Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YBR061C (TRM7)31030516310.0
Scas_718.4630930513580.0
CAGL0H10252g30930813060.0
Sklu_2357.331530612821e-179
KLLA0F18414g30130512321e-172
Kwal_27.1054330330512091e-169
AGR036W30631011101e-153
Kwal_33.130548302164222e-46
AFR734C8452174223e-46
CAGL0B00484g8372164171e-45
Scas_642.128392164161e-45
YCL054W (SPB1)8412164152e-45
Sklu_2421.108492164064e-44
KLLA0C00737g8332164021e-43
KLLA0B01980g2892512202e-20
CAGL0H08954g2812431893e-16
Sklu_2160.23151571762e-14
Scas_720.46321961753e-14
Kwal_56.241583071381736e-14
AFL117C3031011561e-11
YGL136C (MRM2)3201061542e-11
KLLA0A02541g53162760.17
Scas_702.653352681.7
Kwal_27.1276670771672.0
YFL047W (RGD2)71431653.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YBR061C
         (305 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YBR061C (TRM7) [252] chr2 complement(364747..365679) Methyltrans...   632   0.0  
Scas_718.46                                                           527   0.0  
CAGL0H10252g complement(1002563..1003492) highly similar to sp|P...   507   0.0  
Sklu_2357.3 YBR061C, Contig c2357 3590-4537 reverse complement        498   e-179
KLLA0F18414g complement(1695869..1696774) similar to sp|P38238 S...   479   e-172
Kwal_27.10543                                                         470   e-169
AGR036W [4346] [Homologous to ScYBR061C - SH] complement(774279....   432   e-153
Kwal_33.13054                                                         167   2e-46
AFR734C [3927] [Homologous to ScYCL054W (SPB1) - SH] (1785487..1...   167   3e-46
CAGL0B00484g 35991..38504 highly similar to sp|P25582 Saccharomy...   165   1e-45
Scas_642.12                                                           164   1e-45
YCL054W (SPB1) [493] chr3 (31449..33974) Putative S-adenosyl-met...   164   2e-45
Sklu_2421.10 YCL054W, Contig c2421 13526-16075 reverse complement     160   4e-44
KLLA0C00737g 53188..55689 similar to sp|P25582 Saccharomyces cer...   159   1e-43
KLLA0B01980g complement(173710..174579) similar to sp|P53123 Sac...    89   2e-20
CAGL0H08954g complement(875104..875949) similar to sp|P53123 Sac...    77   3e-16
Sklu_2160.2 YGL136C, Contig c2160 1404-2351                            72   2e-14
Scas_720.46                                                            72   3e-14
Kwal_56.24158                                                          71   6e-14
AFL117C [3078] [Homologous to ScYGL136C (MRM2) - SH] (218993..21...    65   1e-11
YGL136C (MRM2) [1851] chr7 complement(252900..253862) Methyltran...    64   2e-11
KLLA0A02541g 223318..224913 some similarities with sp|P53226 Sac...    34   0.17 
Scas_702.6                                                             31   1.7  
Kwal_27.12766                                                          30   2.0  
YFL047W (RGD2) [1637] chr6 (40421..42565) GTPase activating prot...    30   3.7  

>YBR061C (TRM7) [252] chr2 complement(364747..365679)
           Methyltransferase that methylates 2-prime-O-riboses in
           tRNA anticodon loop, required for optimal protein
           synthesis activity, member of the 2-prime-O-RNA
           methyltransferase family which includes Spb1p, Mrm2p,
           and E. coli FtsJ protein [933 bp, 310 aa]
          Length = 310

 Score =  632 bits (1631), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/305 (100%), Positives = 305/305 (100%)

Query: 1   MGKSSKDKRDLYYRKAKEQGYRARSAFKLLQLNDQFHFLDDPNLKRVVDLCAAPGSWSQV 60
           MGKSSKDKRDLYYRKAKEQGYRARSAFKLLQLNDQFHFLDDPNLKRVVDLCAAPGSWSQV
Sbjct: 1   MGKSSKDKRDLYYRKAKEQGYRARSAFKLLQLNDQFHFLDDPNLKRVVDLCAAPGSWSQV 60

Query: 61  LSRKLFDESPSSDKEDRKIVSVDLQPMSPIPHVTTLQADITHPKTLARILKLFGNEKADF 120
           LSRKLFDESPSSDKEDRKIVSVDLQPMSPIPHVTTLQADITHPKTLARILKLFGNEKADF
Sbjct: 61  LSRKLFDESPSSDKEDRKIVSVDLQPMSPIPHVTTLQADITHPKTLARILKLFGNEKADF 120

Query: 121 VCSDGAPDVTGLHDLDEYVQQQLIMSALQLTACILKKGGTFVAKIFRGRDIDMLYSQLGY 180
           VCSDGAPDVTGLHDLDEYVQQQLIMSALQLTACILKKGGTFVAKIFRGRDIDMLYSQLGY
Sbjct: 121 VCSDGAPDVTGLHDLDEYVQQQLIMSALQLTACILKKGGTFVAKIFRGRDIDMLYSQLGY 180

Query: 181 LFDKIVCAKPRSSRGTSLEAFIVCLGYNPPSNWTPKLDVNTSVDEFFQGCFLNKLCISDK 240
           LFDKIVCAKPRSSRGTSLEAFIVCLGYNPPSNWTPKLDVNTSVDEFFQGCFLNKLCISDK
Sbjct: 181 LFDKIVCAKPRSSRGTSLEAFIVCLGYNPPSNWTPKLDVNTSVDEFFQGCFLNKLCISDK 240

Query: 241 LSHWNEEERNIAEFMACGSLQSFDSDATYHDLPSSVAGTSSSLDPVQSPTNPPYKKALEL 300
           LSHWNEEERNIAEFMACGSLQSFDSDATYHDLPSSVAGTSSSLDPVQSPTNPPYKKALEL
Sbjct: 241 LSHWNEEERNIAEFMACGSLQSFDSDATYHDLPSSVAGTSSSLDPVQSPTNPPYKKALEL 300

Query: 301 KRSGK 305
           KRSGK
Sbjct: 301 KRSGK 305

>Scas_718.46
          Length = 309

 Score =  527 bits (1358), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 253/305 (82%), Positives = 276/305 (90%), Gaps = 1/305 (0%)

Query: 1   MGKSSKDKRDLYYRKAKEQGYRARSAFKLLQLNDQFHFLDDPNLKRVVDLCAAPGSWSQV 60
           MGK+SKDKRD+YYRKAKEQG+RARSAFKLLQLND FHFLDDPNLKRVVDLCAAPGSWSQV
Sbjct: 1   MGKNSKDKRDMYYRKAKEQGFRARSAFKLLQLNDDFHFLDDPNLKRVVDLCAAPGSWSQV 60

Query: 61  LSRKLFDESPSSDKEDRKIVSVDLQPMSPIPHVTTLQADITHPKTLARILKLFGNEKADF 120
           LS+KLFD   + + +DRKIV+VDLQPMSPI HVTTLQADITHPKTL RIL LFGNEKADF
Sbjct: 61  LSQKLFDGKTAEEIKDRKIVAVDLQPMSPINHVTTLQADITHPKTLKRILDLFGNEKADF 120

Query: 121 VCSDGAPDVTGLHDLDEYVQQQLIMSALQLTACILKKGGTFVAKIFRGRDIDMLYSQLGY 180
           VCSDGAPDVTGLHDLDEYVQQQLIMSALQLTACILKKGG FVAKIFRGRDIDMLYSQLGY
Sbjct: 121 VCSDGAPDVTGLHDLDEYVQQQLIMSALQLTACILKKGGIFVAKIFRGRDIDMLYSQLGY 180

Query: 181 LFDKIVCAKPRSSRGTSLEAFIVCLGYNPPSNWTPKLDVNTSVDEFFQGCFLNKLCISDK 240
           LFDK+VCAKP+SSRGTSLEAFIVC+GYNPPS+W   LDVN+SV+EFF GC ++KL I DK
Sbjct: 181 LFDKVVCAKPKSSRGTSLEAFIVCIGYNPPSDWVSTLDVNSSVEEFFSGCHMSKLSIHDK 240

Query: 241 LSHWNEEERNIAEFMACGSLQSFDSDATYHDLPSSVAGTSSSLDPVQSPTNPPYKKALEL 300
           L  W E+ER IA+FM+CG+L+SFDSDATYH L       ++SLDPVQSPTNPPYKKALEL
Sbjct: 241 LPSWQEDERTIAKFMSCGNLESFDSDATYH-LDDFKEDLNTSLDPVQSPTNPPYKKALEL 299

Query: 301 KRSGK 305
           KRSGK
Sbjct: 300 KRSGK 304

>CAGL0H10252g complement(1002563..1003492) highly similar to
           sp|P38238 Saccharomyces cerevisiae YBR061c, start by
           similarity
          Length = 309

 Score =  507 bits (1306), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 244/308 (79%), Positives = 271/308 (87%), Gaps = 7/308 (2%)

Query: 1   MGKSSKDKRDLYYRKAKEQGYRARSAFKLLQLNDQFHFLDDPNLKRVVDLCAAPGSWSQV 60
           MGKSSKDKRDLYYRKAKE+GYRARSA+KLLQLN++FHFLDDP LKRVVDLCAAPGSWSQV
Sbjct: 1   MGKSSKDKRDLYYRKAKEEGYRARSAYKLLQLNEEFHFLDDPELKRVVDLCAAPGSWSQV 60

Query: 61  LSRKLFDE-SPSSD--KEDRKIVSVDLQPMSPIPHVTTLQADITHPKTLARILKLFGNEK 117
           LSRKLF E  P +D  ++DRKI++VDLQPMSPI HV TLQADITHP+TL RI +LFGN+K
Sbjct: 61  LSRKLFAEREPVADGQEDDRKIIAVDLQPMSPIDHVITLQADITHPRTLERIYELFGNQK 120

Query: 118 ADFVCSDGAPDVTGLHDLDEYVQQQLIMSALQLTACILKKGGTFVAKIFRGRDIDMLYSQ 177
           ADFVCSDGAPDVTGLHDLDEY+Q QLIMSALQLT C+LK+GGTFVAKIFRGRDIDMLYSQ
Sbjct: 121 ADFVCSDGAPDVTGLHDLDEYIQHQLIMSALQLTTCVLKRGGTFVAKIFRGRDIDMLYSQ 180

Query: 178 LGYLFDKIVCAKPRSSRGTSLEAFIVCLGYNPPSNWTPKLDVNTSVDEFFQGCFLNKLCI 237
           LGYLF+KIVCAKPRSSRGTSLEAFIVC+GYNPP+ W PKLDVN+SV EFF  C L KL I
Sbjct: 181 LGYLFEKIVCAKPRSSRGTSLEAFIVCIGYNPPAGWEPKLDVNSSVTEFFATCDLGKLSI 240

Query: 238 SDKLSHWNEEERNIAEFMACGSLQSFDSDATYHDLPSSVAGTSSSLDPVQSPTNPPYKKA 297
            D L  W ++ R+IA+FMACGSL S+DSDATYHDLP        +LDPVQ+PTNPPYK+A
Sbjct: 241 DDTLQPWKDQPRSIADFMACGSLSSYDSDATYHDLPK----YGVALDPVQAPTNPPYKRA 296

Query: 298 LELKRSGK 305
           LELKR GK
Sbjct: 297 LELKRDGK 304

>Sklu_2357.3 YBR061C, Contig c2357 3590-4537 reverse complement
          Length = 315

 Score =  498 bits (1282), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 238/306 (77%), Positives = 271/306 (88%), Gaps = 3/306 (0%)

Query: 1   MGKSSKDKRDLYYRKAKEQGYRARSAFKLLQLNDQFHFLDDPNLKRVVDLCAAPGSWSQV 60
           MGKSSKDKRDLYYRKAKEQGYRARSAFKLLQLND FHFLD  N+ RVVDLCAAPGSWSQV
Sbjct: 1   MGKSSKDKRDLYYRKAKEQGYRARSAFKLLQLNDHFHFLD--NVTRVVDLCAAPGSWSQV 58

Query: 61  LSRKLFD-ESPSSDKEDRKIVSVDLQPMSPIPHVTTLQADITHPKTLARILKLFGNEKAD 119
           LSRKLFD E  + +K+ +KIV+VDLQPMSPI HVTTLQADITHP TLA+IL+LFG +KAD
Sbjct: 59  LSRKLFDNELENENKQSKKIVAVDLQPMSPIDHVTTLQADITHPGTLAKILELFGGDKAD 118

Query: 120 FVCSDGAPDVTGLHDLDEYVQQQLIMSALQLTACILKKGGTFVAKIFRGRDIDMLYSQLG 179
           FVCSDGAPDVTGLHDLDEYVQQQLI+SALQLT C+LK+GG FVAKIFRGRD+DMLYSQLG
Sbjct: 119 FVCSDGAPDVTGLHDLDEYVQQQLILSALQLTTCLLKEGGCFVAKIFRGRDVDMLYSQLG 178

Query: 180 YLFDKIVCAKPRSSRGTSLEAFIVCLGYNPPSNWTPKLDVNTSVDEFFQGCFLNKLCISD 239
           YLF+++VCAKPRSSRG+SLE+FIVCLGY PP NWTP LDVN S+++FF+GC L +L + D
Sbjct: 179 YLFERVVCAKPRSSRGSSLESFIVCLGYKPPHNWTPHLDVNQSIEDFFRGCDLGRLTLQD 238

Query: 240 KLSHWNEEERNIAEFMACGSLQSFDSDATYHDLPSSVAGTSSSLDPVQSPTNPPYKKALE 299
            L  + +E RNIAEF++CG L SFDSDATYH++  S   + S+LDPVQ+PTNPPYKKALE
Sbjct: 239 NLVEFYDEPRNIAEFVSCGGLDSFDSDATYHNVEGSDVTSKSALDPVQAPTNPPYKKALE 298

Query: 300 LKRSGK 305
           LKRSGK
Sbjct: 299 LKRSGK 304

>KLLA0F18414g complement(1695869..1696774) similar to sp|P38238
           Saccharomyces cerevisiae YBR061c, start by similarity
          Length = 301

 Score =  479 bits (1232), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 234/305 (76%), Positives = 264/305 (86%), Gaps = 9/305 (2%)

Query: 1   MGKSSKDKRDLYYRKAKEQGYRARSAFKLLQLNDQFHFLDDPNLKRVVDLCAAPGSWSQV 60
           MGKSSKDKRDLYYRKAKEQGYRARSAFKLLQL+D FHFL      RVVDLCAAPGSWSQV
Sbjct: 1   MGKSSKDKRDLYYRKAKEQGYRARSAFKLLQLDDDFHFLQ--QAVRVVDLCAAPGSWSQV 58

Query: 61  LSRKLFDESPSSDKEDRKIVSVDLQPMSPIPHVTTLQADITHPKTLARILKLFGNEKADF 120
           LSR+LF +S  SD  DRKIV+VDLQPMSPI +V TLQADITHPKTL  I +LF  +KADF
Sbjct: 59  LSRRLFPQS--SDNSDRKIVAVDLQPMSPIDNVITLQADITHPKTLQTITELFEGKKADF 116

Query: 121 VCSDGAPDVTGLHDLDEYVQQQLIMSALQLTACILKKGGTFVAKIFRGRDIDMLYSQLGY 180
           +CSDGAPDVTGLHDLDEYVQQQLI+SALQL+ C+L+KGG FVAKIFRGRDIDMLYSQLGY
Sbjct: 117 ICSDGAPDVTGLHDLDEYVQQQLILSALQLSTCLLRKGGNFVAKIFRGRDIDMLYSQLGY 176

Query: 181 LFDKIVCAKPRSSRGTSLEAFIVCLGYNPPSNWTPKLDVNTSVDEFFQGCFLNKLCISDK 240
           LF+K++CAKPRSSRGTSLE+FIVCLGYNPP+NW PKLDVN+SV++FFQGC + KL + DK
Sbjct: 177 LFEKVICAKPRSSRGTSLESFIVCLGYNPPANWEPKLDVNSSVEDFFQGCDIGKLRLEDK 236

Query: 241 LSHWNEEERNIAEFMACGSLQSFDSDATYHDLPSSVAGTSSSLDPVQSPTNPPYKKALEL 300
             +++EE R+IA F+ACG L SFDSDATYH     V  ++ +LDPVQSPTNPPYKKALEL
Sbjct: 237 CPNYHEEPRSIATFIACGGLSSFDSDATYH-----VDTSTPALDPVQSPTNPPYKKALEL 291

Query: 301 KRSGK 305
           KR GK
Sbjct: 292 KRRGK 296

>Kwal_27.10543
          Length = 303

 Score =  470 bits (1209), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 225/305 (73%), Positives = 263/305 (86%), Gaps = 7/305 (2%)

Query: 1   MGKSSKDKRDLYYRKAKEQGYRARSAFKLLQLNDQFHFLDDPNLKRVVDLCAAPGSWSQV 60
           MGKSSKDKRDLYYRKAKE+GYRARSAFKLLQL++QFHFLD  N+ RVVDLCAAPGSWSQV
Sbjct: 1   MGKSSKDKRDLYYRKAKEEGYRARSAFKLLQLDEQFHFLD--NVTRVVDLCAAPGSWSQV 58

Query: 61  LSRKLFDESPSSDKEDRKIVSVDLQPMSPIPHVTTLQADITHPKTLARILKLFGNEKADF 120
           LSR+LF E  + +K  ++IVSVDLQPM PI +VTT+QADITHPKTL +I+ LF  EKADF
Sbjct: 59  LSRRLF-EKDTENKGSKRIVSVDLQPMFPIENVTTIQADITHPKTLNKIMDLFDGEKADF 117

Query: 121 VCSDGAPDVTGLHDLDEYVQQQLIMSALQLTACILKKGGTFVAKIFRGRDIDMLYSQLGY 180
           VCSDGAPDVTGLHDLDEYVQQQLI+SALQLT C+L++GG FVAKIFRGRDIDMLYSQL +
Sbjct: 118 VCSDGAPDVTGLHDLDEYVQQQLILSALQLTTCLLREGGVFVAKIFRGRDIDMLYSQLSF 177

Query: 181 LFDKIVCAKPRSSRGTSLEAFIVCLGYNPPSNWTPKLDVNTSVDEFFQGCFLNKLCISDK 240
           LF+++VCAKPRSSRGTSLE+FIVCLGY PP NWTP LDVN SV++FFQGC + +L + DK
Sbjct: 178 LFERVVCAKPRSSRGTSLESFIVCLGYKPPKNWTPHLDVNMSVEDFFQGCDIGRLSLDDK 237

Query: 241 LSHWNEEERNIAEFMACGSLQSFDSDATYHDLPSSVAGTSSSLDPVQSPTNPPYKKALEL 300
           L  ++ + R++AEF++CG L SFDSDATYHD+P        +L+PVQ PTNPPYK+ALEL
Sbjct: 238 LPDYHVQPRSVAEFISCGGLDSFDSDATYHDVPVD----RVTLNPVQPPTNPPYKRALEL 293

Query: 301 KRSGK 305
           KR GK
Sbjct: 294 KRKGK 298

>AGR036W [4346] [Homologous to ScYBR061C - SH]
           complement(774279..775199) [921 bp, 306 aa]
          Length = 306

 Score =  432 bits (1110), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 222/310 (71%), Positives = 252/310 (81%), Gaps = 14/310 (4%)

Query: 1   MGKSSKDKRDLYYRKAKEQGYRARSAFKLLQLNDQFHFLDDPNLKRVVDLCAAPGSWSQV 60
           MGKSSKDKRDLYYRKAKEQG+RARSAFKLLQLND+FHFLD   ++RVVDLCAAPGSWSQV
Sbjct: 1   MGKSSKDKRDLYYRKAKEQGFRARSAFKLLQLNDEFHFLD--GVQRVVDLCAAPGSWSQV 58

Query: 61  LSRKLFDESPSSDKEDRKIVSVDLQPMSPIPHVTTLQADITHPKTLARILKLFGNEKADF 120
           LSR+LF   P      ++IV+VDLQPMS I HVTTLQADITHP+TL +I++LF  EKADF
Sbjct: 59  LSRELF---PDGKNTKKRIVAVDLQPMSRIEHVTTLQADITHPRTLTKIIELFKGEKADF 115

Query: 121 VCSDGAPDVTGLHDLDEYVQQQLIMSALQLTACILKKGGTFVAKIFRGRDIDMLYSQLGY 180
           VCSDGAPDVTGLHDLDEYVQQQLI+SAL+LT  +L  GG FVAKIFRGRDIDMLYSQLG 
Sbjct: 116 VCSDGAPDVTGLHDLDEYVQQQLILSALKLTVSLLAPGGCFVAKIFRGRDIDMLYSQLGL 175

Query: 181 LFDKIVCAKPRSSRGTSLEAFIVCLGYNPPSNWTPKLDVNTSVDEFFQGCFLN-----KL 235
           LFDK+ CAKPRSSRGTSLE+FIVC GY PP +W P ++ N SV+EFF+  F N      L
Sbjct: 176 LFDKVTCAKPRSSRGTSLESFIVCQGYTPPLSWAPNIEKNVSVEEFFEEFFQNWSIQQPL 235

Query: 236 CISDKLSHWNEEERNIAEFMACGSLQSFDSDATYHDLPSSVAGTSSSLDPVQSPTNPPYK 295
                L  ++E  R IA F++CG L SFDSDATYHDLP S    +++LDPVQSPTNPPYK
Sbjct: 236 TPGRPLPMYSEGHRGIAPFISCGGLDSFDSDATYHDLPKS----ATALDPVQSPTNPPYK 291

Query: 296 KALELKRSGK 305
           +ALELKRSGK
Sbjct: 292 RALELKRSGK 301

>Kwal_33.13054
          Length = 830

 Score =  167 bits (422), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 93/216 (43%), Positives = 127/216 (58%), Gaps = 11/216 (5%)

Query: 3   KSSKDKRDLYYRKAKEQGYRARSAFKLLQLNDQF-HFLDDPNLKRVVDLCAAPGSWSQVL 61
           K+SK + D YY  AKE+GYRARS+FK++Q+N++F HF++   +  V+DLCAAPGSW QV 
Sbjct: 7   KNSKGRLDRYYYLAKEKGYRARSSFKIIQINEKFGHFMEKSKV--VIDLCAAPGSWCQVA 64

Query: 62  SRKLFDESPSSDKEDRKIVSVDLQPMSPIPHVTTLQADITHPKTLARILKLFGNEKADFV 121
           S    +  P +      I+ VD+ PM P+P+V T Q+DIT     +++       KAD V
Sbjct: 65  S----NLCPVNSL----IIGVDIVPMKPMPNVITFQSDITTEDCRSKLRGYMKTWKADTV 116

Query: 122 CSDGAPDVTGLHDLDEYVQQQLIMSALQLTACILKKGGTFVAKIFRGRDIDMLYSQLGYL 181
             DGAP+V      D + Q  L + AL+L    L  GGTFV KIFR +D + L      L
Sbjct: 117 LHDGAPNVGLGWAQDAFTQSHLTLQALKLAVENLVVGGTFVTKIFRSKDYNKLIWVFSQL 176

Query: 182 FDKIVCAKPRSSRGTSLEAFIVCLGYNPPSNWTPKL 217
           FDK+   KP +SR  S E F+VC G+  P    P+L
Sbjct: 177 FDKVEATKPPASRNVSAEIFVVCKGFKAPKKLDPRL 212

>AFR734C [3927] [Homologous to ScYCL054W (SPB1) - SH]
           (1785487..1788024) [2538 bp, 845 aa]
          Length = 845

 Score =  167 bits (422), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 96/217 (44%), Positives = 131/217 (60%), Gaps = 13/217 (5%)

Query: 3   KSSKDKRDLYYRKAKEQGYRARSAFKLLQLNDQF-HFLDDPNLKRVVDLCAAPGSWSQVL 61
           K+SK + D YY  AKE+GYRARS+FK++Q+N++F HFL+   +  V+DLCAAPGSW QV 
Sbjct: 7   KNSKGRLDRYYYLAKEKGYRARSSFKIIQINEKFGHFLEKSKV--VIDLCAAPGSWCQVA 64

Query: 62  SRKLFDESPSSDKEDRKIVSVDLQPMSPIPHVTTLQADITHPKTLARILKLFGNEKADFV 121
           S    +  P +      I+ VD+ PM P+P+V T Q+DIT     +++       KAD V
Sbjct: 65  S----NLCPVNSL----IIGVDIVPMQPMPNVITFQSDITTEDCRSKLRGYMKTWKADTV 116

Query: 122 CSDGAPDVTGLHDL-DEYVQQQLIMSALQLTACILKKGGTFVAKIFRGRDIDMLYSQLGY 180
             DGAP+V GL+ + D + Q  L + AL+L    L  GGTFV KIFR +D + L      
Sbjct: 117 LHDGAPNV-GLNWVQDAFTQSHLTLQALKLAVENLVVGGTFVTKIFRSKDYNKLMWVFQQ 175

Query: 181 LFDKIVCAKPRSSRGTSLEAFIVCLGYNPPSNWTPKL 217
           LFDK+   KP +SR  S E F+VC G+  P    P+L
Sbjct: 176 LFDKVEATKPPASRNVSAEIFVVCKGFKAPKKLDPRL 212

>CAGL0B00484g 35991..38504 highly similar to sp|P25582 Saccharomyces
           cerevisiae YCL054w SPB1, start by similarity
          Length = 837

 Score =  165 bits (417), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 94/216 (43%), Positives = 125/216 (57%), Gaps = 11/216 (5%)

Query: 3   KSSKDKRDLYYRKAKEQGYRARSAFKLLQLNDQF-HFLDDPNLKRVVDLCAAPGSWSQVL 61
           K+SK + D YY  AKE+GYRARS+FK++Q+N++F HFL+    K V+DLCAAPGSW QV 
Sbjct: 7   KNSKGRLDRYYYLAKEKGYRARSSFKIIQINEKFGHFLEKS--KVVIDLCAAPGSWCQVA 64

Query: 62  SRKLFDESPSSDKEDRKIVSVDLQPMSPIPHVTTLQADITHPKTLARILKLFGNEKADFV 121
           S+     S         I+ VD+ PM P+P+V T Q+DIT     +R+       KAD V
Sbjct: 65  SKLCPVNSL--------IIGVDIVPMKPMPNVITFQSDITTEDCRSRLRGYMKTWKADTV 116

Query: 122 CSDGAPDVTGLHDLDEYVQQQLIMSALQLTACILKKGGTFVAKIFRGRDIDMLYSQLGYL 181
             DGAP+V      D + Q  L + AL+L    L   GTFV KIFR +D + L      L
Sbjct: 117 LHDGAPNVGLGWAQDAFTQSHLTLQALKLAVENLVVNGTFVTKIFRSKDYNKLIWVFQQL 176

Query: 182 FDKIVCAKPRSSRGTSLEAFIVCLGYNPPSNWTPKL 217
           F+K+   KP +SR  S E F+VC G+  P    P+L
Sbjct: 177 FEKVEATKPPASRNVSAEIFVVCKGFKAPKKLDPRL 212

>Scas_642.12
          Length = 839

 Score =  164 bits (416), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 93/216 (43%), Positives = 126/216 (58%), Gaps = 11/216 (5%)

Query: 3   KSSKDKRDLYYRKAKEQGYRARSAFKLLQLNDQF-HFLDDPNLKRVVDLCAAPGSWSQVL 61
           K+SK + D YY  AKE+GYRARS+FK++Q+N++F HFL+   +  V+DLCAAPGSW QV 
Sbjct: 7   KNSKGRLDRYYYLAKEKGYRARSSFKIIQINEKFGHFLEKSKV--VIDLCAAPGSWCQVA 64

Query: 62  SRKLFDESPSSDKEDRKIVSVDLQPMSPIPHVTTLQADITHPKTLARILKLFGNEKADFV 121
           S+     S         I+ VD+ PM P+ +  T Q+DIT     +++       KAD V
Sbjct: 65  SKLCPVNSL--------IIGVDIVPMKPMNNCITFQSDITTEDCRSKLRGYMKTWKADTV 116

Query: 122 CSDGAPDVTGLHDLDEYVQQQLIMSALQLTACILKKGGTFVAKIFRGRDIDMLYSQLGYL 181
             DGAP+V      D + Q QL + AL+L A  L  GGTFV K+FR +D + L      L
Sbjct: 117 LHDGAPNVGLGWVQDAFTQSQLTLQALKLAAENLVVGGTFVTKVFRSKDYNKLIWVFQQL 176

Query: 182 FDKIVCAKPRSSRGTSLEAFIVCLGYNPPSNWTPKL 217
           FDK+   KP +SR  S E F+VC G+  P    P+L
Sbjct: 177 FDKVEATKPPASRNVSAEIFVVCKGFKAPKRLDPRL 212

>YCL054W (SPB1) [493] chr3 (31449..33974) Putative
           S-adenosyl-methionine-dependent methyltransferase
           required for synthesis of the 60S ribosomal subunit,
           member of the 2-prime-O-RNA methyltransferase family,
           which includes Trm7p, Mrm2p, and E. coli FtsJ protein
           [2526 bp, 841 aa]
          Length = 841

 Score =  164 bits (415), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 92/216 (42%), Positives = 126/216 (58%), Gaps = 11/216 (5%)

Query: 3   KSSKDKRDLYYRKAKEQGYRARSAFKLLQLNDQF-HFLDDPNLKRVVDLCAAPGSWSQVL 61
           K+SK + D YY  AKE+GYRARS+FK++Q+N+++ HFL+   +  V+DLCAAPGSW QV 
Sbjct: 7   KNSKGRLDRYYYLAKEKGYRARSSFKIIQINEKYGHFLEKSKV--VIDLCAAPGSWCQVA 64

Query: 62  SRKLFDESPSSDKEDRKIVSVDLQPMSPIPHVTTLQADITHPKTLARILKLFGNEKADFV 121
           S+     S         I+ VD+ PM P+P+V T Q+DIT     +++       KAD V
Sbjct: 65  SKLCPVNSL--------IIGVDIVPMKPMPNVITFQSDITTEDCRSKLRGYMKTWKADTV 116

Query: 122 CSDGAPDVTGLHDLDEYVQQQLIMSALQLTACILKKGGTFVAKIFRGRDIDMLYSQLGYL 181
             DGAP+V      D + Q QL + AL+L    L   GTFV KIFR +D + L      L
Sbjct: 117 LHDGAPNVGLGWVQDAFTQSQLTLQALKLAVENLVVNGTFVTKIFRSKDYNKLIWVFQQL 176

Query: 182 FDKIVCAKPRSSRGTSLEAFIVCLGYNPPSNWTPKL 217
           F+K+   KP +SR  S E F+VC G+  P    P+L
Sbjct: 177 FEKVEATKPPASRNVSAEIFVVCKGFKAPKRLDPRL 212

>Sklu_2421.10 YCL054W, Contig c2421 13526-16075 reverse complement
          Length = 849

 Score =  160 bits (406), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 91/216 (42%), Positives = 124/216 (57%), Gaps = 11/216 (5%)

Query: 3   KSSKDKRDLYYRKAKEQGYRARSAFKLLQLNDQF-HFLDDPNLKRVVDLCAAPGSWSQVL 61
           K+SK + D YY  AKE+GYRARS+FK++Q+N++F HFL+   +  V+DLCAAPGSW QV 
Sbjct: 7   KNSKGRLDRYYFLAKEKGYRARSSFKIIQINEKFGHFLEKSKV--VIDLCAAPGSWCQVA 64

Query: 62  SRKLFDESPSSDKEDRKIVSVDLQPMSPIPHVTTLQADITHPKTLARILKLFGNEKADFV 121
           S      S         I+ VD+ PM  +P+V T Q+DIT     +R+       KAD V
Sbjct: 65  SNLCPVNSL--------IIGVDIVPMKSMPNVITFQSDITTEDCRSRLRGYMKTWKADTV 116

Query: 122 CSDGAPDVTGLHDLDEYVQQQLIMSALQLTACILKKGGTFVAKIFRGRDIDMLYSQLGYL 181
             DGAP+V      D + Q  L + AL+L    L  GGTFV K+FR +D + L      L
Sbjct: 117 LHDGAPNVGLGWVQDAFTQSHLTLQALKLAVENLVVGGTFVTKVFRSKDYNKLIWLFQQL 176

Query: 182 FDKIVCAKPRSSRGTSLEAFIVCLGYNPPSNWTPKL 217
           F+++   KP +SR  S E F+VC G+  P    P+L
Sbjct: 177 FERVEATKPPASRNVSAEIFVVCKGFKAPKKLDPRL 212

>KLLA0C00737g 53188..55689 similar to sp|P25582 Saccharomyces
           cerevisiae YCL054w SPB1 required for ribosome synthesis,
           putative methylase, start by similarity
          Length = 833

 Score =  159 bits (402), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 90/216 (41%), Positives = 125/216 (57%), Gaps = 11/216 (5%)

Query: 3   KSSKDKRDLYYRKAKEQGYRARSAFKLLQLNDQF-HFLDDPNLKRVVDLCAAPGSWSQVL 61
           K+SK + D YY  AKE+GYRARS+FK++Q+N+++ HFL+   +  V+DLCAAPGSW QV 
Sbjct: 8   KNSKGRLDKYYYLAKEKGYRARSSFKIIQINEKYGHFLEKSKV--VIDLCAAPGSWCQVA 65

Query: 62  SRKLFDESPSSDKEDRKIVSVDLQPMSPIPHVTTLQADITHPKTLARILKLFGNEKADFV 121
           S    +  P +      I+ VD+ PM  +P+V T Q+DIT     +++       KAD V
Sbjct: 66  S----NLCPVNSL----IIGVDIVPMKTMPNVITFQSDITTEDCRSKLRGYMKTWKADTV 117

Query: 122 CSDGAPDVTGLHDLDEYVQQQLIMSALQLTACILKKGGTFVAKIFRGRDIDMLYSQLGYL 181
             DGAP+V      D + Q  L + AL+L    L  GGTFV KIFR +D + L      L
Sbjct: 118 LHDGAPNVGLSWAQDAFTQSHLTLQALKLAVENLVVGGTFVTKIFRSKDYNKLIWVFQQL 177

Query: 182 FDKIVCAKPRSSRGTSLEAFIVCLGYNPPSNWTPKL 217
           F+K+   KP +SR  S E F+VC  +  P    P+L
Sbjct: 178 FEKVEATKPPASRNVSAEIFVVCKNFKAPKKLDPRL 213

>KLLA0B01980g complement(173710..174579) similar to sp|P53123
           Saccharomyces cerevisiae YGL136c singleton, start by
           similarity
          Length = 289

 Score = 89.4 bits (220), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 69/251 (27%), Positives = 113/251 (45%), Gaps = 59/251 (23%)

Query: 5   SKDKRDLYYRKAKEQGYRARSAFKLLQLNDQFHFLDDPNLKRVVDLCAAPGSWSQVLSRK 64
           ++ K D + + AKEQ +R+R+AFKL+ ++D++ F      ++V+DL  APG+WSQV  ++
Sbjct: 35  ARQKNDHFTKAAKEQQFRSRAAFKLMDIDDKYRFFKQN--QKVLDLGFAPGAWSQVARKR 92

Query: 65  LFDESPSSDKEDRKIVSVDLQPMSPIPHVTTLQADITHPKT-------LARILKLFGNEK 117
           +             I+ VDL   +P   V +LQA+I   KT        AR ++L  +++
Sbjct: 93  IGSGG--------MIMGVDLLRCTPPKGVYSLQANILSKKTHELIRLCFARHIQLNKHDQ 144

Query: 118 ------------------------------------------ADFVCSDGAPDVTGLHDL 135
                                                      D V SD   + TG+   
Sbjct: 145 LHKDHGYLQHMLEEELNHLKETEEYKELFSQTDISQNIERYPVDVVLSDMMANTTGIQSK 204

Query: 136 DEYVQQQLIMSALQLTACILKKGGTFVAKIFRGRDIDMLYSQLGYLFDKIVCAKPRSSRG 195
           D Y+   L  +AL +   +LK GG+F  K++ G +  +L  +L  +F K+   KP +SR 
Sbjct: 205 DHYMSMDLCDAALIVAIDLLKPGGSFTCKLYAGSEDTLLEKRLKKVFKKVDRFKPNASRN 264

Query: 196 TSLEAFIVCLG 206
            S E + V  G
Sbjct: 265 ESKELYFVARG 275

>CAGL0H08954g complement(875104..875949) similar to sp|P53123
           Saccharomyces cerevisiae YGL136c, hypothetical start
          Length = 281

 Score = 77.4 bits (189), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 58/243 (23%), Positives = 103/243 (42%), Gaps = 53/243 (21%)

Query: 6   KDKRDLYYRKAKEQGYRARSAFKLLQLNDQFHFLDDPNLKRVVDLCAAPGSWSQVLSRKL 65
           + K+D Y R++K    R+R+ FKL QL+D +H       +R++DL  APG+WSQV  ++ 
Sbjct: 32  RQKQDFYTRESKLDNLRSRAGFKLAQLDDVYHVFHKSVPQRILDLGYAPGAWSQVARKRT 91

Query: 66  FDESPSSDKEDRKIVSVDLQPMSPIPHVTTLQADITHPKTLARILKLFGNE--------- 116
                     D  ++ VD+ P  P   V+++QA+I   +T   I + F  +         
Sbjct: 92  --------HPDSIVLGVDILPCDPPFGVSSMQANILSKRTHQLIRQFFMEQIFMNDSQVE 143

Query: 117 ---------------KADFVCSDG-------APDVTGLHDLDEYVQQQ------------ 142
                            + + SD        +P +  L ++  Y                
Sbjct: 144 SMARNDSDTEQQPQFPVNIILSDMYEPFPQLSPSLNNLTNMPYYRMSNTSGLNFKDHLNS 203

Query: 143 --LIMSALQLTACILKKGGTFVAKIFRGRDIDMLYSQLGYLFDKIVCAKPRSSRGTSLEA 200
             L  +AL     +L+  G+F+ K F G +  +   ++  +FD++   KP +SR  S E 
Sbjct: 204 IDLCDAALITAVDLLEPAGSFICKQFSGAETSLFEKRMKKVFDRVEITKPSASRDESKEI 263

Query: 201 FIV 203
           + +
Sbjct: 264 YFI 266

>Sklu_2160.2 YGL136C, Contig c2160 1404-2351
          Length = 315

 Score = 72.4 bits (176), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 53/157 (33%), Positives = 84/157 (53%), Gaps = 21/157 (13%)

Query: 6   KDKRDLYYRKAKEQGYRARSAFKLLQLNDQFHFLDDPNLKRVVDLCAAPGSWSQVLSRKL 65
           + + D Y ++AK Q  R+R+AFKL++L+D+F F      +RV+DL  APG+WSQV     
Sbjct: 36  RQRNDFYTKEAKNQDLRSRAAFKLIELDDRFKFFLKNKSQRVLDLGFAPGAWSQV----A 91

Query: 66  FDESPSSDKEDRKIVSVDLQPMSPIPHVTTLQADITHPKT--LARIL--KLFGNEKADFV 121
           FD +    K +  ++ VD+ P  P   V+++QA+I   KT  L R+   K F   + D +
Sbjct: 92  FDRT----KPNGMVLGVDILPCKPPRGVSSIQANILSRKTHELIRLFFSKHFQINRHDEL 147

Query: 122 CSDGA-------PDVTGLHDLDEYVQQQLIMSALQLT 151
             D          D+  L   DEY  +++  S ++LT
Sbjct: 148 HEDHGYFQHMLEEDLKNLKQTDEY--REIFGSDVELT 182

 Score = 50.4 bits (119), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 44/79 (55%)

Query: 128 DVTGLHDLDEYVQQQLIMSALQLTACILKKGGTFVAKIFRGRDIDMLYSQLGYLFDKIVC 187
           + TG+   D Y+   L  +AL +   +L+ GG+F  K++ G++  +L  ++  +F K+  
Sbjct: 224 NTTGVAIKDHYMSMDLCDAALVVAIDLLRPGGSFACKVYTGKEDKLLEKRMKMVFSKVCR 283

Query: 188 AKPRSSRGTSLEAFIVCLG 206
            KP SSR  S E + V LG
Sbjct: 284 FKPDSSRNESKELYFVGLG 302

>Scas_720.46
          Length = 321

 Score = 72.0 bits (175), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 38/96 (39%), Positives = 57/96 (59%), Gaps = 8/96 (8%)

Query: 10  DLYYRKAKEQGYRARSAFKLLQLNDQFHFLDDPNLKRVVDLCAAPGSWSQVLSRKLFDES 69
           D Y R+AK   +R+R+AFKL +++D+FH  +   ++RV+DL  APG+WSQV   +   ES
Sbjct: 42  DPYTREAKINNFRSRAAFKLTEIDDKFHIFNKSKIQRVLDLGFAPGAWSQVARERTSKES 101

Query: 70  PSSDKEDRKIVSVDLQPMSPIPHVTTLQADITHPKT 105
                    I+ VD+ P  P   V+ +QA+I   KT
Sbjct: 102 --------MILGVDILPCDPPHGVSAIQANILSKKT 129

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 40/78 (51%)

Query: 128 DVTGLHDLDEYVQQQLIMSALQLTACILKKGGTFVAKIFRGRDIDMLYSQLGYLFDKIVC 187
           + +GL   D      L  +AL     +L+  G+FV K+F G +  +   ++  +F K + 
Sbjct: 230 NTSGLTVRDHQHSIDLCDAALVTALDLLRPKGSFVCKLFTGVEDKLFEKRVKMVFKKTIR 289

Query: 188 AKPRSSRGTSLEAFIVCL 205
            KP+SSR  S E +I+ +
Sbjct: 290 FKPKSSRNESKEVYIIGM 307

>Kwal_56.24158
          Length = 307

 Score = 71.2 bits (173), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 48/138 (34%), Positives = 73/138 (52%), Gaps = 15/138 (10%)

Query: 6   KDKRDLYYRKAKEQGYRARSAFKLLQLNDQFHFLDDPNLKRVVDLCAAPGSWSQVLSRKL 65
           + K D + R AK QG R+R+AFKL+Q++D+ H       + V+DL  APG+WSQV     
Sbjct: 35  RQKNDSFTRDAKVQGLRSRAAFKLMQIDDKVHLFRKNARQNVLDLGYAPGAWSQV----A 90

Query: 66  FDESPSSDKEDRKIVSVDLQPMSPIPHVTTLQADITHPKTLARILKLFGNEKADFVCSDG 125
           FD +      D  I+ VD+ P +P   V+++QA+I   KT   +++LF + +      D 
Sbjct: 91  FDRTGP----DGVILGVDILPCAPPRGVSSIQANILSRKT-HELIRLFFSRQFQLYYED- 144

Query: 126 APDVTGLHDLDEYVQQQL 143
                 LH  + Y Q  L
Sbjct: 145 -----RLHKDNGYFQHML 157

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 45/82 (54%)

Query: 124 DGAPDVTGLHDLDEYVQQQLIMSALQLTACILKKGGTFVAKIFRGRDIDMLYSQLGYLFD 183
           D   + +G+   D Y    L  +AL     +LK GG+FV K++ G++  +L ++L  +F+
Sbjct: 210 DRMANTSGVAIKDHYASMDLCDAALVAAIDLLKPGGSFVCKLYTGKEDRILENRLKQVFN 269

Query: 184 KIVCAKPRSSRGTSLEAFIVCL 205
           ++   KP +SR  S E + V L
Sbjct: 270 EVQRFKPTASRDESKELYFVGL 291

>AFL117C [3078] [Homologous to ScYGL136C (MRM2) - SH]
           (218993..219904) [912 bp, 303 aa]
          Length = 303

 Score = 64.7 bits (156), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 38/101 (37%), Positives = 60/101 (59%), Gaps = 10/101 (9%)

Query: 5   SKDKRDLYYRKAKEQGYRARSAFKLLQLNDQFHFLDDPNLKRVVDLCAAPGSWSQVLSRK 64
           S+ +RD Y R+AK Q  R+R+AFKL+++++QF        +RV+DL  APG+WSQV  ++
Sbjct: 32  SRQRRDPYTREAKVQELRSRAAFKLIEIDEQFRLFRAG--QRVLDLGFAPGAWSQVAQQR 89

Query: 65  LFDESPSSDKEDRKIVSVDLQPMSPIPHVTTLQADITHPKT 105
                P       K++ VD+ P  P   V+++QA+    KT
Sbjct: 90  ---TQPGG-----KVMGVDVLPCKPPTGVSSIQANALSRKT 122

 Score = 37.7 bits (86), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 42/78 (53%)

Query: 128 DVTGLHDLDEYVQQQLIMSALQLTACILKKGGTFVAKIFRGRDIDMLYSQLGYLFDKIVC 187
           + +G+   D Y+   L  +AL     +L+ GG+FV K++ G++  +L  +L  +F K+  
Sbjct: 212 NTSGVAVKDHYMSMDLCDAALLCAIALLRPGGSFVCKLYTGKEDQLLERRLRKVFTKVRR 271

Query: 188 AKPRSSRGTSLEAFIVCL 205
            KP + R  S E + V L
Sbjct: 272 FKPEACRSESKELYFVGL 289

>YGL136C (MRM2) [1851] chr7 complement(252900..253862)
           Methyltransferase that methylates mitochondrial 21S rRNA
           at nucleotide U2791, member of the 2-prime-O-RNA
           methyltransferase family, which includes Trm7p, Spb1p,
           and E. coli FtsJ protein [963 bp, 320 aa]
          Length = 320

 Score = 63.9 bits (154), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 39/106 (36%), Positives = 66/106 (62%), Gaps = 10/106 (9%)

Query: 9   RDLYYRKAKEQGYRARSAFKLLQLNDQFH-FLDDPNLKRVVDLCAAPGSWSQVLSRKLFD 67
           +D Y ++AK Q  R+R+AFKL+Q++D++  F  +   +R++DL  APG+WSQV  ++   
Sbjct: 37  KDPYTKEAKVQNLRSRAAFKLMQIDDKYRLFSKNRTDQRILDLGYAPGAWSQVARQR--- 93

Query: 68  ESPSSDKEDRKIVSVDLQPMSPIPHVTTLQADITHPKTLARILKLF 113
            SP+S      I+ VD+ P  P   V ++QA+I   +T   +++LF
Sbjct: 94  SSPNS-----MILGVDILPCEPPHGVNSIQANILAKRT-HDLIRLF 133

 Score = 35.4 bits (80), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 20/78 (25%), Positives = 39/78 (50%)

Query: 128 DVTGLHDLDEYVQQQLIMSALQLTACILKKGGTFVAKIFRGRDIDMLYSQLGYLFDKIVC 187
           + +G+   D Y    L  +AL     +L+  G+FV K++ G + ++   ++  +F  +  
Sbjct: 228 NTSGVSIRDHYQSIDLCDAALVTAIDLLRPLGSFVCKLYTGEEENLFKKRMQAVFTNVHK 287

Query: 188 AKPRSSRGTSLEAFIVCL 205
            KP +SR  S E + + L
Sbjct: 288 FKPDASRDESKETYYIGL 305

>KLLA0A02541g 223318..224913 some similarities with sp|P53226
           Saccharomyces cerevisiae YGR041w BUD9 budding protein,
           hypothetical start
          Length = 531

 Score = 33.9 bits (76), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 31/62 (50%), Gaps = 6/62 (9%)

Query: 43  NLKRVVDLCAAP--GSWSQVLSRKLFDESPSSDKEDRKIVSVDLQPMSPIPHVTTLQADI 100
           N+KR     + P  GS  QVL  ++ +E+ S +  D+K  +    P     H  +LQAD 
Sbjct: 200 NMKRSSKAVSTPALGSSDQVLDERIVEETESDETSDKKNRTSSFYPA----HTESLQADE 255

Query: 101 TH 102
           TH
Sbjct: 256 TH 257

>Scas_702.6
          Length = 533

 Score = 30.8 bits (68), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 29/52 (55%)

Query: 135 LDEYVQQQLIMSALQLTACILKKGGTFVAKIFRGRDIDMLYSQLGYLFDKIV 186
           ++ Y+++  I   L  T    +KG +F+  I  G  + ++ +Q GYL +KIV
Sbjct: 259 IERYMKRLTINEPLYETMTKEEKGVSFIKYINFGEKLVVMNNQYGYLINKIV 310

>Kwal_27.12766
          Length = 707

 Score = 30.4 bits (67), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 34/71 (47%), Gaps = 9/71 (12%)

Query: 63  RKLFDESPSSDKEDRKIVSVDLQPMSPI---------PHVTTLQADITHPKTLARILKLF 113
           + L+ E P S  ED    +VD Q  S I         P + TL A  +H   L +IL++ 
Sbjct: 578 KALYTEFPPSSFEDEAQAAVDAQRTSGISRTFNSLSKPQIATLDAITSHFSRLIKILRMG 637

Query: 114 GNEKADFVCSD 124
            +E ++ + ++
Sbjct: 638 SSETSEALANE 648

>YFL047W (RGD2) [1637] chr6 (40421..42565) GTPase activating protein
           (GAP) containing a Fes/CIP4 domain, a
           dishevelled-Egl-10-pleckstrin homology domain, a Rho-GAP
           domain, and a PEST motif, has similarity to Rga2p [2145
           bp, 714 aa]
          Length = 714

 Score = 29.6 bits (65), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 19/31 (61%), Gaps = 2/31 (6%)

Query: 91  PHVTTLQADITHPKTLARILKL--FGNEKAD 119
           PH+ TL A  TH   L +ILK+   GNE AD
Sbjct: 633 PHIATLDAITTHFYRLIKILKMGENGNEVAD 663

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.134    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 10,718,343
Number of extensions: 471110
Number of successful extensions: 1343
Number of sequences better than 10.0: 30
Number of HSP's gapped: 1298
Number of HSP's successfully gapped: 37
Length of query: 305
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 204
Effective length of database: 13,099,691
Effective search space: 2672336964
Effective search space used: 2672336964
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 61 (28.1 bits)