Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YBR063C40439820980.0
Kwal_26.805963159701.3
Kwal_55.1964067861673.1
Scas_695.31245966673.7
Scas_643.1450793664.2
Kwal_26.7891310153645.0
YKR021W91562655.1
YJL125C (GCD14)38350646.0
Sklu_1809.266847638.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YBR063C
         (398 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YBR063C (YBR063C) [254] chr2 complement(366931..368145) Protein ...   812   0.0  
Kwal_26.8059                                                           32   1.3  
Kwal_55.19640                                                          30   3.1  
Scas_695.31                                                            30   3.7  
Scas_643.14                                                            30   4.2  
Kwal_26.7891                                                           29   5.0  
YKR021W (YKR021W) [3276] chr11 (478877..481624) Protein containi...    30   5.1  
YJL125C (GCD14) [2794] chr10 complement(185447..186598) Protein ...    29   6.0  
Sklu_1809.2 YDR194C, Contig c1809 1564-3570 reverse complement         29   8.6  

>YBR063C (YBR063C) [254] chr2 complement(366931..368145) Protein
           with similarity to phosphopanthethein-binding proteins
           [1215 bp, 404 aa]
          Length = 404

 Score =  812 bits (2098), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/398 (100%), Positives = 398/398 (100%)

Query: 1   MEELGLKSTFPYEYGSDFTMIRTEMLNTTKSETTILFSNIKSILAIIWKYSFTFLRSFSD 60
           MEELGLKSTFPYEYGSDFTMIRTEMLNTTKSETTILFSNIKSILAIIWKYSFTFLRSFSD
Sbjct: 1   MEELGLKSTFPYEYGSDFTMIRTEMLNTTKSETTILFSNIKSILAIIWKYSFTFLRSFSD 60

Query: 61  SIKLIIDDVVTIGSRNFAERLQIEAKKNNDQEDIWASTIILGVIIGYLISSIKRKNTFPI 120
           SIKLIIDDVVTIGSRNFAERLQIEAKKNNDQEDIWASTIILGVIIGYLISSIKRKNTFPI
Sbjct: 61  SIKLIIDDVVTIGSRNFAERLQIEAKKNNDQEDIWASTIILGVIIGYLISSIKRKNTFPI 120

Query: 121 MPTSSPKIDDCRFKTGDTISIVINFNEDCLNNRSDVTEERNYEESTVLHSKESVLSIGRQ 180
           MPTSSPKIDDCRFKTGDTISIVINFNEDCLNNRSDVTEERNYEESTVLHSKESVLSIGRQ
Sbjct: 121 MPTSSPKIDDCRFKTGDTISIVINFNEDCLNNRSDVTEERNYEESTVLHSKESVLSIGRQ 180

Query: 181 NMVTLNQSDENFTYGNFDEYDLLTKDYTTEVLTRSPGSNPEFKAVVNNTLLDSANETPFK 240
           NMVTLNQSDENFTYGNFDEYDLLTKDYTTEVLTRSPGSNPEFKAVVNNTLLDSANETPFK
Sbjct: 181 NMVTLNQSDENFTYGNFDEYDLLTKDYTTEVLTRSPGSNPEFKAVVNNTLLDSANETPFK 240

Query: 241 GIEKSINETMVKVPMGCDVSLSHYGRQYAPGNISIMRSFTARDNTKSVSREIRDICKSFL 300
           GIEKSINETMVKVPMGCDVSLSHYGRQYAPGNISIMRSFTARDNTKSVSREIRDICKSFL
Sbjct: 241 GIEKSINETMVKVPMGCDVSLSHYGRQYAPGNISIMRSFTARDNTKSVSREIRDICKSFL 300

Query: 301 IIKSQFGDELFLTMFMEKPVFFDNNIPIEITGAYREKRERLDEVIHKDLIRYDEVQNLTR 360
           IIKSQFGDELFLTMFMEKPVFFDNNIPIEITGAYREKRERLDEVIHKDLIRYDEVQNLTR
Sbjct: 301 IIKSQFGDELFLTMFMEKPVFFDNNIPIEITGAYREKRERLDEVIHKDLIRYDEVQNLTR 360

Query: 361 IRNLLRVKSQKICSRRHNSSVPTKKLLVNDKGATSILL 398
           IRNLLRVKSQKICSRRHNSSVPTKKLLVNDKGATSILL
Sbjct: 361 IRNLLRVKSQKICSRRHNSSVPTKKLLVNDKGATSILL 398

>Kwal_26.8059
          Length = 631

 Score = 31.6 bits (70), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 32/59 (54%), Gaps = 3/59 (5%)

Query: 327 PIEITGAYREKRERLDEVIHKDLIRYDEVQNLTRIRNLLRVKSQKICSRRHNSSVPTKK 385
           P   TG+    RERL+    + L R   ++++T+ +++ R K Q    R+ N+ +P K+
Sbjct: 137 PASATGSEETYRERLETPNSEQLTRLSSLRSITKPKDIYRTKRQ---YRKKNNHIPPKQ 192

>Kwal_55.19640
          Length = 678

 Score = 30.4 bits (67), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 27/61 (44%), Gaps = 3/61 (4%)

Query: 172 ESVLSIGRQNMVTLNQSDENFTYGNFDEYDLLTKDYTTEVLTRSPGSNPEFKAVVNNTLL 231
           ES+ S+ +   V  NQS +N   G  DEYD L   Y  +V    P   P  K     ++ 
Sbjct: 595 ESLRSLAQ---VPSNQSHKNAHDGPLDEYDYLYNFYEDQVEVSRPDHPPSTKMTATQSVY 651

Query: 232 D 232
           D
Sbjct: 652 D 652

>Scas_695.31
          Length = 2459

 Score = 30.4 bits (67), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 17/66 (25%), Positives = 31/66 (46%)

Query: 215 SPGSNPEFKAVVNNTLLDSANETPFKGIEKSINETMVKVPMGCDVSLSHYGRQYAPGNIS 274
           SP +   +  VV NTLL   ++        ++ + ++ +     +    + +Q  PG IS
Sbjct: 898 SPSNEEYYPTVVINTLLKILHDPSLSSHHTAVIQAIMNIFQSLGLRCVSFLKQIVPGIIS 957

Query: 275 IMRSFT 280
           +MRS T
Sbjct: 958 VMRSCT 963

>Scas_643.14
          Length = 507

 Score = 30.0 bits (66), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 46/93 (49%), Gaps = 11/93 (11%)

Query: 6   LKSTFPYEYGSDFTMIRTEMLNTTK------SETTI--LFSNIKSILAIIWKYSFTFLRS 57
           + +T PYE+ SDF  IR E+L+  K      S+ TI  +F N+    A  +K+ F  +  
Sbjct: 191 IDTTSPYEFSSDFNEIR-ELLSKEKPSLSSSSQDTIETIFDNVME-FAHDYKHGFKIMTH 248

Query: 58  FSDSIK-LIIDDVVTIGSRNFAERLQIEAKKNN 89
             D +K +  +D ++   R  + R+     +NN
Sbjct: 249 EFDLLKNITFNDRLSPNLRELSARMMTSCLRNN 281

>Kwal_26.7891
          Length = 310

 Score = 29.3 bits (64), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 39/153 (25%), Positives = 58/153 (37%), Gaps = 23/153 (15%)

Query: 121 MPTSSPKIDDCRFKTGDTISIVINFNEDCLNNRSDVTEERNYEESTVLHSKESVLSIGRQ 180
           MP+  PK               I F ++    R      R  +E+ V   ++ +  I RQ
Sbjct: 137 MPSGVPKY-------------FITFTDERTRYRWVFPLSRKSDEAVVAVFRKLIAHIARQ 183

Query: 181 NMVTLN--QSDENFTYGNFDEYDLLTKD----YTTEVLTRSPGSNPEFKAVVNNTLLDSA 234
           + V +   Q D+   Y N      L  +    Y T V      S+    A +N TL++  
Sbjct: 184 HGVKVKAIQMDKGSEYTNQSIRMFLANEGIDTYYTSV---GDSSSHGIAARLNLTLMNDC 240

Query: 235 NETPFKGIEKSINETMVKVPMGCDVSLSHYGRQ 267
             T  KG + SI+     V   C+V  SHY  Q
Sbjct: 241 -RTILKGSKMSIHLWFHAVKAACNVPQSHYSTQ 272

>YKR021W (YKR021W) [3276] chr11 (478877..481624) Protein containing
           an N-terminal arrestin (or S-antigen) domain, which form
           an Ig-like beta-sandwich, has moderate similarity to
           uncharacterized S. cerevisiae Yjl084p [2748 bp, 915 aa]
          Length = 915

 Score = 29.6 bits (65), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 30/62 (48%)

Query: 122 PTSSPKIDDCRFKTGDTISIVINFNEDCLNNRSDVTEERNYEESTVLHSKESVLSIGRQN 181
           P  SP +     +    + +V N  E    ++SD T ++N + S V  SK+ V +I + N
Sbjct: 570 PVLSPNVQKMNIRIPSDLPVVRNRAESVKKSKSDNTSKKNDQSSNVFASKQLVANIYKPN 629

Query: 182 MV 183
            +
Sbjct: 630 QI 631

>YJL125C (GCD14) [2794] chr10 complement(185447..186598) Protein
           required for translational repression of GCN4 mRNA,
           required for 1-methyladenosine methyltransferase
           activity [1152 bp, 383 aa]
          Length = 383

 Score = 29.3 bits (64), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 14/50 (28%), Positives = 27/50 (54%), Gaps = 3/50 (6%)

Query: 173 SVLSIGRQNMVTLNQSDE---NFTYGNFDEYDLLTKDYTTEVLTRSPGSN 219
           +++ + R N+  +    E   N  YG+F   D++ K Y +++  R+ GSN
Sbjct: 19  TLIWVSRDNIKPVRMHSEEVFNTRYGSFPHKDIIGKPYGSQIAIRTKGSN 68

>Sklu_1809.2 YDR194C, Contig c1809 1564-3570 reverse complement
          Length = 668

 Score = 28.9 bits (63), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 27/47 (57%)

Query: 109 ISSIKRKNTFPIMPTSSPKIDDCRFKTGDTISIVINFNEDCLNNRSD 155
           ++ +++K   PI+ T++  I   +  TG T++ +I   E  L NR+D
Sbjct: 143 LTPVQQKTIKPILATTNDVIARAKTGTGKTLAFLIPMFEHLLANRTD 189

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.134    0.376 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 13,383,323
Number of extensions: 602217
Number of successful extensions: 1954
Number of sequences better than 10.0: 34
Number of HSP's gapped: 1982
Number of HSP's successfully gapped: 34
Length of query: 398
Length of database: 16,596,109
Length adjustment: 104
Effective length of query: 294
Effective length of database: 12,995,837
Effective search space: 3820776078
Effective search space used: 3820776078
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 63 (28.9 bits)