Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YBR060C (ORC2)62060932670.0
CAGL0H10230g51450114940.0
Scas_718.4773055414160.0
Kwal_27.1094159560613461e-180
AGR028C57940111091e-145
KLLA0F18590g5966228631e-108
CAGL0B01837g56948692.9
CAGL0L03410g73172683.7
YPL115C (BEM3)112886684.6
KLLA0E21362g392105665.3
Scas_704.3056361658.1
Scas_720.593186658.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YBR060C
         (609 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YBR060C (ORC2) [251] chr2 complement(360612..362474) Origin reco...  1263   0.0  
CAGL0H10230g complement(1000574..1002118) similar to sp|P32833 S...   580   0.0  
Scas_718.47                                                           550   0.0  
Kwal_27.10941                                                         523   e-180
AGR028C [4338] [Homologous to ScYBR060C (ORC2) - SH] (766480..76...   431   e-145
KLLA0F18590g 1709034..1710824 similar to sp|P32833 Saccharomyces...   337   e-108
CAGL0B01837g complement(166953..168662) similar to tr|Q04600 Sac...    31   2.9  
CAGL0L03410g 387487..389682 similar to sp|P47027 Saccharomyces c...    31   3.7  
YPL115C (BEM3) [5330] chr16 complement(332099..335485) GTPase-ac...    31   4.6  
KLLA0E21362g complement(1900927..1902105) some similarities with...    30   5.3  
Scas_704.30                                                            30   8.1  
Scas_720.5                                                             30   8.4  

>YBR060C (ORC2) [251] chr2 complement(360612..362474) Origin
           recognition complex, 72 kDa subunit, functions in
           pre-replication complex formation, which is essential
           for proper DNA replication initiation [1863 bp, 620 aa]
          Length = 620

 Score = 1263 bits (3267), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 609/609 (100%), Positives = 609/609 (100%)

Query: 1   MLNGEDFVEHNDILSSPAKSRNVTPKRVDPHGERQLRRIHSSKKNLLERISLVGNERKNT 60
           MLNGEDFVEHNDILSSPAKSRNVTPKRVDPHGERQLRRIHSSKKNLLERISLVGNERKNT
Sbjct: 1   MLNGEDFVEHNDILSSPAKSRNVTPKRVDPHGERQLRRIHSSKKNLLERISLVGNERKNT 60

Query: 61  SPDPALKPKTPSKAPRKRGRPRKIQEELTDRIKKDEKDTISSKKKRKLDKDTSGNVNEES 120
           SPDPALKPKTPSKAPRKRGRPRKIQEELTDRIKKDEKDTISSKKKRKLDKDTSGNVNEES
Sbjct: 61  SPDPALKPKTPSKAPRKRGRPRKIQEELTDRIKKDEKDTISSKKKRKLDKDTSGNVNEES 120

Query: 121 KTSNNKQVMEKTGIKEKREREKIQVATTTYEDNVTPQTDDNFVSNSPEPPEPATPSKKSL 180
           KTSNNKQVMEKTGIKEKREREKIQVATTTYEDNVTPQTDDNFVSNSPEPPEPATPSKKSL
Sbjct: 121 KTSNNKQVMEKTGIKEKREREKIQVATTTYEDNVTPQTDDNFVSNSPEPPEPATPSKKSL 180

Query: 181 TTNHDFTSPLKQIIMNNLKEYKDSTSPGKLTLSRNFTPTPVPKNKKLYQTSETKSASSFL 240
           TTNHDFTSPLKQIIMNNLKEYKDSTSPGKLTLSRNFTPTPVPKNKKLYQTSETKSASSFL
Sbjct: 181 TTNHDFTSPLKQIIMNNLKEYKDSTSPGKLTLSRNFTPTPVPKNKKLYQTSETKSASSFL 240

Query: 241 DTFEGYFDQRKIVRTNAKSRHTMSMAPDVTREEFSLVSNFFNENFQKRPRQKLFEIQKKM 300
           DTFEGYFDQRKIVRTNAKSRHTMSMAPDVTREEFSLVSNFFNENFQKRPRQKLFEIQKKM
Sbjct: 241 DTFEGYFDQRKIVRTNAKSRHTMSMAPDVTREEFSLVSNFFNENFQKRPRQKLFEIQKKM 300

Query: 301 FPQYWFELTQGFSLLFYGVGSKRNFLEEFAIDYLSPKIAYSQLAYENELQQNKPVNSIPC 360
           FPQYWFELTQGFSLLFYGVGSKRNFLEEFAIDYLSPKIAYSQLAYENELQQNKPVNSIPC
Sbjct: 301 FPQYWFELTQGFSLLFYGVGSKRNFLEEFAIDYLSPKIAYSQLAYENELQQNKPVNSIPC 360

Query: 361 LILNGYNPSCNYRDVFKEITDLLVPAELTRSETKYWGNHVILQIQKMIDFYKNQPLDIKL 420
           LILNGYNPSCNYRDVFKEITDLLVPAELTRSETKYWGNHVILQIQKMIDFYKNQPLDIKL
Sbjct: 361 LILNGYNPSCNYRDVFKEITDLLVPAELTRSETKYWGNHVILQIQKMIDFYKNQPLDIKL 420

Query: 421 ILVVHNLDGPSIRKNTFQTMLSFLSVIRQIAIVASTDHIYAPLLWDNMKAQNYNFVFHDI 480
           ILVVHNLDGPSIRKNTFQTMLSFLSVIRQIAIVASTDHIYAPLLWDNMKAQNYNFVFHDI
Sbjct: 421 ILVVHNLDGPSIRKNTFQTMLSFLSVIRQIAIVASTDHIYAPLLWDNMKAQNYNFVFHDI 480

Query: 481 SNFEPSTVESTFQDVMKMGKSDTSSGAEGAKYVLQSLTVNSKKMYKLLIETQMQNMGNLS 540
           SNFEPSTVESTFQDVMKMGKSDTSSGAEGAKYVLQSLTVNSKKMYKLLIETQMQNMGNLS
Sbjct: 481 SNFEPSTVESTFQDVMKMGKSDTSSGAEGAKYVLQSLTVNSKKMYKLLIETQMQNMGNLS 540

Query: 541 ANTGPKRGTQRTGVELKLFNHLCAADFIASNEIALRSMLREFIEHKMANITKNNSGMEII 600
           ANTGPKRGTQRTGVELKLFNHLCAADFIASNEIALRSMLREFIEHKMANITKNNSGMEII
Sbjct: 541 ANTGPKRGTQRTGVELKLFNHLCAADFIASNEIALRSMLREFIEHKMANITKNNSGMEII 600

Query: 601 WVPYTYAEL 609
           WVPYTYAEL
Sbjct: 601 WVPYTYAEL 609

>CAGL0H10230g complement(1000574..1002118) similar to sp|P32833
           Saccharomyces cerevisiae YBR060c RRR1 origin recognition
           complex, hypothetical start
          Length = 514

 Score =  580 bits (1494), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/501 (56%), Positives = 366/501 (73%), Gaps = 14/501 (2%)

Query: 118 EESKTSNNKQVMEKTGIKEKREREKIQVATTT-YEDNVTPQTDDNFVSNSPEPPEPATPS 176
           +ES   N    +++ G   +   +KI+V +   YE       ++N V    +   P    
Sbjct: 9   KESLKENEDLAIKENGTSPREIGDKIKVESAGEYETPELTSDEENLV----QLQTPRKRR 64

Query: 177 KKSLTTNHDFTSPLKQIIMNNLKEYKDSTSPGKLTLSRNFTPTPVPKNKKLYQTSETKSA 236
           K +L+  HDFTSPLK++IMNNL EYK S    KL LSR+F  T VP+   + +    ++ 
Sbjct: 65  KVNLSKEHDFTSPLKKVIMNNLNEYKKSDLADKLKLSRDFVNTQVPRPADVEKLKANRAV 124

Query: 237 SSFLDTFEGYFDQRKIVRTNAKSRHTMSMAPDVTREEFSLVSNFFNENFQKRPRQKLFEI 296
           +SF DTFEGYF+Q++ VR    S+++++MAP VTREEF L+SN F+ N  K  R  L+ I
Sbjct: 125 TSFTDTFEGYFEQKRSVRGVKVSKNSITMAPHVTREEFGLISNIFHRNLHKNLRDHLYII 184

Query: 297 QKKMFPQYWFELTQGFSLLFYGVGSKRNFLEEFAIDYLSPKIAYSQLAYENELQQNKP-- 354
           QKK++PQYWFE+ QGFSLLFYG+GSK+ FLE+F   YLSPK+A SQ A E      K   
Sbjct: 185 QKKLYPQYWFEVIQGFSLLFYGIGSKKVFLEDFVFKYLSPKLALSQ-AIEVPTYNGKKSK 243

Query: 355 VNSIPCLILNGYNPSCNYRDVFKEITDLLVPAELTRSETKYWGNHVILQIQKMIDFYKNQ 414
              IP +++NGYNP+CNYRDVFK+I  LL PAELT+SE+K+WGNHVI+ IQK+ID+YK++
Sbjct: 244 FEGIPVVVVNGYNPTCNYRDVFKDILSLLTPAELTQSESKFWGNHVIMNIQKLIDYYKDK 303

Query: 415 PLDIKLILVVHNLDGPSIRKNTFQTMLSFLSVIRQIAIVASTDHIYAPLLWDNMKAQNYN 474
           PLDIKLI+ +HN+DGP+IR+    T+LSFLS+IRQ+AIVAS DHIYAP LWDN++AQNYN
Sbjct: 304 PLDIKLIVAIHNIDGPNIRRGDSPTILSFLSLIRQVAIVASADHIYAPFLWDNLRAQNYN 363

Query: 475 FVFHDISNFEPSTVESTFQDVMKMGKSDTSSGAEGAKYVLQSLTVNSKKMYKLLIETQMQ 534
           FVFHD++N+ P   ES+FQDVM++GKS+ S+GAEGAKYVLQSLT+NSKKMYKLLIETQ+Q
Sbjct: 364 FVFHDVTNYAPYEAESSFQDVMRLGKSENSTGAEGAKYVLQSLTLNSKKMYKLLIETQLQ 423

Query: 535 NMGNLSA--NTG----PKRGTQRTGVELKLFNHLCAADFIASNEIALRSMLREFIEHKMA 588
           +M  +S   +TG     KRGT   GVE K   HLCAADFIASNE+ALRSML EFIEHKMA
Sbjct: 424 HMEKVSTTKSTGKVAASKRGTMSMGVEFKQLVHLCAADFIASNEMALRSMLTEFIEHKMA 483

Query: 589 NITKNNSGMEIIWVPYTYAEL 609
           +++KN  G E +WVPYTYAE+
Sbjct: 484 SVSKNTVGTEFVWVPYTYAEM 504

>Scas_718.47
          Length = 730

 Score =  550 bits (1416), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/554 (51%), Positives = 384/554 (69%), Gaps = 51/554 (9%)

Query: 76  RKRGRPRKIQEELTDRIKKDEKDTISSKKKRKLDKDTSGNVNEESKTSNNKQVMEKTGIK 135
           RKRGRPRK     T +IK+         + RK    +  N  E+ K+    +  E + I+
Sbjct: 196 RKRGRPRKYPIPETPKIKRKRG------RPRKEPVISENNSEEKGKSRKPNKKGESSDIE 249

Query: 136 EKREREKIQVATTTYEDNVTPQTDDNFVSNSPEPPEPATPSKKSLTTNHDFTSPLKQIIM 195
             RE        +   D  +P                  PSK +  T HDFTSPLKQ+IM
Sbjct: 250 SDRE--------SLAMDQTSP-----------------LPSKIAPLTEHDFTSPLKQVIM 284

Query: 196 NNLKEYKDST--SPGKLTLSRNFTPTPVPKN---KKLYQTSETKSASSFLDTFEGYFDQR 250
           N+L++Y++ +  S  KL L+R F PT VPK    +K  + SE KS+ +F DTFEGYFDQR
Sbjct: 285 NSLRQYQEDSLLSSKKLVLNREFVPTQVPKTDKYEKRLEASENKSSKTFFDTFEGYFDQR 344

Query: 251 K--IVRTNAKSRHTMSMAPDVTREEFSLVSNFFNENFQKRPRQKLFEIQKKMFPQYWFEL 308
              +  T   S++TMSM P V+++EF++ +N FN+++ K PR KL  +Q+KMFPQYWFE+
Sbjct: 345 SHSLKYTTKLSKNTMSMGPSVSKDEFAMFTNVFNKHYLKEPRAKLQALQRKMFPQYWFEI 404

Query: 309 TQGFSLLFYGVGSKRNFLEEFAIDYLSPKIAYSQ-LAYENELQQNK------PVNSIPCL 361
           TQGFSLLFYG+GSKRNFLE+ AI Y+SPK+ + + +A + EL+  K       +  IPCL
Sbjct: 405 TQGFSLLFYGIGSKRNFLEDLAIKYISPKLTFGKRIALQKELELKKVNKSTGSIQGIPCL 464

Query: 362 ILNGYNPSCNYRDVFKEITDLLVPAELTRSETKYWGNHVILQIQKMIDFYKNQPLDIKLI 421
           I+NGYNP+C+YR++F++ITD++ P  LTR+ETK+WGN  ILQ+QKMI+FY  QP DIKLI
Sbjct: 465 IINGYNPTCSYREIFQDITDIMFPDGLTRNETKFWGNLAILQVQKMIEFYSTQPKDIKLI 524

Query: 422 LVVHNLDGPSIRKNTFQTMLSFLSVIRQIAIVASTDHIYAPLLWDNMKAQNYNFVFHDIS 481
           LV+HNLDGP++RK  FQT+ S L+ I+QI ++AS DHIYAP+L+DN KAQNYNFVFHD++
Sbjct: 525 LVIHNLDGPALRKEIFQTIFSSLAQIKQIVLIASVDHIYAPVLFDNKKAQNYNFVFHDVT 584

Query: 482 NFEPSTVESTFQDVMKMGKSDTSSGAEGAKYVLQSLTVNSKKMYKLLIETQMQNMG---- 537
           N+E + VES+FQD M +GKS +SSGAEGAKYVL+SLT+N+KKMYKLL++ Q+ NM     
Sbjct: 585 NYESNEVESSFQDKMNLGKSSSSSGAEGAKYVLESLTLNAKKMYKLLLDLQLNNMDLASG 644

Query: 538 --NLSANTGPKRGTQRTGVELKLFNHLCAADFIASNEIALRSMLREFIEHKMANITKNNS 595
             N SA++  KRG   TGVE K F  +CA++FIASNEI+LR+ML EFIEHKM  +++++S
Sbjct: 645 SKNKSASSVSKRGGLSTGVEFKSFVTMCASEFIASNEISLRTMLTEFIEHKMLLLSRHSS 704

Query: 596 GMEIIWVPYTYAEL 609
           G E ++VPY Y+E+
Sbjct: 705 GTEYLYVPYRYSEM 718

 Score = 34.3 bits (77), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 55/119 (46%), Gaps = 18/119 (15%)

Query: 5   EDFVEHNDILSSPAKSRNVTPKR--VDPHGERQLRRIHSSKKNLLERISLVGNER--KNT 60
           +D V H DIL SP KS N   +      H     +   S+K+  LE + L   E   K  
Sbjct: 7   DDIVTHIDILCSPVKSSNKAIRNPLAHIHDSPNKKSRVSTKRPALETVKLETTETIGKFV 66

Query: 61  SP-DPALKPK----------TPSKAPRKRGRPRKIQEELTDRIKKDEKDTISSKKKRKL 108
            P +P +K K           P K  RKRGRPRK   E   + K++++++  + K+R +
Sbjct: 67  GPGEPIIKRKRGRPRKIVTSEPPKLKRKRGRPRK---EEQHQYKEEDEESEGTMKERSM 122

>Kwal_27.10941
          Length = 595

 Score =  523 bits (1346), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 272/606 (44%), Positives = 380/606 (62%), Gaps = 78/606 (12%)

Query: 16  SPAKSRNVTP-KRVDPHGERQLRRIHSSKKNLLERISLVGNERKNTSPDPALKPKTPSKA 74
           SPAK R  +P K+ D     QL   H       E+ +    E K  S  P    ++P + 
Sbjct: 46  SPAKRRTPSPVKQEDTSELEQLSHDH-------EKSAGATPEVKVDSLPPRSPSQSPVRH 98

Query: 75  PRKRGRPRKIQEE-----LTDRIKKDEKDTISSKKKRKLDKDTSGNVNEESKTSNNKQVM 129
           PRKRGRPR ++ E      T  +      +IS +  RKL K                   
Sbjct: 99  PRKRGRPRSVKAEHDPKITTPSVNASPSRSISPQGPRKLTK------------------- 139

Query: 130 EKTGIKEKREREKIQVATTTYEDNVTPQTDDNFVSNSPEPPEPATPSKKSLTTNHDFTSP 189
                                   + P  +  FV+ +  P          + ++H F+SP
Sbjct: 140 ------------------------LEPVPESEFVTANSSP----------IKSSHVFSSP 165

Query: 190 LKQIIMNNLKEYKDSTSPGKLTLSRNFTPTPVPKNKKLYQTSETKSASSFLDTFEGYFDQ 249
            K      LK+     SP K+ L R+F PTP+P     Y+  + K  + F D FEGY DQ
Sbjct: 166 AKSPSKPVLKQ-----SPFKIQLDRHFVPTPIPHEGD-YKPPQEKHLTYFFDGFEGYIDQ 219

Query: 250 RKIVRTNAKSRHTMSMAPDVTREEFSLVSNFFNENFQKRPRQKLFEIQKKMFPQYWFELT 309
           +K +R + KS +TM+MAP VTREEFSL+SN   ++  K  ++ L E+Q+KMFPQYWFEL 
Sbjct: 220 KKPLRAHQKSTNTMAMAPQVTREEFSLLSNTLIDSLHKPAKEALLEVQRKMFPQYWFELA 279

Query: 310 QGFSLLFYGVGSKRNFLEEFAIDYLSPKIAYSQL-----AYENE-LQQNKPVNSIPCLIL 363
           QGFSLLFYGVGSKR+FLEEF + YLSP++A S       A ++E + +   ++ +PC+++
Sbjct: 280 QGFSLLFYGVGSKRSFLEEFVLQYLSPQLALSDALNFGTAEDSEAIDEESEIDGVPCVVI 339

Query: 364 NGYNPSCNYRDVFKEITDLLVPAELTRSETKYWGNHVILQIQKMIDFYKNQPLDIKLILV 423
           NGYNP+CNYRD F  I+ +++  EL++SETKYWGNHV LQI KMI+ Y++ P  IKLI++
Sbjct: 340 NGYNPTCNYRDAFHSISQIMMQEELSKSETKYWGNHVELQINKMIEVYRDSPPLIKLIVL 399

Query: 424 VHNLDGPSIRKNTFQTMLSFLSVIRQIAIVASTDHIYAPLLWDNMKAQNYNFVFHDISNF 483
           VHNLDGP +RK+ FQ MLS LS +RQIA++ASTD++YAPLLWD+++AQN+NF+FHDI+N+
Sbjct: 400 VHNLDGPMVRKDPFQNMLSSLSRVRQIALIASTDNLYAPLLWDHVRAQNFNFIFHDITNY 459

Query: 484 EPSTVESTFQDVMKMGKSDTSSGAEGAKYVLQSLTVNSKKMYKLLIETQMQNMGNLSANT 543
           +   VES+F D+M++G+S  ++GAEGA+YVL+SLT NSK+MYKLLIETQ+ NM +     
Sbjct: 460 QSYAVESSFSDIMQLGRSAGTTGAEGARYVLESLTSNSKRMYKLLIETQLSNMDSQGKAV 519

Query: 544 GPKRGTQRTGVELKLFNHLCAADFIASNEIALRSMLREFIEHKMANITKNNSGMEIIWVP 603
             KRG+   G+E K F H+CAADFIASNE++LRSML EFIEHKMA ++++ +G E +++P
Sbjct: 520 ANKRGSHAFGIEFKQFYHMCAADFIASNEVSLRSMLGEFIEHKMAAMSRDRTGAETLYIP 579

Query: 604 YTYAEL 609
           Y ++E+
Sbjct: 580 YVHSEM 585

>AGR028C [4338] [Homologous to ScYBR060C (ORC2) - SH]
           (766480..768219) [1740 bp, 579 aa]
          Length = 579

 Score =  431 bits (1109), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 195/401 (48%), Positives = 281/401 (70%), Gaps = 12/401 (2%)

Query: 212 LSRNFTPTPVPKNKKLYQTSETKSASSFLDTFEGYFDQRKIVRTNAKSRHTMSMAPDVTR 271
           L   F P  VPK    Y+  E ++ + F D FEGY DQ+K +R + KSR++M++AP V+R
Sbjct: 177 LDPGFVPAAVPKG---YRLPEDRNLTYFFDGFEGYIDQKKPIRAHKKSRNSMAIAPSVSR 233

Query: 272 EEFSLVSNFFNENFQKRPRQKLFEIQKKMFPQYWFELTQGFSLLFYGVGSKRNFLEEFAI 331
           +EF L+S   N    + PR  L   Q+++FPQYWFE+ QGF+LLFYG+GSKR FLE    
Sbjct: 234 DEFRLLSGALNGFMHQTPRAVLTGHQQRLFPQYWFEVMQGFTLLFYGIGSKRRFLETLVF 293

Query: 332 DYLSPKIAYSQLAYENELQQNKPVNSIPCLILNGYNPSCNYRDVFKEITDLLVPAELTRS 391
           +YLSPK+A S         +   V  +PC+++NG+NP+CNYRD F+ I   ++P EL  +
Sbjct: 294 EYLSPKLALSGAP------EGADVEGVPCVVINGFNPACNYRDCFQSIAAYMLPDELRHA 347

Query: 392 ETKYWGNHVILQIQKMIDFYKNQPLDIKLILVVHNLDGPSIRKNTFQTMLSFLSVIRQIA 451
           ETKYW NHV LQIQKM++ +  QP  ++++++VHNLDGP +RK+ FQ MLS L+ IRQIA
Sbjct: 348 ETKYWHNHVHLQIQKMVEHWAAQPPQVQMVVLVHNLDGPMLRKDPFQQMLSSLARIRQIA 407

Query: 452 IVASTDHIYAPLLWDNMKAQNYNFVFHDISNFEPSTVESTFQDVMKMGKSDTSSGA-EGA 510
           IVAS DHI+APLLW +++AQ YNFVFHD++N+EP  +E+ FQ+ +++ +S+  +G+ + A
Sbjct: 408 IVASVDHIHAPLLWYSLRAQLYNFVFHDVTNYEPYAIEAAFQESVRLNRSELQAGSIDAA 467

Query: 511 KYVLQSLTVNSKKMYKLLIETQMQNMGNLS--ANTGPKRGTQRTGVELKLFNHLCAADFI 568
           +YVL SLT NSK++++LL+ET + NM +      T  +R     GV    F   CAA F+
Sbjct: 468 RYVLASLTANSKRLFRLLLETVVANMQSAKRIKLTNSRRAGISFGVPFSAFYQACAAQFV 527

Query: 569 ASNEIALRSMLREFIEHKMANITKNNSGMEIIWVPYTYAEL 609
           ASNE++LRSMLREF+EHKMA++ K+ +G EI++V Y++ E+
Sbjct: 528 ASNEMSLRSMLREFVEHKMAHLAKDKAGQEIVYVNYSFGEM 568

>KLLA0F18590g 1709034..1710824 similar to sp|P32833 Saccharomyces
           cerevisiae YBR060c RRR1 origin recognition complex, 72
           kDa subunit singleton, start by similarity
          Length = 596

 Score =  337 bits (863), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 221/622 (35%), Positives = 349/622 (56%), Gaps = 76/622 (12%)

Query: 8   VEHNDILSSPAKSRNVTPKRV---DPHGERQLRRIHSSKKNL-LERISLVG-----NERK 58
           V H DI  SP+K R  +PK++   D     +  R  S K++L LE +S+         RK
Sbjct: 19  VNHQDIFISPSKVRYQSPKKLKSFDFLSPSKTVRPKSPKRSLTLESVSIETEYKDEESRK 78

Query: 59  NTSPDPALKPKTPSKAPRKRGRPRKIQEELTDRIKKDEKDTISSKKKRKLDKDTSGNVNE 118
           ++S D A    TP +  RK  +  K++E+       D  D +S         DT+  ++ 
Sbjct: 79  HSSTDTA----TPRRRQRKTTKRVKLEED-------DAIDYVS---------DTNELIHN 118

Query: 119 ESKTSNNKQVMEKTGIKEKREREKIQVATTTYEDNVTPQTDDNFVSNSPEPPEPATPSKK 178
           +                ++ E  KI++ +     N +P+    F   + EP      ++ 
Sbjct: 119 D----------------DEYEDLKIKIDSNESSPNKSPRRKLTF---NAEPSPQRKTTRN 159

Query: 179 SLTTNHDFTSPLKQIIMNNLKEYKDSTSPGKLTLSRNFTPTPVPKNKKLYQTSETKSASS 238
           ++  N      L     +++++YK      KL L+ NF PT +PK+    QTS+ +S   
Sbjct: 160 TVQRNKIIDDDLA---YDDIQQYKHL----KLNLNPNFKPTKLPKSDNNDQTSDEQSQIY 212

Query: 239 FLDTFEGYFDQRKIVRTNAKSRHTMSMAPDVTREEFSLVSNFFNENFQKRPRQKLFEIQK 298
           F D FEG+ DQ KI++T+ +S+++MS AP ++R+E++++S   N+ F +   + + +I +
Sbjct: 213 FFDGFEGFIDQTKILKTDKRSKNSMSSAPSISRDEYNILSQLSNDIFHRSSTKAVQKIHE 272

Query: 299 KMFPQYWFELTQGFSLLFYGVGSKRNFLEEFAIDYLSPKIAYSQLAYENELQQNKPVNSI 358
            +F Q+ FEL QGF+LLFYG+GSK+ FLE FA ++LS KIA   L    ++Q++ P   I
Sbjct: 273 TLFQQFTFELLQGFTLLFYGIGSKKKFLESFAFNFLSMKIA---LLQNPDIQKDDPC--I 327

Query: 359 PCLILNGYNPSCNYRDVFKEITDLLVPAELT--RSETKYWGNHVILQIQKMIDFYKNQPL 416
           P  ++NGY      +++F +I  +LV  E    + ++ YW N + LQ+ ++  ++K +P 
Sbjct: 328 PVFVMNGYTTLS--KNIFLDIFKILVEGETIDDQGQSNYWDNRIDLQMDRLSKYFKKRPP 385

Query: 417 DIKLILVVHNLDGPSIRKNTFQTMLSFLSVIRQIAIVASTDHIYAPLLWDNMKAQNYNFV 476
            +K+IL++HNLDGPS R+  FQT +S L+ I+QI +VAS DHI AP LWD+ +AQ++NFV
Sbjct: 386 TVKMILLIHNLDGPSFRREHFQTRMSILAQIKQICVVASVDHIQAPFLWDHFRAQSFNFV 445

Query: 477 FHDISNFEPSTVESTFQD-VMKMGK-SDTSSGAEGAKYVLQSLTVNSKKMYKLLIETQMQ 534
           +HDI+NFEP  VE+   D  +   K S T   A GAKYVL+SLT NSK+MYK+L++    
Sbjct: 446 YHDITNFEPYIVETVQTDNAIDFSKDSGTLFNANGAKYVLESLTDNSKRMYKILLQLL-- 503

Query: 535 NMGNLSANTGPKRGTQRT-------GVELKLFNHLCAADFIASNEIALRSMLREFIEHKM 587
            MG ++A    K   + +       G+E       C   F+ S+E+ LR++L EFI+HKM
Sbjct: 504 -MGQINAKNESKPRAKSSSLNKITPGIEFSELFKTCTEQFVVSSEMGLRTILSEFIDHKM 562

Query: 588 ANITKNNSGMEIIWVPYTYAEL 609
           A  TKN  G EII V Y+Y ++
Sbjct: 563 AVNTKNKMGKEIINVKYSYGDM 584

>CAGL0B01837g complement(166953..168662) similar to tr|Q04600
           Saccharomyces cerevisiae YDR117c, start by similarity
          Length = 569

 Score = 31.2 bits (69), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 30/48 (62%), Gaps = 2/48 (4%)

Query: 536 MGNLSANTGPKRGTQRTGVEL-KLFNHL-CAADFIASNEIALRSMLRE 581
           +GN  +NTG + G  +T +++  L+  +  A DFI+SN++ L+ +  E
Sbjct: 337 IGNQGSNTGSEGGNAKTTIKIVTLYKPINLAKDFISSNKVPLKQLYME 384

>CAGL0L03410g 387487..389682 similar to sp|P47027 Saccharomyces
           cerevisiae YJL090c DPB11 involved in DNA replication and
           S-phase checkpoint, start by similarity
          Length = 731

 Score = 30.8 bits (68), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 34/72 (47%), Gaps = 13/72 (18%)

Query: 4   GEDFVEHNDILSSPAKSRNV-------------TPKRVDPHGERQLRRIHSSKKNLLERI 50
           G D  +  D L  PA++R V               KR+ PHG++  +++ SSK +  + I
Sbjct: 227 GRDSCDCWDDLDDPAQNRLVYEDEEDRMTQRKSISKRLKPHGDKLWQKVMSSKDSKDQEI 286

Query: 51  SLVGNERKNTSP 62
           S +     N++P
Sbjct: 287 SSINENEPNSAP 298

>YPL115C (BEM3) [5330] chr16 complement(332099..335485)
           GTPase-activating protein (GAP) for Cdc42p and Rho1p,
           contains a PH (pleckstrin) domain [3387 bp, 1128 aa]
          Length = 1128

 Score = 30.8 bits (68), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 36/86 (41%), Gaps = 19/86 (22%)

Query: 172 PATPSKKSLTTNHDFTSPLKQIIMNNLKEYKDSTSPGKLTLSRNFTPTPVPKNKKLYQ-- 229
           P  P++ +   N+   SPLK    NNL E  +S        S+  T   + KN ++Y   
Sbjct: 238 PQNPNRMTAVINNHLHSPLKASTSNNLDELTESK-------SQQLTNDAIQKNDRVYSSI 290

Query: 230 ----------TSETKSASSFLDTFEG 245
                     TS  KS SS L+  EG
Sbjct: 291 TSSAYTTGTPTSAAKSPSSLLEVKEG 316

>KLLA0E21362g complement(1900927..1902105) some similarities with
           sgd|S0002771 Saccharomyces cerevisiae YDR363w ESC2
           involved in silencing, hypothetical start
          Length = 392

 Score = 30.0 bits (66), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 49/105 (46%), Gaps = 24/105 (22%)

Query: 146 ATTTYEDNVTPQTDDNFVSNSPEPPEPATPSKKSLTTNHDFTSPLKQIIMNNLKEYKDST 205
           A ++YE++V  ++DD+  S      E  TPS  +     DF   LK+ + +N K + D+ 
Sbjct: 85  AESSYENSVISESDDSIHSELERFKEDQTPSINTQDEMFDF---LKE-VTSNAKNHADTH 140

Query: 206 SPGKLTLSRNFTPTPVPKNKKLYQTSETKSASSFLDTFEGYFDQR 250
           + GK+T             K++Y         +F+ T EG  D+R
Sbjct: 141 NNGKVT-------------KRIYNI-------NFISTLEGSQDKR 165

>Scas_704.30
          Length = 563

 Score = 29.6 bits (65), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 32/61 (52%), Gaps = 2/61 (3%)

Query: 247 FDQRKIVRTNAKSRHTMSMAPDVTREEFSLVSNFFNEN-FQKRPRQK-LFEIQKKMFPQY 304
           FD   I++  + S   ++      +  F +  N FNEN F+K+   + +F+I+ + FP Y
Sbjct: 307 FDGHNIIQRKSISNQYLTSQNKTNKSRFKMFKNIFNENAFRKQMTNRGMFQIRLENFPPY 366

Query: 305 W 305
           +
Sbjct: 367 F 367

>Scas_720.5
          Length = 931

 Score = 29.6 bits (65), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 39/86 (45%), Gaps = 15/86 (17%)

Query: 210 LTLSRNFTPTPVPKNKKLYQTSETKSASSFLDTFEGYFDQRKIVRTNAKSRHTMSMAPDV 269
           L LS+   PT +P    ++ ++ T S  + L   +G  D+R            +S APDV
Sbjct: 79  LPLSKFQLPTQIPSKADVFDSNNTTSRINTL-KLQGRVDRR------------VSFAPDV 125

Query: 270 TREEFSLVSNFFNENFQKRPRQKLFE 295
           T   F  V +  +   Q+ PR+K  E
Sbjct: 126 TLHSFDFVPDGISS--QREPRRKQHE 149

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.314    0.130    0.368 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 21,408,059
Number of extensions: 1023939
Number of successful extensions: 5643
Number of sequences better than 10.0: 447
Number of HSP's gapped: 5556
Number of HSP's successfully gapped: 522
Length of query: 609
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 502
Effective length of database: 12,891,983
Effective search space: 6471775466
Effective search space used: 6471775466
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 65 (29.6 bits)