Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YBR065C (ECM2)36432917410.0
Scas_718.453763309361e-125
Sklu_2357.63643347563e-98
CAGL0L07458g3643377477e-97
Kwal_27.105503353217118e-92
AGR032W3312996291e-79
KLLA0F18502g3022832134e-19
YMR160W81681701.3
CAGL0B01947g43279672.2
KLLA0E07458g142131652.2
CAGL0M03861g14296624.2
CAGL0F00407g32277644.4
YOL127W (RPL25)14254615.9
Scas_635.214254615.9
ADL166W22397636.0
Sklu_2207.351984646.1
CAGL0J06732g98984646.2
Scas_716.7075370646.4
Sklu_2354.615054608.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YBR065C
         (358 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YBR065C (ECM2) [255] chr2 complement(368545..369639) Putative pr...   675   0.0  
Scas_718.45                                                           365   e-125
Sklu_2357.6 YBR065C, Contig c2357 7338-8432 reverse complement        295   3e-98
CAGL0L07458g complement(820608..821702) similar to sp|P38241 Sac...   292   7e-97
Kwal_27.10550                                                         278   8e-92
AGR032W [4342] [Homologous to ScYBR065C (ECM2) - SH] complement(...   246   1e-79
KLLA0F18502g complement(1699447..1700355) some similarities with...    87   4e-19
YMR160W (YMR160W) [4115] chr13 (575065..577515) Protein of unkno...    32   1.3  
CAGL0B01947g complement(179403..180701) weakly similar to sp|P26...    30   2.2  
KLLA0E07458g join(676406..676418,677034..677449) gi|1350700|sp|P...    30   2.2  
CAGL0M03861g join(complement(435566..435578),complement(434549.....    28   4.2  
CAGL0F00407g 41539..42507 highly similar to sp|P47120 Saccharomy...    29   4.4  
YOL127W (RPL25) [4696] chr15 (80347..80359,80774..81189) Ribosom...    28   5.9  
Scas_635.2                                                             28   5.9  
ADL166W [1575] [Homologous to ScYOL127W (RPL25) - SH] complement...    29   6.0  
Sklu_2207.3 YKR023W, Contig c2207 4957-6516                            29   6.1  
CAGL0J06732g complement(643534..646503) similar to sp|Q03758 Sac...    29   6.2  
Scas_716.70                                                            29   6.4  
Sklu_2354.6 YOL127W, Contig c2354 8285-8737                            28   8.7  

>YBR065C (ECM2) [255] chr2 complement(368545..369639) Putative
           pre-mRNA splicing factor, also involved in cell wall
           structure or biosynthesis [1095 bp, 364 aa]
          Length = 364

 Score =  675 bits (1741), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/329 (100%), Positives = 329/329 (100%)

Query: 1   MNDEINEPPPNICEQCLGDEANIRMTKIPQGSECKICTLPFTLYHFKTSKRSNNIIKTLI 60
           MNDEINEPPPNICEQCLGDEANIRMTKIPQGSECKICTLPFTLYHFKTSKRSNNIIKTLI
Sbjct: 1   MNDEINEPPPNICEQCLGDEANIRMTKIPQGSECKICTLPFTLYHFKTSKRSNNIIKTLI 60

Query: 61  CVRCATQRNICQCCMLDSRWHIPIQLRDHLISLVNEENVMTEEAKNDMMKRFLSLKNVKL 120
           CVRCATQRNICQCCMLDSRWHIPIQLRDHLISLVNEENVMTEEAKNDMMKRFLSLKNVKL
Sbjct: 61  CVRCATQRNICQCCMLDSRWHIPIQLRDHLISLVNEENVMTEEAKNDMMKRFLSLKNVKL 120

Query: 121 GGAQITSDPSEADNIVDKLKNILLRATSDGPSTPLIKNTTALYKNEKGANEVKNLEKYAS 180
           GGAQITSDPSEADNIVDKLKNILLRATSDGPSTPLIKNTTALYKNEKGANEVKNLEKYAS
Sbjct: 121 GGAQITSDPSEADNIVDKLKNILLRATSDGPSTPLIKNTTALYKNEKGANEVKNLEKYAS 180

Query: 181 VDISHILKKLPLNESFLKNPSTKSFFLYNIDASIPEWKITDTVSQLLGIKKWKDGNSLSL 240
           VDISHILKKLPLNESFLKNPSTKSFFLYNIDASIPEWKITDTVSQLLGIKKWKDGNSLSL
Sbjct: 181 VDISHILKKLPLNESFLKNPSTKSFFLYNIDASIPEWKITDTVSQLLGIKKWKDGNSLSL 240

Query: 241 IVNHKAKCGGLRFQSSELGERFVSKISETLVTPKGLKRGVLLIDRFRIFIIPWSSGFSAA 300
           IVNHKAKCGGLRFQSSELGERFVSKISETLVTPKGLKRGVLLIDRFRIFIIPWSSGFSAA
Sbjct: 241 IVNHKAKCGGLRFQSSELGERFVSKISETLVTPKGLKRGVLLIDRFRIFIIPWSSGFSAA 300

Query: 301 SFGTNTAENIKLSLSLNKLIQLELGLSFP 329
           SFGTNTAENIKLSLSLNKLIQLELGLSFP
Sbjct: 301 SFGTNTAENIKLSLSLNKLIQLELGLSFP 329

>Scas_718.45
          Length = 376

 Score =  365 bits (936), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 188/330 (56%), Positives = 242/330 (73%), Gaps = 9/330 (2%)

Query: 4   EINEPPPNICEQCLGDEANIRMTKIPQGSECKICTLPFTLYHFKTSKRSNNIIKTLICVR 63
           + +  PP+IC+ CLGD  NIR+TK+P G++CKICT+ FT YHFK  +RS+N+ KTLIC+R
Sbjct: 5   DYDSQPPSICDVCLGDSPNIRLTKLPNGAQCKICTMTFTSYHFKQQERSSNLTKTLICLR 64

Query: 64  CATQRNICQCCMLDSRWHIPIQLRDHLISLVNEENVM-TEEAKNDMMKRFLSLKNVKLGG 122
           CATQRN+CQCCMLD  WHIP+QLRD ++SLVN++  M T+EAKND+MKRFL+LK+ KLGG
Sbjct: 65  CATQRNVCQCCMLDMTWHIPVQLRDSIVSLVNQDKSMITKEAKNDIMKRFLALKDGKLGG 124

Query: 123 AQITSDPSEADNIVDKLKNILLRATSDGPSTPLIKNTTALYKNEKGANEVKNLEKYASVD 182
           AQ+TSD  + D ++ KLK+ILL+  S      + K T A+   +   +   +  K   +D
Sbjct: 125 AQVTSDSKQTDELMQKLKDILLQNNS---KENIHKKTEAISSGDSSNSTRLDNSKLKGID 181

Query: 183 ISHILKKLPLNESFLK-NPSTKSFFLYNIDASIPEWKITDTVSQLLGIKKWKDGNSLSLI 241
           ISHI++KLPL ESFL    S KSFFLYNID SIPEWK++D +S ++G K WKD  SLSLI
Sbjct: 182 ISHIIRKLPLRESFLDTTASVKSFFLYNIDPSIPEWKVSDQISNIVGTKDWKDPTSLSLI 241

Query: 242 VNHKAKCGGLRFQSSELGERFVSKISETLVTPKG----LKRGVLLIDRFRIFIIPWSSGF 297
           + HKAKCGG+RF+S ELG +FV  +  +    K     ++RG+L ID F+IF IPW SGF
Sbjct: 242 IIHKAKCGGVRFKSEELGSKFVKNMLASGSFMKSNDGKVQRGILKIDHFQIFAIPWRSGF 301

Query: 298 SAASFGTNTAENIKLSLSLNKLIQLELGLS 327
           S +SFG N  ENIKLSLS+NKLIQLE G S
Sbjct: 302 SGSSFGGNVNENIKLSLSMNKLIQLENGAS 331

>Sklu_2357.6 YBR065C, Contig c2357 7338-8432 reverse complement
          Length = 364

 Score =  295 bits (756), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 155/334 (46%), Positives = 218/334 (65%), Gaps = 24/334 (7%)

Query: 5   INEPPPNICEQCLG-DEANIRMTKIPQGSECKICTLPFTLYHFKTSKRSNNIIKTLICVR 63
           +++  P ICE CL  D   IRMTK P G+ CKICTLPFTL++FK      ++ KTLIC+ 
Sbjct: 1   MSDQHPAICESCLSRDSKFIRMTKAPDGATCKICTLPFTLFYFKLPGH-RHLTKTLICLN 59

Query: 64  CATQRNICQCCMLDSRWHIPIQLRDHLISLVNEENVMTEEAKNDMMKRFLSLKN---VKL 120
           C+ QRNICQCC+LD  WH+P  +RD ++S++N+  V+TEEA N+M+KRF+ LK+    K+
Sbjct: 60  CSKQRNICQCCLLDLSWHVPTNVRDQILSMLNDSAVVTEEASNEMVKRFIGLKDGDSFKM 119

Query: 121 GGAQITSDPSEADNIVDKLKNILLRATSDG--PST-----PLIKNTTALYKNEKGANEVK 173
           GGA +TSD      ++ KL+NIL  +TS G  P+T     PL    T + K++    E  
Sbjct: 120 GGASVTSDYDSNQQVMLKLQNILNASTSQGTSPATAGEPDPLNDVATLVTKDKHDKRE-- 177

Query: 174 NLEKYASVDISHILKKLPLNESFLKNPSTKSFFLYNIDASIPEWKITDTVSQLLGIKKWK 233
              KYA++DISHILK+LPL  S  K  ST+SFFLYNID  IPEW I + +S ++   +W+
Sbjct: 178 ---KYANLDISHILKRLPLKGSIDKGDSTRSFFLYNIDPGIPEWSIVEKISSMVETTQWQ 234

Query: 234 DGNSLSLIVNHKAKCGGLRFQSSELGERFVSKISETLVTPKGLKRGVLLIDRFRIFIIPW 293
           D  + S+I+NH AKCGG+RF+S++L  RF++++       K   +GVL +   RI ++ W
Sbjct: 235 DRETTSVIINHTAKCGGIRFKSADLANRFITQLE------KNGSKGVLAVRNCRIHVVKW 288

Query: 294 SSGFSAASFGTNTAENIKLSLSLNKLIQLELGLS 327
           SS  S A FG   AE +KL LSL+KL+Q ++  S
Sbjct: 289 SSMHSGA-FGDKYAEFVKLGLSLDKLVQKDVSPS 321

>CAGL0L07458g complement(820608..821702) similar to sp|P38241
           Saccharomyces cerevisiae YBR065c ECM2, start by
           similarity
          Length = 364

 Score =  292 bits (747), Expect = 7e-97,   Method: Compositional matrix adjust.
 Identities = 155/337 (45%), Positives = 209/337 (62%), Gaps = 30/337 (8%)

Query: 7   EPPPNICEQCLGDE---ANIRMTKIPQGSECKICTLPFTLYHFKTSKRSNNIIKTLICVR 63
           E  P ICE+CLG      NIRM ++P G+ CKICTLP+TLYHFK S RS +IIKTLIC +
Sbjct: 9   EEVPQICEKCLGTSNTNENIRMNEVPNGAACKICTLPYTLYHFKKSHRSADIIKTLICKK 68

Query: 64  CATQRNICQCCMLDSRWHIPIQLRDHLISLVNEENVMTEEAKNDMMKRFLSLKNVKLGGA 123
           CA QRN+CQCCMLD + HI IQLRD L+S+V+ +  +TEEAKN MMK+F+++K   LG A
Sbjct: 69  CAIQRNVCQCCMLDMKLHISIQLRDKLMSIVSGKETITEEAKNIMMKKFIAMKGGSLGSA 128

Query: 124 QITSDPSEADNIVDKLKNILLRATSDGPSTPLIKNT---TALYKNEKGANEVKNLEKYAS 180
            +T +       VD +++ILL         PL       +AL   E G N         S
Sbjct: 129 DLTRN-------VDSIEDILLNLREKLEGKPLNDENEPISALQNKELGDN-----PHLKS 176

Query: 181 VDISHILKKLPLNESFLK-------NPSTKSFFLYNIDASIPEWKITDTVSQLLGIKKWK 233
           VDI     K PL E+F         N S KSFF+YNID+S+PEWKI+D +++LLG   WK
Sbjct: 177 VDIQPYWDKFPLQETFPNAIQIPKGNDSFKSFFIYNIDSSVPEWKISDKITELLGSDSWK 236

Query: 234 DGNSLSLIVNHKAKCGGLRFQSSELGERFVSKISET-----LVTPKGLKRGVLLIDRFRI 288
              S+ +I+NHKA CG  R  ++EL E+F+  I+ +     +    GL+RG+L +D F++
Sbjct: 237 TKESIPIIINHKAMCGAFRIGNNELSEKFLQTINNSDNMIRINRSNGLRRGILKVDHFQL 296

Query: 289 FIIPWSSGFSAASFGTNTAENIKLSLSLNKLIQLELG 325
           FIIPW  GFS  SFG    E+ K++ +L ++I  E+G
Sbjct: 297 FIIPWKQGFSVESFGRTPNESKKIAFALREIIVEEMG 333

>Kwal_27.10550
          Length = 335

 Score =  278 bits (711), Expect = 8e-92,   Method: Compositional matrix adjust.
 Identities = 142/321 (44%), Positives = 208/321 (64%), Gaps = 25/321 (7%)

Query: 10  PNICEQCLGDEANIRMTKIPQGSECKICTLPFTLYHFKTSKRSNNIIKTLICVRCATQRN 69
           P ICE CLGD+   R+T+   G+ECKICTL FT+YHFKT  + N   +T+IC  C+ QRN
Sbjct: 3   PAICEACLGDQT--RLTRAVNGAECKICTLAFTVYHFKTHHKVN---RTVICHNCSKQRN 57

Query: 70  ICQCCMLDSRWHIPIQLRDHLISLVNEENVMTEEAKNDMMKRFLSLKN---VKLGGAQIT 126
           ICQCC+LD +WHIP++LRD ++SL+    V TEEA+NDMMKRF++LK+    K+GGA++T
Sbjct: 58  ICQCCLLDLQWHIPVELRDRVLSLIQGSEVATEEAQNDMMKRFIALKDGSTYKVGGAKVT 117

Query: 127 SDPSEADNIVDKLKNILLRATSDGPSTPLIKNTTALYKNEKGANEVKNLEKYASVDISHI 186
           SD S   ++++++++  L+A  D        N+ A  K+   A      +    VDISH+
Sbjct: 118 SDASATADVIERIRDT-LQAVEDKD------NSNANVKSAAIAP-----QSVTEVDISHL 165

Query: 187 LKKLPLNESFLKNPSTKSFFLYNIDASIPEWKITDTVSQLLGIKKWKDGNSLSLIVNHKA 246
           LKKLPL  S  +     +FFLYNID ++PEW + D +S+++    W++  S S+ +NH A
Sbjct: 166 LKKLPLKGSLSEGT---AFFLYNIDPALPEWAVVDAISEVVETPSWQEPVSASVAINHTA 222

Query: 247 KCGGLRFQSSELGERFVSKISETLVTPKGLKRGVLLIDRFRIFIIPWSSGFSAASFGTNT 306
           +CGG+RF+++EL ++F   I ET     GL +G LL+   R+ ++ W   F  A+ GT  
Sbjct: 223 RCGGIRFKNAELAQKFRDSI-ETFKAESGLIKGKLLVQNSRVHVVSWPQ-FHRAALGTKN 280

Query: 307 AENIKLSLSLNKLIQLELGLS 327
           AE  KL+LSL+KL+Q +L  S
Sbjct: 281 AECRKLALSLDKLVQKDLTAS 301

>AGR032W [4342] [Homologous to ScYBR065C (ECM2) - SH]
           complement(770660..771655) [996 bp, 331 aa]
          Length = 331

 Score =  246 bits (629), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 119/299 (39%), Positives = 180/299 (60%), Gaps = 28/299 (9%)

Query: 5   INEPPPNICEQCLGDEANIRMTKIPQGSECKICTLPFTLYHFKTSKRSNNIIKTLICVRC 64
           ++E  P+ICEQCL D A++RMT+  +G+ECKICTLPFTLYHFK    +  + KTL+C RC
Sbjct: 1   MDEETPSICEQCLTD-ADLRMTRAARGAECKICTLPFTLYHFKPPG-APRVTKTLVCRRC 58

Query: 65  ATQRNICQCCMLDSRWHIPIQLRDHLISLVNEENVMTEEAKNDMMKRFLSLKNVKLGGAQ 124
           A QRN+CQCCMLD  W +P+ LRD L+SLV   +  T EA N+M++RFL+L+  +LGGA+
Sbjct: 59  AAQRNVCQCCMLDLAWKLPVALRDELVSLVQGSDERTPEASNEMVRRFLALRGGQLGGAR 118

Query: 125 ITSDPSEADNIVDKLKNILLRATSDGPSTPLIKNTTALYKNEKGANEVKNLEKYASVDIS 184
           +T+D +    ++ K++ +                    +   + A EV            
Sbjct: 119 LTADSAPLRELMGKMRAVAA----------AAAPAARAHGGREDAGEVPE---------- 158

Query: 185 HILKKLPLNESFLKNPSTKSFFLYNIDASIPEWKITDTVSQLLGIKKWKDGNSLSLIVNH 244
               +LP   + L  P+++SFF+Y +D ++PEW++ D VSQL+    W+D  S+S++V  
Sbjct: 159 ---TQLPFGGA-LATPASRSFFIYGVDPALPEWELVDAVSQLVRTPDWRDAGSVSVVVRQ 214

Query: 245 KAKCGGLRFQSSELGERFVSKISETLVTPKGLKRGVLLIDRFRIFIIPWSSGFSAASFG 303
            A+C G+RF+  EL + FV+++ ETL    G  +GVL I   R+ ++ W   F  A+FG
Sbjct: 215 DARCAGIRFRREELAQAFVARL-ETLPAAAGAPKGVLRIRHLRMHVVAWPE-FHLAAFG 271

>KLLA0F18502g complement(1699447..1700355) some similarities with
           sp|P38241 Saccharomyces cerevisiae YBR065c ECM2 involved
           in cell wall biogenesis and architecture singleton,
           hypothetical start
          Length = 302

 Score = 86.7 bits (213), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 82/283 (28%), Positives = 130/283 (45%), Gaps = 62/283 (21%)

Query: 12  ICEQCLG-DEANIRMTKIPQGSECKICTLPFTLYHFKTSKRSNNIIKTLICVRCATQRNI 70
           ICE+CL   E    + + P G ECK CT PF  Y +  +  +     T+ C +CAT+  I
Sbjct: 10  ICERCLPLGENTPTLIRYPNGRECKFCTFPFDSYSYTINHTT---FHTICCPKCATKNLI 66

Query: 71  CQCCMLDSRWHIPIQLRDHLISLVNEENVMTEEAKNDMMKRFLSLKNVKLGGAQITSDPS 130
           CQ C+ D    IP+ LR+ +  L+N EN  +   KNDMMKRF+ L + ++    I     
Sbjct: 67  CQVCLNDFEHGIPMHLRNSMKQLLN-ENADSVIPKNDMMKRFIGLSSKQVAPLNI----- 120

Query: 131 EADNIVDKLKNILLRATSDGPSTPLIKNTTALYKNEKGANEVKNLEKYASVDISHILKKL 190
                 DKLK                              + +++ K+        +++L
Sbjct: 121 ------DKLK------------------------------QAESIRKWR-------VREL 137

Query: 191 PLNESFLKNPSTKSFFLYNIDASIPEWKITDTVSQLL-GIKKWKDGNSLSLIVNHKAKCG 249
           P N +   N +  +FFLYNID ++ E +I   VSQL+       +  + SL +N K +  
Sbjct: 138 PFNSNV--NDTKDTFFLYNIDPNLTESQI---VSQLIVATNNNLERENTSLKLNSKLRIA 192

Query: 250 GLRF-QSSEL-GERFVSKISETLVTPKGLKRGVLLIDRFRIFI 290
            L F Q  +L  ++ +S + +  V P  +++  LL+   RI I
Sbjct: 193 TLTFKQDPDLWTQKLISILPKFKVGP-TVEKCYLLMKGNRIHI 234

>YMR160W (YMR160W) [4115] chr13 (575065..577515) Protein of unknown
           function [2451 bp, 816 aa]
          Length = 816

 Score = 31.6 bits (70), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 37/81 (45%), Gaps = 16/81 (19%)

Query: 163 YKNEKGANEVKNLEKYASV-DISHILKKLPLNESFLKNPSTKSFFLYNIDASIPE----- 216
           Y+NEK ++ V+    Y+ + D   + K    N  F KNP ++     NID   P      
Sbjct: 653 YQNEKSSDFVR---IYSDIYDDDKVYKCFLYNTIFTKNPLSRKHLRLNIDLDTPTSILNT 709

Query: 217 -------WKITDTVSQLLGIK 230
                  WKI D+ S+L+ +K
Sbjct: 710 VNQYDLVWKIHDSFSKLIQLK 730

>CAGL0B01947g complement(179403..180701) weakly similar to sp|P26798
           Saccharomyces cerevisiae YDR123c INO2, hypothetical
           start
          Length = 432

 Score = 30.4 bits (67), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 39/79 (49%), Gaps = 13/79 (16%)

Query: 160 TALYKNEKGANEVKNLEKYASVDIS--HILKKLPLNESFLKNPSTKSFFLYNI---DASI 214
           + L+KN   ++ V N E Y + D++  H +KK+P+ + +     TK+  L  I   D  I
Sbjct: 299 STLHKNSNSSDIVHNREDYKNTDLTTNHKIKKIPVPKDY----PTKNIELPGIVISDDDI 354

Query: 215 PEWKITDTVSQLLGIKKWK 233
           P     D    +  ++KWK
Sbjct: 355 P----ADIRHDMAKVRKWK 369

>KLLA0E07458g join(676406..676418,677034..677449)
           gi|1350700|sp|P48045|RL25_KLULA Kluyveromyces lactis 60S
           RIBOSOMAL PROTEIN L25 (INTRON), start by similarity
          Length = 142

 Score = 29.6 bits (65), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 37/131 (28%), Positives = 59/131 (45%), Gaps = 12/131 (9%)

Query: 154 PLIKNTTALYKNEKGANEVKNLEKYASVDISHILKKLPLNESFLKNP--STKSFFLYNID 211
           P  K T A     KG N  K L+   S        +LP      ++P  +TK+   YN  
Sbjct: 3   PSTKATAAKKAVVKGTNGKKALKVRTSASF-----RLPKTLKLARSPKYATKAVPHYN-- 55

Query: 212 ASIPEWKITDT-VSQLLGIKKWKDGNSLSLIVNHKAKCGGLRFQSSELGERFVSKISETL 270
             +  +K+ +  ++    +KK +DGN+L   V+ KA    ++    EL E  V  ++ TL
Sbjct: 56  -RLDSYKVIEQPITSETAMKKVEDGNTLVFKVSLKANKYQIKKAVKELYEVDVLSVN-TL 113

Query: 271 VTPKGLKRGVL 281
           V P G K+  +
Sbjct: 114 VRPNGTKKAYV 124

>CAGL0M03861g
           join(complement(435566..435578),
           complement(434549..434964)) highly similar to sp|P04456
           Saccharomyces cerevisiae YOL127w RPL25
          Length = 142

 Score = 28.5 bits (62), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 49/96 (51%), Gaps = 7/96 (7%)

Query: 189 KLPLNESFLKNP--STKSFFLYNIDASIPEWKITDT-VSQLLGIKKWKDGNSLSLIVNHK 245
           +LP      ++P  ++KS   YN    +  +K+ +  ++    +KK +DGN L   V+ K
Sbjct: 33  RLPKTLKLARSPKYASKSVPHYN---RLDSYKVIEHPITSETAMKKVEDGNILVFQVSLK 89

Query: 246 AKCGGLRFQSSELGERFVSKISETLVTPKGLKRGVL 281
           A    ++    EL E  V K++ TL+T KG K+  +
Sbjct: 90  ANKHQIKKAVKELYEVDVMKVN-TLITAKGNKKAFV 124

>CAGL0F00407g 41539..42507 highly similar to sp|P47120 Saccharomyces
           cerevisiae YJR070c, start by similarity
          Length = 322

 Score = 29.3 bits (64), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 38/77 (49%), Gaps = 15/77 (19%)

Query: 85  QLRDHLISLVNEENVMTEEAKNDMMKRFLSLKNVKLGGAQITSDPSEADNIVDKLKNILL 144
           QLRD L++         +E K+ +  RF +L N+K   ++  ++PS+A+  V  +     
Sbjct: 20  QLRDILVN---------KEGKSALANRFRALFNLKTAASEFEANPSDAEKAVQYMGETF- 69

Query: 145 RATSDGPSTPLIKNTTA 161
                G ++ L+K+  A
Sbjct: 70  -----GDNSELLKHEVA 81

>YOL127W (RPL25) [4696] chr15 (80347..80359,80774..81189) Ribosomal
           protein L25 (YL25; rp61L; E. coli L23; rat L23a),
           required for efficient pre-rRNA processing, including
           early cleavage steps and processing of internal
           transcribed spacer 2 (ITS2) [429 bp, 142 aa]
          Length = 142

 Score = 28.1 bits (61), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 29/54 (53%), Gaps = 1/54 (1%)

Query: 228 GIKKWKDGNSLSLIVNHKAKCGGLRFQSSELGERFVSKISETLVTPKGLKRGVL 281
            +KK +DGN L   V+ KA    ++    EL E  V K++ TLV P G K+  +
Sbjct: 72  AMKKVEDGNILVFQVSMKANKYQIKKAVKELYEVDVLKVN-TLVRPNGTKKAYV 124

>Scas_635.2
          Length = 142

 Score = 28.1 bits (61), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 29/54 (53%), Gaps = 1/54 (1%)

Query: 228 GIKKWKDGNSLSLIVNHKAKCGGLRFQSSELGERFVSKISETLVTPKGLKRGVL 281
            +KK +DGN+L   V+ KA    ++    EL E  V  ++ TLV P G K+  +
Sbjct: 72  AMKKVEDGNTLVFQVSMKANKHQIKKAVKELYEVDVLSVN-TLVRPNGTKKAYV 124

>ADL166W [1575] [Homologous to ScYOL127W (RPL25) - SH]
           complement(400582..400837,401061..401476) [672 bp, 223
           aa]
          Length = 223

 Score = 28.9 bits (63), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 50/97 (51%), Gaps = 9/97 (9%)

Query: 189 KLPLNESFLKNP--STKSFFLYN-IDASIPEWKITDT-VSQLLGIKKWKDGNSLSLIVNH 244
           +LP      ++P  S+KS   YN +DA    +K+ +  ++    +KK +DGN+L   V+ 
Sbjct: 114 RLPKTLKLARSPKYSSKSVPHYNRLDA----YKVIEKPINSETAMKKVEDGNTLVFQVSL 169

Query: 245 KAKCGGLRFQSSELGERFVSKISETLVTPKGLKRGVL 281
           KA    ++    EL E  V  ++ TLV P G K+  +
Sbjct: 170 KANKHQIKKAVKELYEVDVLAVN-TLVRPNGTKKAYV 205

>Sklu_2207.3 YKR023W, Contig c2207 4957-6516
          Length = 519

 Score = 29.3 bits (64), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 37/84 (44%), Gaps = 11/84 (13%)

Query: 59  LICVRCATQRNICQCCMLDSRWHIPIQLRDHLISLVNEE-----NVMTEEAKNDMMKRFL 113
           +IC+R     N C  C       IPI+ R  +I ++N E     +  TEE K   MK+  
Sbjct: 197 IICIREGLHLNNCTFC---GEELIPIEERMKIIQVLNREKATLQDTKTEENKPKEMKKTK 253

Query: 114 SLKNVKLGGAQITSDPSEADNIVD 137
           + K    GG  +    SE D + D
Sbjct: 254 TYKIQSGGGTNLF---SEQDKLFD 274

>CAGL0J06732g complement(643534..646503) similar to sp|Q03758
           Saccharomyces cerevisiae YML111w BUL2 or sp|P48524
           Saccharomyces cerevisiae YMR275c BUL1, hypothetical
           start
          Length = 989

 Score = 29.3 bits (64), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 35/84 (41%), Gaps = 15/84 (17%)

Query: 179 ASVDISHILKKLPLNESFLKNPSTKSFFLYNIDASIPEWKITDTVSQ----------LLG 228
             VD    +  L  + +FL     K +F++     IP+  +  T  Q           LG
Sbjct: 378 GDVDFDDSILGLSNSRTFLPKTKYKKYFMF----KIPDQLLDVTCRQEIFPHCSLPPSLG 433

Query: 229 IKKWKDGNSLSLI-VNHKAKCGGL 251
           I KWKD    S+I VN+   CG L
Sbjct: 434 IDKWKDNGKYSIIKVNNVLGCGHL 457

>Scas_716.70
          Length = 753

 Score = 29.3 bits (64), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 30/70 (42%), Gaps = 1/70 (1%)

Query: 88  DHLISLVNEENVMTEEAKNDMMKRFLSLKNVKLG-GAQITSDPSEADNIVDKLKNILLRA 146
           DH I  + EENV +++ +ND  +   S+   KL    Q+     E D  VD         
Sbjct: 29  DHTIDEIGEENVQSDQEENDTKEDTSSVNMKKLRYDLQVDDSKEEKDGAVDTTSESDEST 88

Query: 147 TSDGPSTPLI 156
           +  G S P I
Sbjct: 89  SKIGLSKPFI 98

>Sklu_2354.6 YOL127W, Contig c2354 8285-8737
          Length = 150

 Score = 27.7 bits (60), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 29/54 (53%), Gaps = 1/54 (1%)

Query: 228 GIKKWKDGNSLSLIVNHKAKCGGLRFQSSELGERFVSKISETLVTPKGLKRGVL 281
            +KK +DGN+L   V+ KA    ++    EL E  V  ++ TLV P G K+  +
Sbjct: 80  AMKKVEDGNTLVFQVSLKANKYQIKSAVKELYEVDVLSVN-TLVRPNGTKKAYV 132

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.134    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 10,976,138
Number of extensions: 467152
Number of successful extensions: 1582
Number of sequences better than 10.0: 38
Number of HSP's gapped: 1594
Number of HSP's successfully gapped: 39
Length of query: 358
Length of database: 16,596,109
Length adjustment: 103
Effective length of query: 255
Effective length of database: 13,030,455
Effective search space: 3322766025
Effective search space used: 3322766025
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 62 (28.5 bits)