRL   I
Sbjct: 90  RMITGVPWYSTRLKPAI 106

>YEL049W (PAU2) [1379] chr5 (63728..64090) Member of the
           seripauperin (PAU) family [363 bp, 120 aa]
          Length = 120

 Score = 44.3 bits (103), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 28  ELQAIIGDINSHLSDYLGLETGNSGFQIPSDVLSVYQQVMTYTDDAYTTLFSELDFDAIT 87
           EL   + DI +HL+ Y   +  +     P   + V + V  Y D  +TT+ + +  D +T
Sbjct: 35  ELGVYVSDIRAHLAQYYSFQAAHPTETYP---IEVAEAVFNYGD--FTTMLTGIAPDQVT 89

Query: 88  KTIVKLPWYTTRLSSEI 104
           + I  +PWY++RL   I
Sbjct: 90  RMITGVPWYSSRLKPAI 106

>Scas_692.19
          Length = 429

 Score = 45.8 bits (107), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 38/77 (49%)

Query: 28  ELQAIIGDINSHLSDYLGLETGNSGFQIPSDVLSVYQQVMTYTDDAYTTLFSELDFDAIT 87
           EL   + DI ++  DYL ++  N     P+++       +      +TTLFS +    + 
Sbjct: 3   ELMVYVKDIVAYRDDYLSMQKANPAMPYPAEMPRAVLAAIMGDKSKFTTLFSTIPATEVD 62

Query: 88  KTIVKLPWYTTRLSSEI 104
             +  +PWY+TRLSS I
Sbjct: 63  FMVTGVPWYSTRLSSLI 79

>YJL223C (PAU1) [2708] chr10 complement(8776..9138) Member of the
           seripauperin (PAU) family (PAU1 and YIL176C code for
           identical proteins) [363 bp, 120 aa]
          Length = 120

 Score = 43.9 bits (102), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 28  ELQAIIGDINSHLSDYLGLETGNSGFQIPSDVLSVYQQVMTYTDDAYTTLFSELDFDAIT 87
           EL   + DI +HL+ Y   +  +     P +V    + V  Y D  +TT+ + +  D +T
Sbjct: 35  ELGVYVSDIRAHLAQYYMFQAAHPTETYPVEVA---EAVFNYGD--FTTMLTGISPDQVT 89

Query: 88  KTIVKLPWYTTRLSSEI 104
           + I  +PWY++RL   I
Sbjct: 90  RMITGVPWYSSRLKPAI 106

>YIL176C (YIL176C) [2504] chr9 complement(8793..9155) Member of the
           seripauperin (PAU) family (PAU1 and YIL176C code for
           identical proteins) [363 bp, 120 aa]
          Length = 120

 Score = 43.9 bits (102), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 28  ELQAIIGDINSHLSDYLGLETGNSGFQIPSDVLSVYQQVMTYTDDAYTTLFSELDFDAIT 87
           EL   + DI +HL+ Y   +  +     P +V    + V  Y D  +TT+ + +  D +T
Sbjct: 35  ELGVYVSDIRAHLAQYYMFQAAHPTETYPVEVA---EAVFNYGD--FTTMLTGISPDQVT 89

Query: 88  KTIVKLPWYTTRLSSEI 104
           + I  +PWY++RL   I
Sbjct: 90  RMITGVPWYSSRLKPAI 106

>YIR041W (YIR041W) [2704] chr9 (433925..434299) Protein with strong
           similarity to S. cerevisiae Pau5p, which is involved in
           phosphatidylinositol binding, member of the seripauperin
           and TIP1 family [375 bp, 124 aa]
          Length = 124

 Score = 43.5 bits (101), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 28  ELQAIIGDINSHLSDYLGLETGNSGFQIPSDVLSVYQQVMTYTDDAYTTLFSELDFDAIT 87
           EL   + DI +HL+ Y   +  +     P ++    + V  Y D  +TT+ + +  + +T
Sbjct: 38  ELGVYVSDIRAHLAQYYLFQAAHPSETYPVEIA---EAVFNYGD--FTTMLTGIPAEQVT 92

Query: 88  KTIVKLPWYTTRLSSEI 104
           + I  +PWY+TRL   I
Sbjct: 93  RVITGVPWYSTRLRPAI 109

>YDR542W (YDR542W) [1351] chr4 (1523230..1523592) Protein with
           strong similarity to S. cerevisiae Pau5p, which binds
           phosphatidylinositol, member of the seripauperin and
           TIP1 family [363 bp, 120 aa]
          Length = 120

 Score = 43.5 bits (101), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 28  ELQAIIGDINSHLSDYLGLETGNSGFQIPSDVLSVYQQVMTYTDDAYTTLFSELDFDAIT 87
           EL   + DI +HL+ Y   +  +     P +V    + V  Y D  +TT+ + +  D +T
Sbjct: 35  ELGVYVSDIRAHLAQYYMFQAAHPTETYPVEVA---EAVFNYGD--FTTMLTGIAPDQVT 89

Query: 88  KTIVKLPWYTTRLSSEI 104
           + I  +PWY++RL   I
Sbjct: 90  RMITGVPWYSSRLKPAI 106

>YBR301W (DAN3) [477] chr2 (809013..809375) Protein with strong
           similarity to S. cerevisiae Pau5p, which is involved in
           phosphatidylinositiol binding, member of the
           seripauperin and TIP1 family [363 bp, 120 aa]
          Length = 120

 Score = 43.5 bits (101), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 28  ELQAIIGDINSHLSDYLGLETGNSGFQIPSDVLSVYQQVMTYTDDAYTTLFSELDFDAIT 87
           EL   + DI +HL+ Y   +  +     P ++    + V  Y D  +TT+ + +  D +T
Sbjct: 35  ELGVYVSDIRAHLAQYYSFQVAHPTETYPVEIA---EAVFNYGD--FTTMLTGIAPDQVT 89

Query: 88  KTIVKLPWYTTRLSSEI 104
           + I  +PWY++RL   I
Sbjct: 90  RMITGVPWYSSRLKPAI 106

>YGR294W (YGR294W) [2236] chr7 (1080311..1080673) Protein with
           strong similarity to S. cerevisiae Pau5p, which is
           involved in phosphatidylinositol binding, member of the
           seripauperin and TIP1 family [363 bp, 120 aa]
          Length = 120

 Score = 43.5 bits (101), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 28  ELQAIIGDINSHLSDYLGLETGNSGFQIPSDVLSVYQQVMTYTDDAYTTLFSELDFDAIT 87
           EL   + DI +HL+ Y   +  +     P ++    + V  Y D  +TT+ + +  D +T
Sbjct: 35  ELGVYVSDIRAHLAQYYSFQAAHPTETYPVEIA---EAVFNYGD--FTTMLTGIAPDQVT 89

Query: 88  KTIVKLPWYTTRLSSEI 104
           + I  +PWY++RL   I
Sbjct: 90  RMITGVPWYSSRLKPAI 106

>YKL224C (YKL224C) [3052] chr11 complement(1811..2182) Protein with
           very strong similarity to S. cerevisiae Yir041p, which
           is involved in phosphatidylinositol-3,4,5-triphosphate
           binding, member of the seripauperin and TIP1 family [372
           bp, 123 aa]
          Length = 123

 Score = 43.5 bits (101), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 28  ELQAIIGDINSHLSDYLGLETGNSGFQIPSDVLSVYQQVMTYTDDAYTTLFSELDFDAIT 87
           EL   + DI +HL+ Y   +  +     P ++    + V  Y D  +TT+ + +  + +T
Sbjct: 38  ELGVYVSDIRAHLAQYYLFQAAHPSETYPVEIA---EAVFNYGD--FTTMLTGIPAEQVT 92

Query: 88  KTIVKLPWYTTRLSSEI 104
           + I  +PWY+TRL   I
Sbjct: 93  RVITGVPWYSTRLRPAI 109

>Scas_614.12
          Length = 224

 Score = 44.7 bits (104), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 40/73 (54%), Gaps = 4/73 (5%)

Query: 28  ELQAIIGDINSHLSDYLGLETGNSGFQIPSDVLSVYQQVMTYTDDAYTTLFSELDFDAIT 87
           EL   + DI ++++DYL +   N     P+ + +    VM   DD +TT+ + +  D +T
Sbjct: 34  ELSVYVKDIRANMNDYLSMAKANPNQAYPAIIATA---VMGKGDD-FTTMLTGISGDEVT 89

Query: 88  KTIVKLPWYTTRL 100
             +  +PWY++RL
Sbjct: 90  MMLTGVPWYSSRL 102

>YLR461W (PAU4) [3834] chr12 (1062916..1063278) Member of the
           seripauperin (PAU) family [363 bp, 120 aa]
          Length = 120

 Score = 43.5 bits (101), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 28  ELQAIIGDINSHLSDYLGLETGNSGFQIPSDVLSVYQQVMTYTDDAYTTLFSELDFDAIT 87
           EL   + DI +HL+ Y   +  +     P +V    + V  Y D  +TT+ + +  D +T
Sbjct: 35  ELGVYVSDIRAHLAQYYMFQAAHPTETYPVEVA---EAVFNYGD--FTTMLTGIAPDQVT 89

Query: 88  KTIVKLPWYTTRLSSEI 104
           + I  +PWY++RL   I
Sbjct: 90  RMITGVPWYSSRLKPAI 106

>YGL261C (YGL261C) [1739] chr7 complement(6290..6652) Protein with
           strong similarity to S. cerevisiae Pau5p, which is
           involved in phosphatidylinositol binding, member of the
           seripauperin and TIP1 family [363 bp, 120 aa]
          Length = 120

 Score = 43.5 bits (101), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 28  ELQAIIGDINSHLSDYLGLETGNSGFQIPSDVLSVYQQVMTYTDDAYTTLFSELDFDAIT 87
           EL   + DI +HL+ Y   +  +     P +V    + V  Y D  +TT+ + +  D +T
Sbjct: 35  ELGVYVSDIRAHLAQYYMFQAAHPTETYPVEVA---EAVFNYGD--FTTMLTGIAPDQVT 89

Query: 88  KTIVKLPWYTTRLSSEI 104
           + I  +PWY++RL   I
Sbjct: 90  RMITGVPWYSSRLKPAI 106

>YAL068C (YAL068C) [1] chr1 complement(1807..2169) Protein possibly
           required for full induction of IME1 during early meiosis
           [363 bp, 120 aa]
          Length = 120

 Score = 43.5 bits (101), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 28  ELQAIIGDINSHLSDYLGLETGNSGFQIPSDVLSVYQQVMTYTDDAYTTLFSELDFDAIT 87
           EL   + DI +HL+ Y   +  +     P +V    + V  Y D  +TT+ + +  D +T
Sbjct: 35  ELGVYVSDIRAHLAQYYMFQAAHPTETYPVEVA---EAVFNYGD--FTTMLTGIAPDQVT 89

Query: 88  KTIVKLPWYTTRLSSEI 104
           + I  +PWY++RL   I
Sbjct: 90  RMITGVPWYSSRLKPAI 106

>YHL046C (YHL046C) [2243] chr8 complement(11921..12283) Member of
           the seripauperin (PAU) family [363 bp, 120 aa]
          Length = 120

 Score = 43.1 bits (100), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 28  ELQAIIGDINSHLSDYLGLETGNSGFQIPSDVLSVYQQVMTYTDDAYTTLFSELDFDAIT 87
           EL   + DI +HL+ Y   +  +     P +V    + V  Y D  +TT+ + +  D +T
Sbjct: 35  ELGVYVSDIRAHLAQYYMFQAAHPTETYPVEVA---EAVFNYGD--FTTMLTGIAPDQVT 89

Query: 88  KTIVKLPWYTTRLSSEI 104
           + I  +PWY++RL   I
Sbjct: 90  RMITGVPWYSSRLKPAI 106

>YMR325W (YMR325W) [4277] chr13 (922639..923013) Protein with very
           strong similarity to S. cerevisiae Yir041p, which binds
           phosphatidylinositol-3,4,5-triphosphate, member of the
           seripauperin and TIP1 family [375 bp, 124 aa]
          Length = 124

 Score = 43.1 bits (100), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 28  ELQAIIGDINSHLSDYLGLETGNSGFQIPSDVLSVYQQVMTYTDDAYTTLFSELDFDAIT 87
           EL   + DI +HL+ Y   +  +     P ++    + V  Y D  +TT+ + +  + +T
Sbjct: 38  ELGVYVSDIRAHLAQYYLFQAAHPTETYPVEIA---EAVFNYGD--FTTMLTGIPAEQVT 92

Query: 88  KTIVKLPWYTTRLSSEI 104
           + I  +PWY+TRL   I
Sbjct: 93  RVITGVPWYSTRLRPAI 109

>YCR104W (PAU3) [625] chr3 (307797..308171) Protein involved in the
           response to rapamycin, member of the seripauperin and
           TIP1 family, has very strong similarity to S. cerevisiae
           Yir041p [375 bp, 124 aa]
          Length = 124

 Score = 42.7 bits (99), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 28  ELQAIIGDINSHLSDYLGLETGNSGFQIPSDVLSVYQQVMTYTDDAYTTLFSELDFDAIT 87
           EL   + DI +HL+ Y   +  +     P ++    + V  Y D  +TT+ + +  + +T
Sbjct: 38  ELGVYVSDIRAHLAQYYLFQAAHPTETYPVEIA---EAVFNYGD--FTTMLTGIPAEQVT 92

Query: 88  KTIVKLPWYTTRLSSEI 104
           + I  +PWY+TRL   I
Sbjct: 93  RVITGVPWYSTRLRPAI 109

>YPL282C (YPL282C) [5169] chr16 complement(7933..8427) Protein with
           high similarity to S. cerevisiae Yir041wp, member of the
           seripauperin and TIP1 family [495 bp, 164 aa]
          Length = 164

 Score = 42.7 bits (99), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 28  ELQAIIGDINSHLSDYLGLETGNSGFQIPSDVLSVYQQVMTYTDDAYTTLFSELDFDAIT 87
           EL   + DI +HL+ Y   +  +     P ++    + V  Y D  +TT+ + +  + +T
Sbjct: 78  ELGVYVSDIRAHLAQYYLFQAAHPTETYPVEIA---EAVFNYGD--FTTMLTGIPAEQVT 132

Query: 88  KTIVKLPWYTTRLSSEI 104
           + I  +PWY+TRL   I
Sbjct: 133 RVITGVPWYSTRLRPAI 149

>YOR394W (YOR394W) [5166] chr15 (1082714..1083208) Protein with high
           similarity to S. cerevisiae Yir041p, which is involved
           in phosphatidylinositol-3,4,5-triphosphate binding,
           member of the seripauperin and TIP1 family [495 bp, 164
           aa]
          Length = 164

 Score = 42.7 bits (99), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 28  ELQAIIGDINSHLSDYLGLETGNSGFQIPSDVLSVYQQVMTYTDDAYTTLFSELDFDAIT 87
           EL   + DI +HL+ Y   +  +     P ++    + V  Y D  +TT+ + +  + +T
Sbjct: 78  ELGVYVSDIRAHLAQYYLFQAAHPTETYPVEIA---EAVFNYGD--FTTMLTGIPAEQVT 132

Query: 88  KTIVKLPWYTTRLSSEI 104
           + I  +PWY+TRL   I
Sbjct: 133 RVITGVPWYSTRLRPAI 149

>YJR150C (DAN1) [3041] chr10 complement(708726..709622) Cell wall
           mannoprotein induced during anaerobic growth, member of
           the seripauperin (PAU) family of possible cell wall
           mannoproteins [897 bp, 298 aa]
          Length = 298

 Score = 43.1 bits (100), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 37/77 (48%), Gaps = 5/77 (6%)

Query: 28  ELQAIIGDINSHLSDYLGLETGNSGFQIPSDVLSVYQQVMTYTDDAYTTLFSELDFDAIT 87
           EL   + DI +HLS+Y   +  +     P ++         +    +TT+ + +  D +T
Sbjct: 37  ELAVYVSDIGAHLSEYYAFQALHKTETYPPEIAKAV-----FAGGDFTTMLTGISGDEVT 91

Query: 88  KTIVKLPWYTTRLSSEI 104
           + I  +PWY+TRL   I
Sbjct: 92  RMITGVPWYSTRLMGAI 108

>CAGL0G10175g 977483..979216 some similarities with sp|P47179
           Saccharomyces cerevisiae YJR151c, hypothetical start
          Length = 577

 Score = 43.1 bits (100), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 34/73 (46%), Gaps = 7/73 (9%)

Query: 28  ELQAIIGDINSHLSDYLGLETGNSGFQIPSDVLSVYQQVMTYTDDAYTTLFSELDFDAIT 87
           ELQA + DI  H+  YL  +  N     PS +L     VM       T   SE+  + IT
Sbjct: 37  ELQAYLADIKGHMMQYLSFQGANPNQPYPSQMLGA---VMF----GNTGPLSEIAPETIT 89

Query: 88  KTIVKLPWYTTRL 100
             I  +PWY+ RL
Sbjct: 90  MMITGVPWYSERL 102

>CAGL0C00209g complement(11626..12939) some similarities with
           sp|P47179 Saccharomyces cerevisiae YJR151c, hypothetical
           start
          Length = 437

 Score = 40.4 bits (93), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 35/73 (47%), Gaps = 7/73 (9%)

Query: 28  ELQAIIGDINSHLSDYLGLETGNSGFQIPSDVLSVYQQVMTYTDDAYTTLFSELDFDAIT 87
           ELQA + DI  H+  YL  +  +     PS ++     VM       T+  SE+  + IT
Sbjct: 36  ELQAYLADIKGHMMQYLSFQGAHPDQPYPSQMIGA---VMF----GNTSPLSEIAPETIT 88

Query: 88  KTIVKLPWYTTRL 100
             I  +PWY+ RL
Sbjct: 89  MMITGVPWYSERL 101

>YJR151C (DAN4) [3042] chr10 complement(712170..715655) Member of
           the seripauperin (PAU) family of possible cell wall
           mannoproteins [3486 bp, 1161 aa]
          Length = 1161

 Score = 39.3 bits (90), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 37/77 (48%), Gaps = 5/77 (6%)

Query: 28  ELQAIIGDINSHLSDYLGLETGNSGFQIPSDVLSVYQQVMTYTDDAYTTLFSELDFDAIT 87
           EL   + DI +H+  Y      +     PS++ +    V  Y D  +TT  + +  D +T
Sbjct: 37  ELAVYVSDIRAHIFQYYSFRNHHKTETYPSEIAAA---VFDYGD--FTTRLTGISGDEVT 91

Query: 88  KTIVKLPWYTTRLSSEI 104
           + I  +PWY+TRL   I
Sbjct: 92  RMITGVPWYSTRLKPAI 108

>ADR019C [1760] [Homologous to ScYER011W (TIR1) - SH]
           (739207..739839) [633 bp, 210 aa]
          Length = 210

 Score = 34.3 bits (77), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 17/82 (20%), Positives = 36/82 (43%), Gaps = 5/82 (6%)

Query: 25  ETAELQAIIGDINSHLSDYLGLETGNSGFQIPSDVLSVYQQVM--TYTDDAYTTLFSELD 82
           E++ L  +  D  +H  DY+G          P  +   + +++   +  +A    +  +D
Sbjct: 24  ESSSLDVLFSDAQAHTQDYMGFFKPVGTHDPPRGLKEAFFKLLAGNFPTEAD---YEAID 80

Query: 83  FDAITKTIVKLPWYTTRLSSEI 104
           F+ +   +  LPWY  RL+  +
Sbjct: 81  FETVKNGVKDLPWYNDRLAKPL 102

>Scas_692.28*
          Length = 218

 Score = 33.9 bits (76), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 17/77 (22%), Positives = 37/77 (48%), Gaps = 5/77 (6%)

Query: 28  ELQAIIGDINSHLSDYLGLETGNSGFQIPSDVLSVYQQVMTYTDDAYTTLFSELDFDAIT 87
           EL   + DI ++L+DY  +   +     P  + S       + D  +TT+ + ++   +T
Sbjct: 35  ELAVYVNDIKANLNDYFAMAAAHPEQAYPDIIASA-----VFGDADFTTMLTGIEPAEVT 89

Query: 88  KTIVKLPWYTTRLSSEI 104
             +  + WY++R++  I
Sbjct: 90  SMLTGVAWYSSRIAPAI 106

>Scas_644.11
          Length = 272

 Score = 30.8 bits (68), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 41/89 (46%), Gaps = 6/89 (6%)

Query: 11  SAIASLAVADTSAAETAELQAIIGDINSHLSDYL-----GLETGNSGFQIPSDVLSVYQQ 65
           S + +L + D S    A    I+ +I   L D+      GL  G+ G+ IPS   + +  
Sbjct: 35  SFVNNLKITDFSFGAIAP-TIILKEITDPLPDFYESVNEGLVEGDEGWTIPSPSDTQFLI 93

Query: 66  VMTYTDDAYTTLFSELDFDAITKTIVKLP 94
            + Y  D + T+  EL  +  ++  +KLP
Sbjct: 94  EVEYKGDLFVTMSGELVLNYPSQEFIKLP 122

>Scas_676.30
          Length = 267

 Score = 28.1 bits (61), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 24/105 (22%), Positives = 44/105 (41%), Gaps = 14/105 (13%)

Query: 11  SAIASLAVADTSAAETAELQAIIGD-------INSHLSDYLGLETGNSGFQIPSDVLSVY 63
           S+I S+  +        +LQ    D        N HL+DY+ +  G SGF     ++S  
Sbjct: 38  SSIFSMDTSPLPPPNDTDLQKFTDDNLHFSMIRNLHLADYITMLNGFSGFY---SIISCL 94

Query: 64  QQVMT----YTDDAYTTLFSELDFDAITKTIVKLPWYTTRLSSEI 104
           +  +T    Y   A+  +F  + FD +   + +L    + +  E+
Sbjct: 95  RFTLTGKPHYVQRAHFFIFLGMCFDFLDGRVARLRHRASLMGQEL 139

>AGR050W [4360] [Homologous to ScYDR132C - SH; ScYLR108C - SH]
           complement(810195..811568) [1374 bp, 457 aa]
          Length = 457

 Score = 27.7 bits (60), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 26/48 (54%), Gaps = 1/48 (2%)

Query: 35  DINSHLSDYLGLETGNSGFQIPSDVLSVYQQVMTYTDDAYTTLFSELD 82
           D+  H S+Y     G + F+IP D+LS +     Y D A  +L++ L+
Sbjct: 115 DMLKH-SEYYYTCIGGTSFKIPKDLLSAHGNSPNYFDVAVDSLYTGLE 161

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.128    0.346 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 2,970,814
Number of extensions: 104705
Number of successful extensions: 381
Number of sequences better than 10.0: 53
Number of HSP's gapped: 362
Number of HSP's successfully gapped: 55
Length of query: 207
Length of database: 16,596,109
Length adjustment: 97
Effective length of query: 110
Effective length of database: 13,238,163
Effective search space: 1456197930
Effective search space used: 1456197930
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 59 (27.3 bits)