Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YBR062C1151146101e-83
CAGL0H10274g1141133922e-50
Kwal_27.105461041093522e-44
Scas_560.6*1181143481e-43
AGR034W1591143432e-42
KLLA0F18458g140972911e-34
Scas_625.11274961659e-15
Scas_644.6510641095e-07
Kwal_56.22522513651026e-06
KLLA0C05874g55352964e-05
Kwal_56.2390058939955e-05
Scas_713.4557088955e-05
ACL019C57585912e-04
Sklu_2432.9147568903e-04
YOL013C (HRD1)55124876e-04
Sklu_1684.114475847e-04
KLLA0E07139g11058810.001
ABL058C154654840.001
YMR247C156254840.002
YDL008W (APC11)16559820.002
Kwal_56.2311213578790.003
AER016C14759800.003
CAGL0E02299g54528810.004
Scas_696.17156462810.004
Scas_625.476161800.005
YKL034W (TUL1)75859800.006
Sklu_2102.175155790.006
KLLA0F12166g152868790.007
Sklu_2317.249334780.008
Scas_705.4142853770.011
Scas_585.5*10959740.012
Kwal_26.809975024770.013
KLLA0E03960g70440770.014
Kwal_27.12327157488770.014
YOL133W (HRT1)12159740.015
ADL181W10859730.017
YDR143C (SAN1)61053760.018
CAGL0L01947g75762760.019
Kwal_55.2205411159730.023
KLLA0E17787g16242740.024
CAGL0I04576g14957730.025
Sklu_2416.811059720.031
KLLA0C14344g151858740.036
CAGL0E01441g71732730.041
KLLA0F25674g75724720.059
Kwal_14.1287151824710.087
CAGL0I09988g38767700.100
AGL217W41467690.15
YHL010C58545690.16
YOL054W40652680.17
Kwal_26.809052060680.18
KLLA0B07799g122760680.19
CAGL0H02651g154462680.21
ABR104W32850660.38
YLR247C155687660.38
AFR275W75324660.39
CAGL0K02563g58645650.42
CAGL0B05049g147027650.48
Scas_665.139252650.48
Sklu_1785.333145650.49
Sklu_2337.232247640.54
KLLA0F25740g51745630.77
AGL079C50658630.86
Scas_685.920057621.0
Sklu_1676.310170601.0
YPR093C28847621.2
Scas_718.7712856611.3
CAGL0I01958g109940621.3
Scas_573.9150267621.3
Scas_633.6*302547621.4
Kwal_55.1999915233592.1
AAL030C153922602.2
CAGL0M08690g32833593.1
KLLA0C18260g22951583.9
KLLA0E18601g65050584.2
Kwal_55.2120627538584.3
Scas_615.1333033574.6
Scas_610.1367840584.7
AAR049C44326575.4
CAGL0A03432g115158575.7
YDR265W (PEX10)33733575.7
Kwal_47.1763824851565.9
CAGL0I08261g67631567.5
AER390W31634567.6
Kwal_33.1547578335568.1
CAGL0G03553g21059558.7
KLLA0C15697g30447558.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YBR062C
         (114 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YBR062C (YBR062C) [253] chr2 complement(365936..366283) Protein ...   239   1e-83
CAGL0H10274g complement(1003801..1004145) similar to sp|P38239 S...   155   2e-50
Kwal_27.10546                                                         140   2e-44
Scas_560.6*                                                           138   1e-43
AGR034W [4344] [Homologous to ScYBR062C - SH] complement(772772....   136   2e-42
KLLA0F18458g complement(1697871..1698293) some similarities with...   116   1e-34
Scas_625.11                                                            68   9e-15
Scas_644.6                                                             47   5e-07
Kwal_56.22522                                                          44   6e-06
KLLA0C05874g complement(520079..521740) weakly similar to sgd|S0...    42   4e-05
Kwal_56.23900                                                          41   5e-05
Scas_713.45                                                            41   5e-05
ACL019C [1030] [Homologous to ScYOL013C (HRD1) - SH] (328044..32...    40   2e-04
Sklu_2432.9 , Contig c2432 20306-24733 reverse complement              39   3e-04
YOL013C (HRD1) [4803] chr15 complement(301380..303035) E3 ubiqui...    38   6e-04
Sklu_1684.1 YDL008W, Contig c1684 226-660                              37   7e-04
KLLA0E07139g 651474..651806 similar to sgd|S0005493 Saccharomyce...    36   0.001
ABL058C [534] [Homologous to ScYMR247C - SH] (288355..292995) [4...    37   0.001
YMR247C (YMR247C) [4203] chr13 complement(763350..768038) Protei...    37   0.002
YDL008W (APC11) [849] chr4 (433494..433991) Component of the ana...    36   0.002
Kwal_56.23112                                                          35   0.003
AER016C [2521] [Homologous to ScYDL008W (APC11) - SH] (659572..6...    35   0.003
CAGL0E02299g complement(219009..220646) similar to tr|Q08109 Sac...    36   0.004
Scas_696.17                                                            36   0.004
Scas_625.4                                                             35   0.005
YKL034W (TUL1) [3222] chr11 (371472..373748) Protein containing ...    35   0.006
Sklu_2102.1 YKL034W, Contig c2102 417-2672 reverse complement          35   0.006
KLLA0F12166g complement(1116715..1121301) weakly similar to sgd|...    35   0.007
Sklu_2317.2 YDR143C, Contig c2317 4002-5483                            35   0.008
Scas_705.41                                                            34   0.011
Scas_585.5*                                                            33   0.012
Kwal_26.8099                                                           34   0.013
KLLA0E03960g 369201..371315 some similarities with sp|P22470 Sac...    34   0.014
Kwal_27.12327                                                          34   0.014
YOL133W (HRT1) [4690] chr15 (70324..70689) Activator of the Cdc5...    33   0.015
ADL181W [1560] [Homologous to ScYOL133W (HRT1) - SH] complement(...    33   0.017
YDR143C (SAN1) [988] chr4 complement(742036..743868) Protein tha...    34   0.018
CAGL0L01947g 225999..228272 similar to sp|P36096 Saccharomyces c...    34   0.019
Kwal_55.22054                                                          33   0.023
KLLA0E17787g complement(1571018..1571506) similar to sgd|S000216...    33   0.024
CAGL0I04576g 408872..409321 similar to tr|Q12157 Saccharomyces c...    33   0.025
Sklu_2416.8 YOL133W, Contig c2416 15124-15456                          32   0.031
KLLA0C14344g 1245226..1249782 similar to sp|Q04781 Saccharomyces...    33   0.036
CAGL0E01441g 135075..137228 weakly similar to sp|P22470 Saccharo...    33   0.041
KLLA0F25674g 2384293..2386566 similar to sp|P36096 Saccharomyces...    32   0.059
Kwal_14.1287                                                           32   0.087
CAGL0I09988g complement(951368..952531) similar to tr|Q12161 Sac...    32   0.100
AGL217W [4095] [Homologous to ScYOL054W - SH] complement(290043....    31   0.15 
YHL010C (YHL010C) [2276] chr8 complement(81959..83716) Protein t...    31   0.16 
YOL054W (YOL054W) [4765] chr15 (228612..229832) Protein required...    31   0.17 
Kwal_26.8090                                                           31   0.18 
KLLA0B07799g complement(682960..686643) gi|16611806|gb|AAL27369....    31   0.19 
CAGL0H02651g 238495..243129 similar to sp|Q04781 Saccharomyces c...    31   0.21 
ABR104W [696] [Homologous to ScYPR093C - SH] complement(574067.....    30   0.38 
YLR247C (YLR247C) [3643] chr12 complement(628686..633356) Protei...    30   0.38 
AFR275W [3467] [Homologous to ScYKL034W (TUL1) - NSH] complement...    30   0.39 
CAGL0K02563g complement(230983..232743) similar to sp|P38748 Sac...    30   0.42 
CAGL0B05049g 487186..491598 some similarities with tr|Q06554 Sac...    30   0.48 
Scas_665.1                                                             30   0.48 
Sklu_1785.3 YOL054W, Contig c1785 2663-3658 reverse complement         30   0.49 
Sklu_2337.2 YPR093C, Contig c2337 3730-4698 reverse complement         29   0.54 
KLLA0F25740g complement(2389226..2390779) similar to sp|P38748 S...    29   0.77 
AGL079C [4232] [Homologous to ScYHL010C - SH] (557422..558942) [...    29   0.86 
Scas_685.9                                                             28   1.0  
Sklu_1676.3 YDR265W, Contig c1676 2766-3071 reverse complement         28   1.0  
YPR093C (YPR093C) [5516] chr16 complement(719554..720420) Protei...    28   1.2  
Scas_718.77                                                            28   1.3  
CAGL0I01958g 162266..165565 weakly similar to sp|P38850 Saccharo...    28   1.3  
Scas_573.9                                                             28   1.3  
Scas_633.6*                                                            28   1.4  
Kwal_55.19999                                                          27   2.1  
AAL030C [157] [Homologous to ScYLR247C - SH] (284758..289377) [4...    28   2.2  
CAGL0M08690g complement(865182..866168) similar to sp|Q05568 Sac...    27   3.1  
KLLA0C18260g 1613311..1614000 similar to sp|P53769 Saccharomyces...    27   3.9  
KLLA0E18601g complement(1645113..1647065) some similarities with...    27   4.2  
Kwal_55.21206                                                          27   4.3  
Scas_615.13                                                            27   4.6  
Scas_610.13                                                            27   4.7  
AAR049C [235] [Homologous to ScYCR066W (RAD18) - SH] (428904..43...    27   5.4  
CAGL0A03432g 345192..348647 similar to sp|P32849 Saccharomyces c...    27   5.7  
YDR265W (PEX10) [1098] chr4 (998856..999869) Peroxisomal biogene...    27   5.7  
Kwal_47.17638                                                          26   5.9  
CAGL0I08261g 803722..805752 similar to sp|P32569 Saccharomyces c...    26   7.5  
AER390W [2890] [Homologous to ScYDR265W (PEX10) - SH] complement...    26   7.6  
Kwal_33.15475                                                          26   8.1  
CAGL0G03553g complement(345057..345689) weakly similar to sp|P40...    26   8.7  
KLLA0C15697g 1360289..1361203 weakly similar to sgd|S0006297 Sac...    26   8.9  

>YBR062C (YBR062C) [253] chr2 complement(365936..366283) Protein
           containing a C3HC4 type (RING) zinc finger, which may
           mediate protein-protein interactions, has moderate
           similarity to uncharacterized C. albicans Orf6.8878p
           [348 bp, 115 aa]
          Length = 115

 Score =  239 bits (610), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 114/114 (100%), Positives = 114/114 (100%)

Query: 1   MLPESLQEEWLQEMDKGKSAGCPDTFAASLPRINKKKLKATDNCSICYTNYLEDEYPLVV 60
           MLPESLQEEWLQEMDKGKSAGCPDTFAASLPRINKKKLKATDNCSICYTNYLEDEYPLVV
Sbjct: 1   MLPESLQEEWLQEMDKGKSAGCPDTFAASLPRINKKKLKATDNCSICYTNYLEDEYPLVV 60

Query: 61  ELPHCHHKFDLECLSVWLSRSTTCPLCRDNVMGHRIINEIDTTEAELEEDWGMY 114
           ELPHCHHKFDLECLSVWLSRSTTCPLCRDNVMGHRIINEIDTTEAELEEDWGMY
Sbjct: 61  ELPHCHHKFDLECLSVWLSRSTTCPLCRDNVMGHRIINEIDTTEAELEEDWGMY 114

>CAGL0H10274g complement(1003801..1004145) similar to sp|P38239
           Saccharomyces cerevisiae YBR062c, hypothetical start
          Length = 114

 Score =  155 bits (392), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 68/113 (60%), Positives = 88/113 (77%)

Query: 2   LPESLQEEWLQEMDKGKSAGCPDTFAASLPRINKKKLKATDNCSICYTNYLEDEYPLVVE 61
           +PE LQE+ +Q MD     GC DTF  SLPRI +KKLK+ D C IC +N++ DEYPLVVE
Sbjct: 1   MPEDLQEQLMQSMDSASKQGCSDTFIDSLPRIPQKKLKSDDTCPICCSNFIADEYPLVVE 60

Query: 62  LPHCHHKFDLECLSVWLSRSTTCPLCRDNVMGHRIINEIDTTEAELEEDWGMY 114
           LPHC HKFD EC+S+WL+++TTCP+CRD+V   + + E+DT++ ELEEDWGMY
Sbjct: 61  LPHCGHKFDFECVSMWLTKNTTCPMCRDDVTHKKELPELDTSKVELEEDWGMY 113

>Kwal_27.10546
          Length = 104

 Score =  140 bits (352), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 65/109 (59%), Positives = 84/109 (77%), Gaps = 6/109 (5%)

Query: 6   LQEEWLQEMDKGKSAGCPDTFAASLPRINKKKLKATDNCSICYTNYLEDEYPLVVELPHC 65
           +QEE LQE    K  GCPDT+  SLPR+ K KLK  + CSIC  NY +D+YPLVVELPHC
Sbjct: 1   MQEELLQE----KQEGCPDTYIDSLPRVEKGKLKDAEACSICCCNYRDDKYPLVVELPHC 56

Query: 66  HHKFDLECLSVWLSRSTTCPLCRDNVMGHRIINEIDTTEAELEEDWGMY 114
           +H+FDLEC++VWLS+S TCPLCRD+V+ H+    +D ++ E+E+DWGMY
Sbjct: 57  NHRFDLECVAVWLSKSRTCPLCRDDVLSHK--PNVDVSQVEMEDDWGMY 103

>Scas_560.6*
          Length = 118

 Score =  138 bits (348), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 83/114 (72%), Gaps = 4/114 (3%)

Query: 1   MLPESLQEEWLQEMDKGKSAGCPDTFAASLPRINKKKLKATDNCSICYTNYLEDEYPLVV 60
           ++PE+LQEEW ++MD+     C + F ASLPR+  K     D C IC   + ED+YPL+V
Sbjct: 8   IIPENLQEEWFEQMDEKNKKHCSEEFIASLPRVKSKH--KNDECPICCCKFSEDKYPLIV 65

Query: 61  ELPHCHHKFDLECLSVWLSRSTTCPLCRDNVMGHRIINEIDTTEAELEEDWGMY 114
           ELP C+H+FDLEC+SVWLS+S TCPLCRDNV+ H++   IDT++ E EE WGMY
Sbjct: 66  ELPRCNHRFDLECISVWLSKSVTCPLCRDNVLEHKL--NIDTSKTEFEEGWGMY 117

>AGR034W [4344] [Homologous to ScYBR062C - SH]
           complement(772772..773251) [480 bp, 159 aa]
          Length = 159

 Score =  136 bits (343), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 67/114 (58%), Positives = 85/114 (74%), Gaps = 4/114 (3%)

Query: 1   MLPESLQEEWLQEMDKGKSAGCPDTFAASLPRINKKKLKATDNCSICYTNYLEDEYPLVV 60
           ++PE LQ+  LQ + +G   G PD +  +LPR+ KK+L   DNC+IC   YLEDEYPLVV
Sbjct: 49  LMPEELQQH-LQLIGEG-DGGVPDGYMDTLPRVPKKRLAEGDNCAICCCGYLEDEYPLVV 106

Query: 61  ELPHCHHKFDLECLSVWLSRSTTCPLCRDNVMGHRIINEIDTTEAELEEDWGMY 114
           ELP+C H FDL+C+SVWLSRSTTCP+CR +V+  +   EID + AELEEDWGMY
Sbjct: 107 ELPNCGHTFDLQCVSVWLSRSTTCPMCRSDVLVRK--PEIDGSAAELEEDWGMY 158

>KLLA0F18458g complement(1697871..1698293) some similarities with
           sp|P38239 Saccharomyces cerevisiae YBR062c singleton,
           hypothetical start
          Length = 140

 Score =  116 bits (291), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 51/97 (52%), Positives = 71/97 (73%), Gaps = 2/97 (2%)

Query: 18  KSAGCPDTFAASLPRINKKKLKATDNCSICYTNYLEDEYPLVVELPHCHHKFDLECLSVW 77
           +  G  +T+  SLPR+   KLKA D C+IC  N+L+D YPLV ++P C+HKFDLECLS+W
Sbjct: 45  QQKGMSETYIDSLPRVPNSKLKAEDTCAICQCNFLDDPYPLVAKVPRCNHKFDLECLSIW 104

Query: 78  LSRSTTCPLCRDNVMGHRIINEIDTTEAELEEDWGMY 114
           L  + TCP+CRD++   ++  EIDT++ ELEED+ MY
Sbjct: 105 LQNNHTCPMCRDDLRSKKV--EIDTSQCELEEDFNMY 139

>Scas_625.11
          Length = 274

 Score = 68.2 bits (165), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 37/96 (38%), Positives = 54/96 (56%), Gaps = 5/96 (5%)

Query: 16  KGKSAGCPDTFAASLPRINKKKL-KATDNCSICYTNYLEDEYPLVVELPHCHHKFDLECL 74
           +  +  C + F   LPR N  +L  ++D C IC   Y +D    +  LP+C H F  EC+
Sbjct: 181 RSAAKPCTNEFIEQLPRTNCAELSNSSDECPICRIAYSDDFETEITCLPNCSHHFHFECI 240

Query: 75  SVWLSRSTTCPLCRDNVMGHRIINEIDTTEAELEED 110
            +WL +++ CPLCRDNVM  +     +TTE +LE D
Sbjct: 241 KLWLQKNSLCPLCRDNVMECK----AETTEEDLEWD 272

>Scas_644.6
          Length = 510

 Score = 46.6 bits (109), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 24/64 (37%), Positives = 35/64 (54%), Gaps = 4/64 (6%)

Query: 28  ASLPRINKKKLKATDN-CSICYTNYLEDEYPL--VVELPHCHHKFDLECLSVWLSRSTTC 84
           + LP +  + L+ +DN C +C  + L +E+       LP C H   L CL  W+ RS TC
Sbjct: 336 SKLPDMIPEDLQDSDNVCIVCMDDLLSEEHKKKKAKRLP-CGHFLHLSCLKNWMERSQTC 394

Query: 85  PLCR 88
           P+CR
Sbjct: 395 PICR 398

>Kwal_56.22522
          Length = 513

 Score = 43.9 bits (102), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 23/65 (35%), Positives = 35/65 (53%), Gaps = 6/65 (9%)

Query: 30  LPRINKKKLKATDN--CSICYTNYLE-DEYPLVVELPH---CHHKFDLECLSVWLSRSTT 83
           LP +++ +L A+D+  C +C  + L   E     + P    C+H   L CL  W+ RS T
Sbjct: 300 LPDVSEAQLAASDDKMCIVCMDDMLAPSECTNAKQKPKRLPCNHCLHLGCLKSWMERSQT 359

Query: 84  CPLCR 88
           CP+CR
Sbjct: 360 CPICR 364

>KLLA0C05874g complement(520079..521740) weakly similar to
           sgd|S0005373 Saccharomyces cerevisiae YOL013c HRD1
           involved in degradation of HMG2P, start by similarity
          Length = 553

 Score = 41.6 bits (96), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 20/52 (38%), Positives = 28/52 (53%), Gaps = 6/52 (11%)

Query: 42  DNCSICYTNYL-----EDEYPLVVELPHCHHKFDLECLSVWLSRSTTCPLCR 88
           D C +C  ++L     + +   V  LP C H   L CL  W++RS TCP+CR
Sbjct: 351 DICIVCMEDFLPSHQRKSDGKKVKILP-CTHALHLSCLKNWIARSPTCPICR 401

>Kwal_56.23900
          Length = 589

 Score = 41.2 bits (95), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 17/39 (43%), Positives = 24/39 (61%), Gaps = 1/39 (2%)

Query: 60  VELPHCHHKFDLECLSVWLSRSTTCPLCRDNVMGHRIIN 98
           V+LP C H F  EC+  W +   TCP+CR N++G   +N
Sbjct: 223 VQLP-CSHVFGRECIRQWTNLHNTCPICRANIVGADGLN 260

 Score = 26.2 bits (56), Expect = 6.9,   Method: Composition-based stats.
 Identities = 18/67 (26%), Positives = 29/67 (43%), Gaps = 13/67 (19%)

Query: 2   LPESLQEEWLQEMDKGKSAGCPDTFAASLPR-------------INKKKLKATDNCSICY 48
           +PES   E + E+    S    +  + SL R             + K +    D+CSICY
Sbjct: 76  VPESTTRERIDEVVALASGVAVNRMSRSLNRSRGISRKAFELLPVLKTEQSLEDSCSICY 135

Query: 49  TNYLEDE 55
             ++E+E
Sbjct: 136 DGFVEEE 142

>Scas_713.45
          Length = 570

 Score = 41.2 bits (95), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 30/88 (34%), Positives = 41/88 (46%), Gaps = 13/88 (14%)

Query: 24  DTFAASLPRINKKKLKAT--DNCSICYTNYLEDEYPLVVELPHCHHKFDLECLSVWLSRS 81
           D   AS P  N+ +   T  DN    +  Y  +  P   +LP C H F  ECL  W    
Sbjct: 197 DATTASTPTSNEPEPTTTVEDNDEEAHPTY--NHSP--TKLP-CGHIFGRECLYRWCKLE 251

Query: 82  TTCPLCRDNVMGHRIINEIDTTEAELEE 109
            TCPLCR       +I E+DTT+ + ++
Sbjct: 252 NTCPLCR------HVIAEVDTTQHQAQD 273

>ACL019C [1030] [Homologous to ScYOL013C (HRD1) - SH]
           (328044..329771) [1728 bp, 575 aa]
          Length = 575

 Score = 39.7 bits (91), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 26/85 (30%), Positives = 41/85 (48%), Gaps = 14/85 (16%)

Query: 30  LPRINKKKLKATDN-CSICYTNYLEDEYPLV--------VELPHCHHKFDLECLSVWLSR 80
           L  +++++L  TD+ C IC    ++D  P           ++  C H     CL  W+ R
Sbjct: 305 LSDVSEEQLDDTDSMCIIC----MDDMLPTTETTKMNRRAKMLPCGHMLHFGCLKSWMER 360

Query: 81  STTCPLCRDNVMGHRIINEIDTTEA 105
           S TCP+CR +V  +   N   TT+A
Sbjct: 361 SQTCPICRLSVFAND-SNSHATTQA 384

>Sklu_2432.9 , Contig c2432 20306-24733 reverse complement
          Length = 1475

 Score = 39.3 bits (90), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 29/68 (42%), Gaps = 6/68 (8%)

Query: 43   NCSICYTNYLEDEYPLVVELPHCHHKFDLECLSVWLSRSTTCPLCRDNVMGHRIINEIDT 102
            +C++C+          V  +  C H F   C+  WL    TCPLC+ NV    + N    
Sbjct: 1164 SCAVCFNEIF------VGSVVKCGHFFCYSCIHTWLKEHNTCPLCKTNVTPSEVYNFRYK 1217

Query: 103  TEAELEED 110
               EL ED
Sbjct: 1218 EGEELPED 1225

>YOL013C (HRD1) [4803] chr15 complement(301380..303035) E3 ubiquitin
           ligase required for endoplasmic reticulum-associated
           degradation of misfolded luminal and integral membrane
           proteins [1656 bp, 551 aa]
          Length = 551

 Score = 38.1 bits (87), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 13/24 (54%), Positives = 15/24 (62%)

Query: 65  CHHKFDLECLSVWLSRSTTCPLCR 88
           C H   L CL  W+ RS TCP+CR
Sbjct: 377 CGHILHLSCLKNWMERSQTCPICR 400

>Sklu_1684.1 YDL008W, Contig c1684 226-660
          Length = 144

 Score = 37.0 bits (84), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 35/75 (46%), Gaps = 18/75 (24%)

Query: 30 LPRINKKKLKATDN----CSICYTNY---------LEDEYPLVVELPHCHHKFDLECLSV 76
          +PR    + +A D     C IC  +Y           DE PLVV    C+H F + C+  
Sbjct: 18 IPRDGTHQHEAADTEEDVCGICRVSYNGTCPSCKYPGDECPLVV--GECNHNFHVHCIVQ 75

Query: 77 WLSRSTT---CPLCR 88
          WL  +T+   CP+CR
Sbjct: 76 WLDTATSRGLCPMCR 90

>KLLA0E07139g 651474..651806 similar to sgd|S0005493 Saccharomyces
          cerevisiae YOL133w HRT1, start by similarity
          Length = 110

 Score = 35.8 bits (81), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 25/58 (43%), Gaps = 12/58 (20%)

Query: 41 TDNCSICYTNYLE------------DEYPLVVELPHCHHKFDLECLSVWLSRSTTCPL 86
           DNC+IC  + +E             E+  V     C+H F L C++ W+     CPL
Sbjct: 41 VDNCAICRNHIMEPCVNCQQEATFNSEHECVAAWGECNHAFHLHCITQWIKSRNVCPL 98

>ABL058C [534] [Homologous to ScYMR247C - SH] (288355..292995) [4641
            bp, 1546 aa]
          Length = 1546

 Score = 37.0 bits (84), Expect = 0.001,   Method: Composition-based stats.
 Identities = 19/54 (35%), Positives = 29/54 (53%), Gaps = 5/54 (9%)

Query: 42   DNCSICYT--NYLEDEYPLVVELPHCHHKFDLECLSVWLSRS--TTCPLCRDNV 91
            + C+ICY+  + ++ + P  V  P C ++F   CL  W   S   TCPLCR  +
Sbjct: 1490 EECAICYSILHVVDRKLPSKV-CPTCSNRFHGACLYKWFKSSGNNTCPLCRGEI 1542

>YMR247C (YMR247C) [4203] chr13 complement(763350..768038) Protein of
            unknown function, has weak similarity to uncharacterized
            C. albicans Orf6.3079p [4689 bp, 1562 aa]
          Length = 1562

 Score = 37.0 bits (84), Expect = 0.002,   Method: Composition-based stats.
 Identities = 19/54 (35%), Positives = 28/54 (51%), Gaps = 5/54 (9%)

Query: 42   DNCSICYT--NYLEDEYPLVVELPHCHHKFDLECLSVWLSRS--TTCPLCRDNV 91
            + C+ICY+  + ++ + P     P C +KF   CL  W   S   TCPLCR  +
Sbjct: 1506 EECAICYSILHAVDRKLPSKT-CPTCKNKFHGACLYKWFRSSGNNTCPLCRSEI 1558

>YDL008W (APC11) [849] chr4 (433494..433991) Component of the
          anaphase-promoting complex (APC), has ubiquitin ligase
          activity and is required for the metaphase-anaphase
          transition [498 bp, 165 aa]
          Length = 165

 Score = 36.2 bits (82), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 28/59 (47%), Gaps = 14/59 (23%)

Query: 42 DNCSICYTNY---------LEDEYPLVVELPHCHHKFDLECLSVWLSRSTT---CPLCR 88
          D C IC  +Y           D+ PLV+ L  CHH F   C+  WL   T+   CP+CR
Sbjct: 39 DVCGICRASYNGTCPSCKFPGDQCPLVIGL--CHHNFHDHCIYRWLDTPTSKGLCPMCR 95

>Kwal_56.23112
          Length = 135

 Score = 35.0 bits (79), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 34/78 (43%), Gaps = 16/78 (20%)

Query: 36  KKLKATDNCSICYTNY---------LEDEYPLVVELPHCHHKFDLECLSVWLSRSTT--- 83
           K++   D C IC  +Y           D  PLV+    C+H F + C+  WL  +T    
Sbjct: 26  KEIGDEDLCGICRVSYNGTCPGCRFPGDNCPLVIG--ECNHNFHVHCIQQWLETATAKGL 83

Query: 84  CPLCRDNVMGHR--IINE 99
           CP+CR      R   INE
Sbjct: 84  CPMCRQQFSLKRGVAINE 101

>AER016C [2521] [Homologous to ScYDL008W (APC11) - SH]
          (659572..660015) [444 bp, 147 aa]
          Length = 147

 Score = 35.4 bits (80), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 30/59 (50%), Gaps = 14/59 (23%)

Query: 42 DNCSICYTNY--------LEDEY-PLVVELPHCHHKFDLECLSVWLSRSTT---CPLCR 88
          D C IC  +Y        L  E  PL+V    CHH F + C+  WL+ ST+   CP+CR
Sbjct: 36 DVCGICRGSYNGTCPNCKLPGETCPLIVG--SCHHNFHVHCIYQWLNTSTSKGLCPMCR 92

>CAGL0E02299g complement(219009..220646) similar to tr|Q08109
           Saccharomyces cerevisiae YOL013c HRD1, start by
           similarity
          Length = 545

 Score = 35.8 bits (81), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 18/28 (64%), Gaps = 1/28 (3%)

Query: 61  ELPHCHHKFDLECLSVWLSRSTTCPLCR 88
           +LP C H   L CL  W+ RS TCP+CR
Sbjct: 374 KLP-CGHVLHLSCLKNWMERSQTCPICR 400

>Scas_696.17
          Length = 1564

 Score = 35.8 bits (81), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 30/62 (48%), Gaps = 3/62 (4%)

Query: 37   KLKATDNCSICYTNYLEDEYPLVVEL-PHCHHKFDLECLSVWL--SRSTTCPLCRDNVMG 93
            +    + C+ICY+     +  L  +  P C +KF   CL  W   S + TCPLCR  +  
Sbjct: 1503 QFSGFEECAICYSILHAVDRKLPTKTCPTCKNKFHGACLYKWFRSSGNNTCPLCRSEIPL 1562

Query: 94   HR 95
            HR
Sbjct: 1563 HR 1564

>Scas_625.4
          Length = 761

 Score = 35.4 bits (80), Expect = 0.005,   Method: Composition-based stats.
 Identities = 19/61 (31%), Positives = 29/61 (47%), Gaps = 13/61 (21%)

Query: 39  KATDNCSICYTN---YLE--------DEYPLVVELPHCHHKFDLECLSVWLSRSTTCPLC 87
           K T +C+IC +    Y+E        D++  +V    C H F  +CL  W+     CP+C
Sbjct: 697 KHTADCAICMSEVPVYIEEAEETHNIDQHSYMVT--PCDHIFHTDCLENWMGYKLQCPVC 754

Query: 88  R 88
           R
Sbjct: 755 R 755

>YKL034W (TUL1) [3222] chr11 (371472..373748) Protein containing a
           C3HC4 type (RING) zinc finger, which may mediate
           protein-protein interactions, has low similarity to
           uncharacterized C. albicans Orf6.5365p [2277 bp, 758 aa]
          Length = 758

 Score = 35.4 bits (80), Expect = 0.006,   Method: Composition-based stats.
 Identities = 18/59 (30%), Positives = 30/59 (50%), Gaps = 13/59 (22%)

Query: 41  TDNCSICYTN---YLE--------DEYPLVVELPHCHHKFDLECLSVWLSRSTTCPLCR 88
           T +C+IC ++   Y+E        D++  +V    C+H F   CL  W++    CP+CR
Sbjct: 696 TVDCAICMSDVPIYIEEIPETHKVDQHSYMVT--PCNHVFHTSCLENWMNYKLQCPVCR 752

>Sklu_2102.1 YKL034W, Contig c2102 417-2672 reverse complement
          Length = 751

 Score = 35.0 bits (79), Expect = 0.006,   Method: Composition-based stats.
 Identities = 16/55 (29%), Positives = 28/55 (50%), Gaps = 9/55 (16%)

Query: 43  NCSIC------YTNYLEDEYPLVVE---LPHCHHKFDLECLSVWLSRSTTCPLCR 88
           +C+IC      Y + +E+ + + +    +  C H F  +CL  W+S    CP+CR
Sbjct: 691 DCAICMTDVPIYVSDIEETHKVDINSYMVTPCGHIFHTQCLESWMSYKLQCPVCR 745

>KLLA0F12166g complement(1116715..1121301) weakly similar to
            sgd|S0004237 Saccharomyces cerevisiae YLR247c,
            hypothetical start
          Length = 1528

 Score = 35.0 bits (79), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 35/68 (51%), Gaps = 7/68 (10%)

Query: 43   NCSICYTNYLEDEYPLVVELPHCHHKFDLECLSVWLSRSTTCPLCRDNVMGHRIINEIDT 102
            +C++CY++           +  C H F  +C++ W  ++T+CP+C+ N M    +     
Sbjct: 1207 SCAVCYSDIYTGS------ILKCGHFFCKDCVTHWFKKNTSCPMCK-NRMSSSEVYHFKF 1259

Query: 103  TEAELEED 110
             E EL+E+
Sbjct: 1260 REEELKEE 1267

>Sklu_2317.2 YDR143C, Contig c2317 4002-5483
          Length = 493

 Score = 34.7 bits (78), Expect = 0.008,   Method: Composition-based stats.
 Identities = 11/34 (32%), Positives = 18/34 (52%)

Query: 65  CHHKFDLECLSVWLSRSTTCPLCRDNVMGHRIIN 98
           C H+F   C+  W     +CP+CR  ++G   +N
Sbjct: 141 CGHRFGRMCIYQWTKEHNSCPICRAEIVGREGLN 174

>Scas_705.41
          Length = 428

 Score = 34.3 bits (77), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 30/53 (56%), Gaps = 3/53 (5%)

Query: 38 LKATDNCSICYTNYLEDEYPLVVELPHCHHKFDLECLSVW--LSRSTTCPLCR 88
          L+  + C IC+ + L D   L  +L  C+HK+  +C+  W   S ++ CPLCR
Sbjct: 6  LEGDNICPICFDD-LNDTDILQGKLKPCNHKYHYDCIRRWHGYSDNSDCPLCR 57

>Scas_585.5*
          Length = 109

 Score = 33.1 bits (74), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 25/59 (42%), Gaps = 12/59 (20%)

Query: 40 ATDNCSICYTNYLE------------DEYPLVVELPHCHHKFDLECLSVWLSRSTTCPL 86
          A DNC+IC  + +E             +   V     C+H F L C++ W+     CPL
Sbjct: 39 AVDNCAICRNHIMEPCIECQPKAMTDTDNECVAAWGTCNHAFHLHCINKWIKTRDACPL 97

>Kwal_26.8099
          Length = 750

 Score = 34.3 bits (77), Expect = 0.013,   Method: Composition-based stats.
 Identities = 11/24 (45%), Positives = 14/24 (58%)

Query: 65  CHHKFDLECLSVWLSRSTTCPLCR 88
           C H F  +CL  W+S    CP+CR
Sbjct: 721 CSHIFHTQCLESWMSYKLQCPVCR 744

>KLLA0E03960g 369201..371315 some similarities with sp|P22470
           Saccharomyces cerevisiae YDR143c SAN1 mating-type
           regulation protein singleton, hypothetical start
          Length = 704

 Score = 34.3 bits (77), Expect = 0.014,   Method: Composition-based stats.
 Identities = 11/40 (27%), Positives = 21/40 (52%)

Query: 65  CHHKFDLECLSVWLSRSTTCPLCRDNVMGHRIINEIDTTE 104
           C H F  ECL  W +   +CP+CR  ++    +  + +++
Sbjct: 219 CGHVFGRECLYKWTTEHNSCPICRAPILSEEELQALHSSD 258

>Kwal_27.12327
          Length = 1574

 Score = 34.3 bits (77), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 40/88 (45%), Gaps = 6/88 (6%)

Query: 12   QEMDKGKSAGCPDTFAASLPRINKKKLKATDNCSICYT--NYLEDEYPLVVELPHCHHKF 69
            Q +  G +    D+       +N       + C+ICY+  + ++ + P  V  P C+++F
Sbjct: 1489 QRVIVGMNGSVMDSLELFTKNVNLH-FSGFEECAICYSILHAVDRKLPSKV-CPTCNNRF 1546

Query: 70   DLECLSVWL--SRSTTCPLCRDNVMGHR 95
               CL  W   S + TCPLCR  +   R
Sbjct: 1547 HGACLYKWFRSSGNNTCPLCRSEIPFRR 1574

>YOL133W (HRT1) [4690] chr15 (70324..70689) Activator of the
           Cdc53p-containing SCF-Cdc4p ubiquitin ligase required
           for ubiquitination of Sic1p and for the G1 to S cell
           cycle transition; RING-box protein [366 bp, 121 aa]
          Length = 121

 Score = 33.1 bits (74), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 25/59 (42%), Gaps = 12/59 (20%)

Query: 40  ATDNCSICYTNYLE------------DEYPLVVELPHCHHKFDLECLSVWLSRSTTCPL 86
           A DNC+IC  + +E             +   V     C+H F L C++ W+     CPL
Sbjct: 51  AVDNCAICRNHIMEPCIECQPKAMTDTDNECVAAWGVCNHAFHLHCINKWIKTRDACPL 109

>ADL181W [1560] [Homologous to ScYOL133W (HRT1) - SH]
          complement(379684..380010) [327 bp, 108 aa]
          Length = 108

 Score = 32.7 bits (73), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 25/59 (42%), Gaps = 12/59 (20%)

Query: 40 ATDNCSICYTNYLE------------DEYPLVVELPHCHHKFDLECLSVWLSRSTTCPL 86
          A +NC+IC  + +E             E   V     C+H F L C++ WL     CPL
Sbjct: 38 AVENCAICRNHIMEPCIQCQPNAMTDTENECVAAWGTCNHAFHLHCINKWLLTRNACPL 96

>YDR143C (SAN1) [988] chr4 complement(742036..743868) Protein that
           may antagonize the function of Spt16p and Sir4p [1833
           bp, 610 aa]
          Length = 610

 Score = 33.9 bits (76), Expect = 0.018,   Method: Composition-based stats.
 Identities = 18/53 (33%), Positives = 26/53 (49%), Gaps = 4/53 (7%)

Query: 60  VELPHCHHKFDLECLSVWLSRSTTCPLCRDNV---MGHRIINEIDTTEAELEE 109
           ++LP C H F  EC+  W     +CPLCR  +   +G +   + DT E    E
Sbjct: 253 IKLP-CGHIFGRECIYKWSRLENSCPLCRQKISESVGVQRAAQQDTDEVAANE 304

>CAGL0L01947g 225999..228272 similar to sp|P36096 Saccharomyces
           cerevisiae YKL034w, start by similarity
          Length = 757

 Score = 33.9 bits (76), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 27/62 (43%), Gaps = 19/62 (30%)

Query: 41  TDNCSICYTNYLEDEYPLVVE-LPHCH-------------HKFDLECLSVWLSRSTTCPL 86
           T +C+IC       E+P+ VE LP  H             H F   CL  W+S    CP+
Sbjct: 695 TVDCAICMA-----EFPVYVEELPETHQVDKDSYMITPCDHMFHTSCLESWMSYKLQCPV 749

Query: 87  CR 88
           CR
Sbjct: 750 CR 751

>Kwal_55.22054
          Length = 111

 Score = 32.7 bits (73), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 25/59 (42%), Gaps = 12/59 (20%)

Query: 40 ATDNCSICYTNYLE------------DEYPLVVELPHCHHKFDLECLSVWLSRSTTCPL 86
          A +NC+IC  + +E             +   V     C+H F L C++ WL     CPL
Sbjct: 41 AVENCAICRNHIMEPCIQCQPTAMTDTDNECVAAWGTCNHAFHLHCINKWLQTRNACPL 99

>KLLA0E17787g complement(1571018..1571506) similar to sgd|S0002166
           Saccharomyces cerevisiae YDL008w APC11 subunit of the
           anaphase promoting complex, start by similarity
          Length = 162

 Score = 33.1 bits (74), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 24/42 (57%), Gaps = 5/42 (11%)

Query: 50  NYLEDEYPLVVELPHCHHKFDLECLSVWLSRSTT---CPLCR 88
           +Y     P+V+ L  C+H F + C+  WLS  T+   CPLCR
Sbjct: 74  DYPGSGCPIVLGL--CNHNFHVHCIKQWLSTETSKGLCPLCR 113

>CAGL0I04576g 408872..409321 similar to tr|Q12157 Saccharomyces
          cerevisiae YDL008w APC11 subunit of the anaphase
          promoting complex, start by similarity
          Length = 149

 Score = 32.7 bits (73), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 26/57 (45%), Gaps = 10/57 (17%)

Query: 42 DNCSICYTNYLED----EYP---LVVELPHCHHKFDLECLSVWLSRSTT---CPLCR 88
          D C IC  +Y        YP     + L  C H F + C+S W+   T+   CP+CR
Sbjct: 35 DVCGICRASYHAPCPNCRYPGESCAIVLGRCGHNFHVHCISRWVDTPTSKGLCPMCR 91

>Sklu_2416.8 YOL133W, Contig c2416 15124-15456
          Length = 110

 Score = 32.3 bits (72), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 25/59 (42%), Gaps = 12/59 (20%)

Query: 40 ATDNCSICYTNYLE------------DEYPLVVELPHCHHKFDLECLSVWLSRSTTCPL 86
          A +NC+IC  + +E             +   V     C+H F L C++ WL     CPL
Sbjct: 40 AVENCAICRNHIMEPCIQCQPTAMTDTDNECVAAWGTCNHAFHLHCINKWLQTRNACPL 98

>KLLA0C14344g 1245226..1249782 similar to sp|Q04781 Saccharomyces
            cerevisiae YMR247c singleton, start by similarity
          Length = 1518

 Score = 33.1 bits (74), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 30/58 (51%), Gaps = 5/58 (8%)

Query: 35   KKKLKATDNCSICY--TNYLEDEYPLVVELPHCHHKFDLECLSVWLSRS--TTCPLCR 88
            K +    + C+ICY   + ++ + P  V  P C+++F   CL  W   S   TCPLCR
Sbjct: 1455 KLQFSGFEECAICYYVLHAIDRKLPTKV-CPTCNNRFHGACLYKWFKSSGNNTCPLCR 1511

>CAGL0E01441g 135075..137228 weakly similar to sp|P22470
           Saccharomyces cerevisiae YDR143c mating-type regulation
           protein, hypothetical start
          Length = 717

 Score = 32.7 bits (73), Expect = 0.041,   Method: Composition-based stats.
 Identities = 13/32 (40%), Positives = 17/32 (53%), Gaps = 1/32 (3%)

Query: 60  VELPHCHHKFDLECLSVWLSRSTTCPLCRDNV 91
           V++P C H F   CL  W     +CPLCR  +
Sbjct: 291 VKIP-CGHIFGRSCLYEWTRLENSCPLCRKKI 321

>KLLA0F25674g 2384293..2386566 similar to sp|P36096 Saccharomyces
           cerevisiae YKL034w singleton, start by similarity
          Length = 757

 Score = 32.3 bits (72), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 14/24 (58%)

Query: 65  CHHKFDLECLSVWLSRSTTCPLCR 88
           C H F  ECL  W+S    CP+CR
Sbjct: 728 CSHIFHTECLENWMSYKLQCPVCR 751

>Kwal_14.1287
          Length = 1518

 Score = 32.0 bits (71), Expect = 0.087,   Method: Composition-based stats.
 Identities = 10/24 (41%), Positives = 15/24 (62%)

Query: 65   CHHKFDLECLSVWLSRSTTCPLCR 88
            C H F  +C+  WL   ++CPLC+
Sbjct: 1204 CGHFFCQDCICSWLKNHSSCPLCK 1227

>CAGL0I09988g complement(951368..952531) similar to tr|Q12161
          Saccharomyces cerevisiae YOL054w, start by similarity
          Length = 387

 Score = 31.6 bits (70), Expect = 0.100,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 28/67 (41%), Gaps = 11/67 (16%)

Query: 37 KLKATDNCSICYTNYLEDEYPLVVELPHCHHKFDLECLSVWLSRST-----TCPLCRDNV 91
          KL  T  CSIC+      +Y  V     C H +   CL  W S  T     +CP CR  V
Sbjct: 23 KLLDTTICSICH------DYMFVPMTTECGHSYCYTCLKTWFSSDTNRGGLSCPECRAIV 76

Query: 92 MGHRIIN 98
              I+N
Sbjct: 77 NRIPIVN 83

>AGL217W [4095] [Homologous to ScYOL054W - SH]
          complement(290043..291287) [1245 bp, 414 aa]
          Length = 414

 Score = 31.2 bits (69), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 33/67 (49%), Gaps = 10/67 (14%)

Query: 36 KKLKATDNCSICYTNYLEDEYPLVVELPHCHHKFDLECLSVWLSRSTT----CPLCRDNV 91
          +KL  T  C+IC+      +Y  V  +  C H +   C+S WL+ +++    CP CR ++
Sbjct: 30 RKLLETTICTICH------DYMYVPVMTGCGHNYCYFCISNWLNNTSSTELNCPQCRSSI 83

Query: 92 MGHRIIN 98
               +N
Sbjct: 84 TSMPSLN 90

>YHL010C (YHL010C) [2276] chr8 complement(81959..83716) Protein that
           binds in vitro to proteins containing canonical nuclear
           localization signal, has similarity to human BRAP2
           breast cancer-associated protein which may regulate
           protein import into the nucleus [1758 bp, 585 aa]
          Length = 585

 Score = 31.2 bits (69), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 26/45 (57%), Gaps = 4/45 (8%)

Query: 44  CSICYTNYLEDEYPLVVELPHCHHKFDLECLSVWLSRSTTCPLCR 88
           C +C    ++ E   +V +P C H F  +CL+ W  +++ CP+CR
Sbjct: 240 CPVCLER-MDSETTGLVTIP-CQHTFHCQCLNKW--KNSRCPVCR 280

>YOL054W (YOL054W) [4765] chr15 (228612..229832) Protein required
          for normal resistance to NaCl and for normal mating
          efficiency of MATa cells, contains a C3HC4-type zinc
          finger [1221 bp, 406 aa]
          Length = 406

 Score = 30.8 bits (68), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 25/52 (48%), Gaps = 10/52 (19%)

Query: 44 CSICYTNYLEDEYPLVVELPHCHHKFDLECLSVWLSRST----TCPLCRDNV 91
          CSIC+      +Y  V  +  C H +   CL+ W + +T     CP CR ++
Sbjct: 30 CSICH------DYMFVPMMTPCGHNYCYGCLNTWFASNTQKELACPQCRSDI 75

>Kwal_26.8090
          Length = 520

 Score = 30.8 bits (68), Expect = 0.18,   Method: Composition-based stats.
 Identities = 19/60 (31%), Positives = 29/60 (48%), Gaps = 6/60 (10%)

Query: 31  PRINKKKLKATD--NCSICYTNYLEDEYPLVVELPHCHHKFDLECLSVWLSRSTTCPLCR 88
           P   KK+++ T+   C +C    L+ E   +  +P C H F   CL+ W      CP+CR
Sbjct: 212 PFTAKKEVQDTELPTCPVCLER-LDSEVTGLATIP-CQHTFHCVCLNKW--GDNRCPVCR 267

>KLLA0B07799g complement(682960..686643)
            gi|16611806|gb|AAL27369.1|AF421953_1 Kluyveromyces lactis
            GDP/GTP exchange factor Rom2p, start by similarity
          Length = 1227

 Score = 30.8 bits (68), Expect = 0.19,   Method: Composition-based stats.
 Identities = 20/60 (33%), Positives = 28/60 (46%), Gaps = 5/60 (8%)

Query: 34   NKKKLKATDNCSICYTNYLEDEYPLVVELPHCHHK-----FDLECLSVWLSRSTTCPLCR 88
            N KKL  T + S     Y E E+PL+ E  H   K     FD E +S+   ++  C  C+
Sbjct: 1026 NGKKLIVTAHTSHNSIKYFEHEHPLLHEKKHTKKKFTEVEFDSEPVSISFLKANLCIGCK 1085

>CAGL0H02651g 238495..243129 similar to sp|Q04781 Saccharomyces
            cerevisiae YMR247c, start by similarity
          Length = 1544

 Score = 30.8 bits (68), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 28/62 (45%), Gaps = 3/62 (4%)

Query: 37   KLKATDNCSICYTNYLEDEYPLVVEL-PHCHHKFDLECLSVWL--SRSTTCPLCRDNVMG 93
            +    + C+ICY+     +  L  +    C +KF   CL  W   S + TCPLCR  +  
Sbjct: 1483 QFSGFEECAICYSILHAVDRKLPTKTCSTCKNKFHGACLYKWFRSSGNNTCPLCRSEINF 1542

Query: 94   HR 95
             R
Sbjct: 1543 RR 1544

>ABR104W [696] [Homologous to ScYPR093C - SH]
          complement(574067..575053) [987 bp, 328 aa]
          Length = 328

 Score = 30.0 bits (66), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 25/50 (50%), Gaps = 7/50 (14%)

Query: 42 DNCSICYTNYLEDEYPLVVELPHCHHKFDLECLSVWL---SRSTTCPLCR 88
          D CSIC+    E     V  L  C H++ L C+  W    S + +CP+CR
Sbjct: 16 DECSICW----ESMPSGVGRLMPCGHEYHLACIRKWFHLHSGNRSCPVCR 61

>YLR247C (YLR247C) [3643] chr12 complement(628686..633356) Protein
            containing an SNF2 related N-terminal domain, a C3HC4
            type (RING) zinc finger, and a helicase conserved
            C-terminal domain, has a region of low similarity to a
            region of transcription termination factor RNA polymerase
            II (human TTF2) [4671 bp, 1556 aa]
          Length = 1556

 Score = 30.0 bits (66), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 37/87 (42%), Gaps = 17/87 (19%)

Query: 34   NKKKLKATDN------CSICYTNYLEDEYPLVVELPHCHHKFDLECLSVWLSRSTTCPLC 87
            N  +LK T N      CSIC     E E   +++   C H F   C+  WL   + CP+C
Sbjct: 1223 NLSRLKDTLNDNQILSCSICLG---EVEIGAIIK---CGHYFCKSCILTWLRAHSKCPIC 1276

Query: 88   R-----DNVMGHRIINEIDTTEAELEE 109
            +       V   +  N  +  E E++E
Sbjct: 1277 KGFCSISEVYNFKFKNSTEKREKEIQE 1303

>AFR275W [3467] [Homologous to ScYKL034W (TUL1) - NSH]
           complement(928488..930749) [2262 bp, 753 aa]
          Length = 753

 Score = 30.0 bits (66), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 11/24 (45%), Positives = 13/24 (54%)

Query: 65  CHHKFDLECLSVWLSRSTTCPLCR 88
           C H F   CL  W+S    CP+CR
Sbjct: 724 CSHLFHTGCLENWMSYKLQCPVCR 747

>CAGL0K02563g complement(230983..232743) similar to sp|P38748
           Saccharomyces cerevisiae YHL010c, hypothetical start
          Length = 586

 Score = 29.6 bits (65), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 25/45 (55%), Gaps = 4/45 (8%)

Query: 44  CSICYTNYLEDEYPLVVELPHCHHKFDLECLSVWLSRSTTCPLCR 88
           C +C    ++ E   ++ +P C H F  +CL  W  +++ CP+CR
Sbjct: 247 CPVCLER-MDSETTGLITIP-CQHTFHCQCLDKW--KNSKCPVCR 287

>CAGL0B05049g 487186..491598 some similarities with tr|Q06554
            Saccharomyces cerevisiae YLR247c, hypothetical start
          Length = 1470

 Score = 29.6 bits (65), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 15/27 (55%)

Query: 62   LPHCHHKFDLECLSVWLSRSTTCPLCR 88
            + +C H F   C+  WL    TCPLC+
Sbjct: 1176 MVNCGHLFCTSCIFSWLKNRKTCPLCK 1202

>Scas_665.1
          Length = 392

 Score = 29.6 bits (65), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 24/52 (46%), Gaps = 10/52 (19%)

Query: 44 CSICYTNYLEDEYPLVVELPHCHHKFDLECLSVWLSRST----TCPLCRDNV 91
          C+IC       EY  V  +  C H +   CL  W+S ++     CP CR ++
Sbjct: 30 CTICS------EYMFVPMMTSCGHNYCYGCLKSWISTNSKKELACPQCRSDI 75

>Sklu_1785.3 YOL054W, Contig c1785 2663-3658 reverse complement
          Length = 331

 Score = 29.6 bits (65), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 24/45 (53%), Gaps = 4/45 (8%)

Query: 58 LVVELPHCHHKFDLECLSVWLSRST----TCPLCRDNVMGHRIIN 98
          LV  +  C H +  +C+S WL+ +     TCP CR +V    ++N
Sbjct: 2  LVPVMTSCGHNYCYDCISNWLNNNNATELTCPQCRTSVSVPPVLN 46

>Sklu_2337.2 YPR093C, Contig c2337 3730-4698 reverse complement
          Length = 322

 Score = 29.3 bits (64), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 23/47 (48%), Gaps = 6/47 (12%)

Query: 44 CSICYTNYLEDEYPLVVELPHCHHKFDLECLSVWLSRST--TCPLCR 88
          CSIC    LE     +  L  C H++ LEC+  W + S    CP CR
Sbjct: 6  CSIC----LEALGQNIGRLVTCQHEYHLECIREWHNHSQDFKCPTCR 48

>KLLA0F25740g complement(2389226..2390779) similar to sp|P38748
           Saccharomyces cerevisiae YHL010c singleton, start by
           similarity
          Length = 517

 Score = 28.9 bits (63), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 23/45 (51%), Gaps = 4/45 (8%)

Query: 44  CSICYTNYLEDEYPLVVELPHCHHKFDLECLSVWLSRSTTCPLCR 88
           C +C    L+ E   +V  P C H F  +CL  W  ++  CP+CR
Sbjct: 215 CPVCLEK-LDSEVTGLVTTP-CQHTFHCKCLDQW--KNGNCPVCR 255

>AGL079C [4232] [Homologous to ScYHL010C - SH] (557422..558942)
           [1521 bp, 506 aa]
          Length = 506

 Score = 28.9 bits (63), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 22/58 (37%), Gaps = 4/58 (6%)

Query: 31  PRINKKKLKATDNCSICYTNYLEDEYPLVVELPHCHHKFDLECLSVWLSRSTTCPLCR 88
           P  N   +     C +C      D   L+     C H F  +CL  W  +   CP+CR
Sbjct: 199 PFTNGSGMVELPTCPVCLERMDSDTTGLITTA--CQHTFHCQCLDKW--KDGRCPVCR 252

>Scas_685.9
          Length = 200

 Score = 28.5 bits (62), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 30/57 (52%), Gaps = 6/57 (10%)

Query: 3   PESLQEEWLQEMDKGKSAGCPDTFAASLPRINKKKLKATDNCSICYTNYLEDEYPLV 59
           PE +  E L  +D+GK++G  D    S+    KK+ K  +  S+    Y ED++ ++
Sbjct: 126 PEDVMLERL--LDRGKTSGRVDDNIESI----KKRFKTFEETSMPVVKYFEDQHKVI 176

>Sklu_1676.3 YDR265W, Contig c1676 2766-3071 reverse complement
          Length = 101

 Score = 27.7 bits (60), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 27/70 (38%), Gaps = 10/70 (14%)

Query: 28 ASLPRINKKKLKATDNCSICYTNYLEDEYPLVVELPHCHHKFDLECLSVWLSRSTTCPLC 87
          A +P IN+   K    C +C T   +           C H F   C+  W    + CPLC
Sbjct: 39 AQMPFINESSRK----CILCLTEMKDPS------CAPCGHIFCWNCIINWCKERSECPLC 88

Query: 88 RDNVMGHRII 97
          R   +   I+
Sbjct: 89 RQKCLKQSIL 98

>YPR093C (YPR093C) [5516] chr16 complement(719554..720420) Protein
          containing a C3HC4 type (RING) zinc finger, which may
          mediate protein-protein interactions [867 bp, 288 aa]
          Length = 288

 Score = 28.5 bits (62), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 23/47 (48%), Gaps = 4/47 (8%)

Query: 44 CSICYTNYLEDEYPLVVELPHCHHKFDLECLSVW--LSRSTTCPLCR 88
          C IC  +  E E    + +  C HKF L C+  W   S +  CP+CR
Sbjct: 4  CPICLADDQEGEQFGCLNV--CGHKFHLNCIREWHKYSINLKCPICR 48

>Scas_718.77
          Length = 128

 Score = 28.1 bits (61), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 24/56 (42%), Gaps = 10/56 (17%)

Query: 44  CSICYTNY----LEDEYPLV---VELPHCHHKFDLECLSVWLSRST---TCPLCRD 89
           C IC   Y        +P V   V +  C H F + C+  WL+ +     CP+CR 
Sbjct: 46  CGICRAGYNAVCPSCSHPGVTCPVVVGTCQHAFHVHCVVPWLATAAARGACPMCRQ 101

>CAGL0I01958g 162266..165565 weakly similar to sp|P38850
           Saccharomyces cerevisiae YHR154w ESC4 Establishes Silent
           Chromatin, hypothetical start
          Length = 1099

 Score = 28.5 bits (62), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 22/40 (55%), Gaps = 1/40 (2%)

Query: 23  PDTFAASLPRINKKKLKATDNCSICYTNYLEDEYPLVVEL 62
           PDT A  LPR  +K  +  D  ++ YTNY  ++   + +L
Sbjct: 356 PDTNAICLPRRRRKLFRKQD-LAVTYTNYFGEQRTYLQQL 394

>Scas_573.9
          Length = 1502

 Score = 28.5 bits (62), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 29/67 (43%), Gaps = 7/67 (10%)

Query: 44   CSICYTNYLEDEYPLVVELPHCHHKFDLECLSVWLSRSTTCPLCRDNVMGHRIINEIDTT 103
            CSIC    L+D    +  +  C H F   C++ WL     CP+C+       I N     
Sbjct: 1191 CSIC----LQD--ISLGSMLKCGHFFCKRCITSWLKNKKNCPMCKMVTTASEIYN-FKFK 1243

Query: 104  EAELEED 110
            E +LE D
Sbjct: 1244 EEKLEGD 1250

>Scas_633.6*
          Length = 3025

 Score = 28.5 bits (62), Expect = 1.4,   Method: Composition-based stats.
 Identities = 15/47 (31%), Positives = 20/47 (42%)

Query: 61   ELPHCHHKFDLECLSVWLSRSTTCPLCRDNVMGHRIINEIDTTEAEL 107
            E PH H    + CLS W+    TC    D+  G    + I  T  +L
Sbjct: 2351 EFPHAHIPTIVSCLSYWIPNLFTCVYLADDEEGPEFTSHIIRTLIKL 2397

>Kwal_55.19999
          Length = 152

 Score = 27.3 bits (59), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 11/33 (33%), Positives = 15/33 (45%)

Query: 65  CHHKFDLECLSVWLSRSTTCPLCRDNVMGHRII 97
           C H F  +CL  W +    CPLCR       ++
Sbjct: 117 CGHVFCWKCLLSWCNERPECPLCRQTCHAQNVL 149

>AAL030C [157] [Homologous to ScYLR247C - SH] (284758..289377) [4620
            bp, 1539 aa]
          Length = 1539

 Score = 27.7 bits (60), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 10/22 (45%), Positives = 14/22 (63%)

Query: 67   HKFDLECLSVWLSRSTTCPLCR 88
            H +  EC+S WL    +CPLC+
Sbjct: 1236 HFYCQECISSWLETKQSCPLCK 1257

>CAGL0M08690g complement(865182..866168) similar to sp|Q05568
           Saccharomyces cerevisiae YDR265w peroxisomal assembly
           protein - peroxin, hypothetical start
          Length = 328

 Score = 27.3 bits (59), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 10/33 (30%), Positives = 17/33 (51%)

Query: 65  CHHKFDLECLSVWLSRSTTCPLCRDNVMGHRII 97
           C H F  +C++ W   +  CPLCR      +++
Sbjct: 292 CGHVFCWDCITDWTKENPECPLCRQRSYPQQVL 324

>KLLA0C18260g 1613311..1614000 similar to sp|P53769 Saccharomyces
           cerevisiae YLR323c singleton, start by similarity
          Length = 229

 Score = 26.9 bits (58), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 21/51 (41%), Gaps = 6/51 (11%)

Query: 43  NCSICYTNYLEDEYPLVVELPHCHHKFDLECLSVWLSRSTTCPLCRDNVMG 93
            C +C   Y     P+V +   C+H F   C    +  ST CP+C     G
Sbjct: 170 RCFLCKKEYTS---PVVTK---CNHYFCSSCFMKQMKVSTNCPICGKETEG 214

>KLLA0E18601g complement(1645113..1647065) some similarities with
           ca|CA2706|IPF11006 Candida albicans unknown function,
           hypothetical start
          Length = 650

 Score = 26.9 bits (58), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 21/50 (42%), Gaps = 1/50 (2%)

Query: 43  NCSICYTNYLEDEYPLVVELPHCHHKFDLECLSVWLSRSTTCPLCRDNVM 92
           NC IC   Y+      VV +  C H     C   ++  S  CP C  +V+
Sbjct: 370 NCPIC-REYMFTSTMAVVYMDPCGHAIHQHCFDEYIKHSYKCPNCNVSVI 418

>Kwal_55.21206
          Length = 275

 Score = 26.9 bits (58), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 12/38 (31%), Positives = 21/38 (55%), Gaps = 1/38 (2%)

Query: 62  LPHCHHKFDLECLSVWLSRSTT-CPLCRDNVMGHRIIN 98
           L  C+H F   C+  W+ R++  CPLC+ +    R+ +
Sbjct: 135 LLGCNHVFHTYCIDQWICRNSACCPLCKRSYSLPRVFH 172

>Scas_615.13
          Length = 330

 Score = 26.6 bits (57), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 15/33 (45%)

Query: 65  CHHKFDLECLSVWLSRSTTCPLCRDNVMGHRII 97
           C H F  EC+  W      CPLCR      +I+
Sbjct: 295 CGHIFCWECILDWCKERPECPLCRQECQIQQIL 327

>Scas_610.13
          Length = 678

 Score = 26.9 bits (58), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 25/40 (62%), Gaps = 2/40 (5%)

Query: 37  KLKATDNCSICYTNYLEDEYPLVVELPHCHHKFDLECLSV 76
           +LK   +  I Y   +E+E  +++ELP  + KF++E LS+
Sbjct: 442 QLKKESSRLISYGVTIENENKVIIELP--NEKFEIELLSL 479

>AAR049C [235] [Homologous to ScYCR066W (RAD18) - SH]
          (428904..430235) [1332 bp, 443 aa]
          Length = 443

 Score = 26.6 bits (57), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 10/26 (38%), Positives = 15/26 (57%)

Query: 62 LPHCHHKFDLECLSVWLSRSTTCPLC 87
          L  C H F   C+  +L++ + CPLC
Sbjct: 44 LTQCGHTFCSLCIREYLNKESRCPLC 69

>CAGL0A03432g 345192..348647 similar to sp|P32849 Saccharomyces
           cerevisiae YLR032w RAD5, hypothetical start
          Length = 1151

 Score = 26.6 bits (57), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 25/58 (43%), Gaps = 9/58 (15%)

Query: 44  CSICYTNYLEDEYPLVVELPHCHHKFDLECLSVW------LSRSTTCPLCRDNVMGHR 95
           CSIC    +E    +V E   C H F  ECL  +       S    CP CR ++  +R
Sbjct: 897 CSICTAEPIESSSAVVTE---CEHVFCKECLEEYGNFQKEKSLQQKCPNCRRDINLNR 951

>YDR265W (PEX10) [1098] chr4 (998856..999869) Peroxisomal biogenesis
           protein (peroxin) [1014 bp, 337 aa]
          Length = 337

 Score = 26.6 bits (57), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 14/33 (42%)

Query: 65  CHHKFDLECLSVWLSRSTTCPLCRDNVMGHRII 97
           C H F   CL  W      CPLCR +     I+
Sbjct: 301 CGHLFCWSCLMSWCKERPECPLCRQHCQPQEIL 333

>Kwal_47.17638
          Length = 248

 Score = 26.2 bits (56), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 14/51 (27%), Positives = 23/51 (45%), Gaps = 6/51 (11%)

Query: 43  NCSICYTNYLEDEYPLVVELPHCHHKFDLECLSVWLSRSTTCPLCRDNVMG 93
            C IC  +Y   + P+V +   C H F   C      ++T C +C ++  G
Sbjct: 187 KCLICKGDY---KKPVVTK---CQHYFCSSCFLAKARKTTKCVVCGEDTQG 231

>CAGL0I08261g 803722..805752 similar to sp|P32569 Saccharomyces
           cerevisiae YER022w SRB4 DNA-directed RNA polymerase II,
           hypothetical start
          Length = 676

 Score = 26.2 bits (56), Expect = 7.5,   Method: Composition-based stats.
 Identities = 13/31 (41%), Positives = 22/31 (70%), Gaps = 2/31 (6%)

Query: 46  ICYTNYLEDEYPLVVELPHCHHKFDLECLSV 76
           I Y   +E+E+ +V+ELP  + KF++E LS+
Sbjct: 448 ISYGVTVENEHKIVIELP--NEKFEIEYLSL 476

>AER390W [2890] [Homologous to ScYDR265W (PEX10) - SH]
           complement(1370316..1370364,1370423..1371324) [951 bp,
           316 aa]
          Length = 316

 Score = 26.2 bits (56), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 11/34 (32%), Positives = 15/34 (44%)

Query: 65  CHHKFDLECLSVWLSRSTTCPLCRDNVMGHRIIN 98
           C H F   C+  W +    CPLCR +     I+ 
Sbjct: 281 CGHMFCWACVMQWCNERNECPLCRQHCTKQSILQ 314

>Kwal_33.15475
          Length = 783

 Score = 26.2 bits (56), Expect = 8.1,   Method: Composition-based stats.
 Identities = 11/35 (31%), Positives = 16/35 (45%)

Query: 67  HKFDLECLSVWLSRSTTCPLCRDNVMGHRIINEID 101
           H +++ CL V    S     CR N + H +I   D
Sbjct: 549 HGYEISCLDVNADSSIIASACRSNNLQHAVIKFFD 583

>CAGL0G03553g complement(345057..345689) weakly similar to sp|P40072
           Saccharomyces cerevisiae YER116c YEU6, hypothetical
           start
          Length = 210

 Score = 25.8 bits (55), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 25/59 (42%), Gaps = 12/59 (20%)

Query: 44  CSICYTNYLEDEYPLVVELPHCHHKFDLECLSVWLSRSTT------CPLCRDNVMGHRI 96
           C IC+      E P V  +  C H F  ECL   ++ S T      C LCR  +   +I
Sbjct: 146 CPICF------EPPDVAIMTPCGHVFCCECLFQMVNNSRTPRKGGVCALCRKTINMKQI 198

>KLLA0C15697g 1360289..1361203 weakly similar to sgd|S0006297
          Saccharomyces cerevisiae YPR093c, start by similarity
          Length = 304

 Score = 25.8 bits (55), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 21/47 (44%), Gaps = 5/47 (10%)

Query: 44 CSICYTNYLEDEYPLVVELPHCHHKFDLECLSVW--LSRSTTCPLCR 88
          C IC  +  E +     EL  C H++ + C+  W   S    CP CR
Sbjct: 5  CGICLESMNETDQG---ELLPCEHRYHVSCIRKWHLYSNDFKCPTCR 48

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.134    0.437 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 4,136,171
Number of extensions: 161966
Number of successful extensions: 488
Number of sequences better than 10.0: 104
Number of HSP's gapped: 477
Number of HSP's successfully gapped: 105
Length of query: 114
Length of database: 16,596,109
Length adjustment: 84
Effective length of query: 30
Effective length of database: 13,688,197
Effective search space: 410645910
Effective search space used: 410645910
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 54 (25.4 bits)