Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YBR059C (AKL1)1108108347830.0
Scas_661.27109550416600.0
CAGL0H10208g102760315280.0
Sklu_1752.285856515080.0
Kwal_27.1094593538514750.0
CAGL0K11990g99139714500.0
KLLA0F18612g81439014210.0
AGR027C96140713361e-167
Kwal_27.115427913198058e-93
Scas_601.66613197801e-90
Scas_671.167233257814e-90
ADL217W7503137731e-88
Sklu_2226.77953217698e-88
YIL095W (PRK1)8103327709e-88
KLLA0E08371g7773197601e-86
CAGL0G02607g6883197302e-83
YNL020C (ARK1)6383177263e-83
CAGL0J03432g6223157112e-81
KLLA0C06138g7082842618e-23
Sklu_2419.96952862474e-21
Scas_700.288961962403e-20
ACL006W7082872394e-20
Scas_644.157262852376e-20
Sklu_2361.38843162361e-19
CAGL0J11638g7462802332e-19
YPL150W9013062306e-19
YMR001C (CDC5)7052862271e-18
Kwal_56.224766972862261e-18
Kwal_26.87518481962233e-18
KLLA0F11319g8431962199e-18
AFL101C3672372042e-16
CAGL0M02299g8933092092e-16
Sklu_2419.105662202045e-16
ACR133C8511982046e-16
Kwal_56.242743463511978e-16
AFR696C11422312031e-15
YPL236C3643331952e-15
Kwal_33.131125052531982e-15
KLLA0C01650g11122311993e-15
Sklu_1962.23643641933e-15
ABL034W14252301984e-15
Kwal_55.215458652601931e-14
Scas_707.369152261922e-14
YOL100W (PKH2)10812431913e-14
CAGL0K05709g11032311913e-14
CAGL0L11550g10722521886e-14
Kwal_23.632515422671886e-14
KLLA0B02332g3612861836e-14
KLLA0E21780g10162851869e-14
YHR102W (KIC1)10802451851e-13
Scas_580.610152321842e-13
Sklu_2323.34002541802e-13
AFR335C10331961832e-13
YDR507C (GIN4)11422311823e-13
Kwal_26.778812672301823e-13
AEL230W6083091794e-13
Kwal_56.226939841951805e-13
KLLA0A03806g6023181795e-13
ACL104C9472351796e-13
KLLA0F13552g12672301806e-13
Scas_660.286232471779e-13
Scas_458.13673121712e-12
YKL101W (HSL1)15182301743e-12
Kwal_56.240913811991703e-12
YDR490C (PKH1)7663221733e-12
Scas_493.211172371733e-12
Kwal_47.182335982911723e-12
CAGL0K08514g14892301724e-12
CAGL0G04609g9653101724e-12
CAGL0E05720g3582731675e-12
AGR058W10711931725e-12
Kwal_56.237178581931716e-12
YNR047W8933471716e-12
Scas_598.67902391707e-12
YDR477W (SNF1)6332911689e-12
KLLA0C12485g9252381699e-12
CAGL0I07513g10762001699e-12
Kwal_47.1726311273081691e-11
CAGL0C03509g8953551681e-11
CAGL0M08910g6122891671e-11
YDL028C (MPS1)7643181671e-11
CAGL0M11396g11921931672e-11
AFR377C7261971652e-11
Scas_502.211161971662e-11
Scas_627.73492371613e-11
CAGL0K02167g11622761663e-11
YCL024W (KCC4)10372311653e-11
YOR233W (KIN4)8002901643e-11
AER264C14832881653e-11
Scas_616.1014612301654e-11
Scas_564.712101931644e-11
Scas_693.1710492031644e-11
Sklu_2437.1610711941644e-11
YER129W (PAK1)11422261635e-11
YDR523C (SPS1)4902031615e-11
Sklu_2366.54662421616e-11
YNL298W (CLA4)8422031617e-11
YDR122W (KIN1)10641941627e-11
KLLA0A07403g8792371618e-11
Sklu_2086.42431241548e-11
Kwal_26.735514462841619e-11
AEL205W7932431609e-11
YAR019C (CDC15)9742661611e-10
YCR073C (SSK22)13312501611e-10
CAGL0G09020g3612011561e-10
KLLA0F19536g11041941601e-10
YBR274W (CHK1)5272141581e-10
KLLA0E17127g8521901591e-10
Kwal_23.566816892121601e-10
Kwal_23.52908192041591e-10
YPL141C8652411582e-10
Sklu_2073.311822241592e-10
Kwal_26.78619551761582e-10
CAGL0K02673g9151961582e-10
ACR196C5302011562e-10
KLLA0C00979g4833101562e-10
AFR724C4402861553e-10
Kwal_23.64588683561573e-10
ABR014W9711771573e-10
KLLA0C08525g15512521573e-10
ACL053C11812801563e-10
CAGL0B01925g9442031554e-10
CAGL0M10153g8671761554e-10
Scas_668.228931761554e-10
YLR096W (KIN2)11471931555e-10
Kwal_26.715412132921555e-10
KLLA0C03828g7933121545e-10
Scas_602.1111863011546e-10
YGL179C (TOS3)5602041526e-10
Scas_720.9416832621547e-10
YHL007C (STE20)9391761538e-10
Scas_675.25271891518e-10
CAGL0M03729g8612031529e-10
CAGL0J03872g6611931529e-10
Kwal_26.87098292361511e-09
Scas_651.183712491481e-09
YPL209C (IPL1)3671981481e-09
Scas_685.245152501501e-09
CAGL0M02519g7563051511e-09
ADL315C4342501491e-09
Scas_584.1110741941511e-09
Kwal_33.141678383131511e-09
AEL284C4791791491e-09
Scas_633.297893121501e-09
Scas_548.613821691502e-09
YJL095W (BCK1)14782981502e-09
YJL187C (SWE1)8192271492e-09
Scas_713.216413371482e-09
Scas_700.348642301483e-09
CAGL0H00979g3991601463e-09
CAGL0F03311g10451961483e-09
AAR009W4532661454e-09
YDL159W (STE7)5151991454e-09
ACR281C12591671475e-09
KLLA0B13112g7301931465e-09
CAGL0C05005g10762521465e-09
KLLA0B13607g9891761465e-09
AEL149C7272271456e-09
YPL203W (TPK2)3802611436e-09
YAL017W (PSK1)13561241466e-09
KLLA0F07623g12291241457e-09
CAGL0M08404g4621421437e-09
AEL115C3862011427e-09
Sklu_1603.24881831438e-09
CAGL0L03520g14472991441e-08
CAGL0I09504g5282991421e-08
YNR031C (SSK2)15793111441e-08
Kwal_55.203267501931421e-08
Scas_640.14*7281931421e-08
Scas_629.169182981421e-08
Sklu_1995.27291931421e-08
CAGL0H06259g13361671412e-08
YHR082C (KSP1)10291951412e-08
ADR300C8901911412e-08
Scas_477.57031821402e-08
ADR313W5782061402e-08
KLLA0F14190g13383031412e-08
KLLA0B07205g4552001392e-08
YCR091W (KIN82)7202901402e-08
YJL164C (TPK1)3971271382e-08
KLLA0F01276g5191841393e-08
Scas_689.25*4091271383e-08
YOL045W (PSK2)11011661403e-08
KLLA0C18568g7743031393e-08
Scas_643.2010822801393e-08
AEL185C5152381383e-08
CAGL0H01639g5212311383e-08
KLLA0C04191g7972141384e-08
YKL166C (TPK3)3981271364e-08
AFR372W7742181385e-08
Kwal_14.12734151801365e-08
Sklu_2429.54322891365e-08
ABR177C7532501375e-08
CAGL0F00913g12061231385e-08
Scas_720.1038042041376e-08
Scas_711.2515152931386e-08
ABL011C7012121376e-08
KLLA0B07579g7222331367e-08
Kwal_27.100047351591367e-08
ACR191C11491861368e-08
ADR167W8733471368e-08
Kwal_33.138463751271338e-08
ADR317C8193191358e-08
CAGL0D02244g4871991349e-08
CAGL0B02739g6761931359e-08
KLLA0D03190g3721071339e-08
Sklu_2066.26392581341e-07
CAGL0K01617g7742711341e-07
Kwal_56.240593532011321e-07
Kwal_55.201898121911341e-07
KLLA0A02717g4322641321e-07
Kwal_56.245844352011321e-07
YKL048C (ELM1)6401841331e-07
YDR283C (GCN2)16592291341e-07
YFR014C (CMK1)4462661321e-07
Kwal_27.1058111541861332e-07
Scas_544.64892071322e-07
YBL105C (PKC1)11511861332e-07
Kwal_0.964272531312e-07
CAGL0F09075g7462881332e-07
YPR054W (SMK1)3882311312e-07
ACR119W9312301332e-07
Scas_703.57492851322e-07
Scas_683.123561891302e-07
Kwal_33.141925771491312e-07
YOL016C (CMK2)4472601312e-07
YLR362W (STE11)7171931322e-07
AER222C4232631303e-07
YMR139W (RIM11)3702051293e-07
Scas_634.57902311313e-07
Kwal_33.140815802551303e-07
Kwal_27.97638682491313e-07
KLLA0D09328g10462071313e-07
ADR253W3802171284e-07
Sklu_2211.511751861314e-07
Sklu_1886.26471491304e-07
KLLA0B03586g7342851304e-07
AFL090W3461071274e-07
CAGL0M09361g11441861304e-07
ADL389W7112851294e-07
YHR205W (SCH9)8242911294e-07
KLLA0E15378g7242691295e-07
Scas_690.133542561275e-07
YDL025C6201481285e-07
Scas_610.76682461286e-07
Kwal_27.125594141771276e-07
Scas_715.3411501861296e-07
YGR052W3692741267e-07
AFR092W14233301287e-07
Kwal_47.183076211891277e-07
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YBR059C
         (1089 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YBR059C (AKL1) [250] chr2 complement(356821..360147) Serine/thre...  1847   0.0  
Scas_661.27                                                           644   0.0  
CAGL0H10208g complement(996853..999936) similar to sp|P38080 Sac...   593   0.0  
Sklu_1752.2 YBR059C, Contig c1752 577-3153 reverse complement         585   0.0  
Kwal_27.10945                                                         572   0.0  
CAGL0K11990g complement(1155395..1158370) some similarities with...   563   0.0  
KLLA0F18612g 1711131..1713575 some similarities with sp|P38080 S...   551   0.0  
AGR027C [4337] [Homologous to ScYBR059C (AKL1) - SH] (763309..76...   519   e-167
Kwal_27.11542                                                         314   8e-93
Scas_601.6                                                            305   1e-90
Scas_671.16                                                           305   4e-90
ADL217W [1524] [Homologous to ScYIL095W (PRK1) - SH; ScYNL020C (...   302   1e-88
Sklu_2226.7 YIL095W, Contig c2226 8986-11373                          300   8e-88
YIL095W (PRK1) [2580] chr9 (183934..186366) Serine/threonine pro...   301   9e-88
KLLA0E08371g complement(756205..758538) similar to sp|P40494 Sac...   297   1e-86
CAGL0G02607g complement(240244..242310) similar to sp|P40494 Sac...   285   2e-83
YNL020C (ARK1) [4567] chr14 complement(595621..597537) Serine/th...   284   3e-83
CAGL0J03432g 327428..329296 similar to sp|P53974 Saccharomyces c...   278   2e-81
KLLA0C06138g 540409..542535 similar to sp|P32562 Saccharomyces c...   105   8e-23
Sklu_2419.9 YMR001C, Contig c2419 14049-16136                         100   4e-21
Scas_700.28                                                            97   3e-20
ACL006W [1043] [Homologous to ScYMR001C (CDC5) - SH] complement(...    97   4e-20
Scas_644.15                                                            96   6e-20
Sklu_2361.3 YPL150W, Contig c2361 3677-6331                            96   1e-19
CAGL0J11638g complement(1128620..1130860) highly similar to sp|P...    94   2e-19
YPL150W (YPL150W) [5297] chr16 (268187..270892) Serine/threonine...    93   6e-19
YMR001C (CDC5) [3966] chr13 complement(269019..271136) Serine/th...    92   1e-18
Kwal_56.22476                                                          92   1e-18
Kwal_26.8751                                                           91   3e-18
KLLA0F11319g 1042436..1044967 similar to sgd|S0006071 Saccharomy...    89   9e-18
AFL101C [3094] [Homologous to ScYPL209C (IPL1) - SH] (249144..25...    83   2e-16
CAGL0M02299g 273725..276406 similar to tr|Q12152 Saccharomyces c...    85   2e-16
Sklu_2419.10 , Contig c2419 14439-16135                                83   5e-16
ACR133C [1180] [Homologous to ScYPL150W - SH] (581468..584023) [...    83   6e-16
Kwal_56.24274                                                          80   8e-16
AFR696C [3889] [Homologous to ScYDR507C (GIN4) - SH; ScYCL024W (...    83   1e-15
YPL236C (YPL236C) [5213] chr16 complement(101608..102702) Serine...    80   2e-15
Kwal_33.13112                                                          81   2e-15
KLLA0C01650g 128119..131457 similar to sp|Q12263 Saccharomyces c...    81   3e-15
Sklu_1962.2 YPL236C, Contig c1962 744-1838 reverse complement          79   3e-15
ABL034W [558] [Homologous to ScYKL101W (HSL1) - SH] complement(3...    81   4e-15
Kwal_55.21545                                                          79   1e-14
Scas_707.36                                                            79   2e-14
YOL100W (PKH2) [4721] chr15 (129236..132481) Serine/threonine pr...    78   3e-14
CAGL0K05709g complement(555903..559214) similar to sp|Q12263 Sac...    78   3e-14
CAGL0L11550g 1229719..1232937 similar to sp|P38692 Saccharomyces...    77   6e-14
Kwal_23.6325                                                           77   6e-14
KLLA0B02332g complement(206863..207948) similar to sp|P38991 Sac...    75   6e-14
KLLA0E21780g complement(1936438..1939488) similar to sp|P38692 S...    76   9e-14
YHR102W (KIC1) [2390] chr8 (316574..319816) Serine/threonine pro...    76   1e-13
Scas_580.6                                                             75   2e-13
Sklu_2323.3 YPL209C, Contig c2323 5241-6443                            74   2e-13
AFR335C [3527] [Homologous to ScYOL100W (PKH2) - SH; ScYDR490C (...    75   2e-13
YDR507C (GIN4) [1321] chr4 complement(1462346..1465774) Serine/t...    75   3e-13
Kwal_26.7788                                                           75   3e-13
AEL230W [2276] [Homologous to ScYDR477W (SNF1) - SH] complement(...    74   4e-13
Kwal_56.22693                                                          74   5e-13
KLLA0A03806g complement(338807..340615) gi|2181934|emb|CAA61235....    74   5e-13
ACL104C [945] [Homologous to ScYHR102W (KIC1) - SH] (157357..160...    74   6e-13
KLLA0F13552g complement(1252906..1256709) gi|33386566|emb|CAD877...    74   6e-13
Scas_660.28                                                            73   9e-13
Scas_458.1                                                             70   2e-12
YKL101W (HSL1) [3161] chr11 (248566..253122) Serine/threonine pr...    72   3e-12
Kwal_56.24091                                                          70   3e-12
YDR490C (PKH1) [1306] chr4 complement(1431956..1434256) Serine/t...    71   3e-12
Scas_493.2                                                             71   3e-12
Kwal_47.18233                                                          71   3e-12
CAGL0K08514g complement(853314..857783) similar to sp|P34244 Sac...    71   4e-12
CAGL0G04609g complement(437162..440059) similar to sp|Q12236 Sac...    71   4e-12
CAGL0E05720g 569028..570104 similar to sp|P38991 Saccharomyces c...    69   5e-12
AGR058W [4368] [Homologous to ScYLR096W (KIN2) - SH; ScYDR122W (...    71   5e-12
Kwal_56.23717                                                          70   6e-12
YNR047W (YNR047W) [4630] chr14 (708522..711203) Serine/threonine...    70   6e-12
Scas_598.6                                                             70   7e-12
YDR477W (SNF1) [1293] chr4 (1412361..1414262) Serine/threonine p...    69   9e-12
KLLA0C12485g 1060167..1062944 weakly similar to sp|Q12236 Saccha...    70   9e-12
CAGL0I07513g 721775..725005 similar to sp|Q12236 Saccharomyces c...    70   9e-12
Kwal_47.17263                                                          70   1e-11
CAGL0C03509g complement(350846..353533) similar to sp|P53739 Sac...    69   1e-11
CAGL0M08910g complement(887703..889541) highly similar to sp|Q00...    69   1e-11
YDL028C (MPS1) [834] chr4 complement(400994..403288) Multi-funct...    69   1e-11
CAGL0M11396g 1120559..1124137 similar to sp|P13186 Saccharomyces...    69   2e-11
AFR377C [3569] [Homologous to ScYDR466W - SH] (1116595..1118775)...    68   2e-11
Scas_502.2                                                             69   2e-11
Scas_627.7                                                             67   3e-11
CAGL0K02167g complement(191468..194956) similar to sp|P38990 Sac...    69   3e-11
YCL024W (KCC4) [520] chr3 (79161..82274) Serine/threonine protei...    68   3e-11
YOR233W (KIN4) [5024] chr15 (775846..778248) Serine/threonine pr...    68   3e-11
AER264C [2766] [Homologous to ScYCR073C (SSK22) - SH; ScYNR031C ...    68   3e-11
Scas_616.10                                                            68   4e-11
Scas_564.7                                                             68   4e-11
Scas_693.17                                                            68   4e-11
Sklu_2437.16 YOL100W, Contig c2437 35714-38929 reverse complement      68   4e-11
YER129W (PAK1) [1559] chr5 (417277..420705) Protein kinase capab...    67   5e-11
YDR523C (SPS1) [1335] chr4 complement(1485554..1487026) Serine/t...    67   5e-11
Sklu_2366.5 YBR274W, Contig c2366 12866-14266 reverse complement       67   6e-11
YNL298W (CLA4) [4314] chr14 (68913..71441) Serine/threonine prot...    67   7e-11
YDR122W (KIN1) [969] chr4 (694694..697888) Serine/threonine prot...    67   7e-11
KLLA0A07403g 661261..663900 similar to sp|P48562 Saccharomyces c...    67   8e-11
Sklu_2086.4 , Contig c2086 6437-7168 reverse complement                64   8e-11
Kwal_26.7355                                                           67   9e-11
AEL205W [2301] [Homologous to ScYNL298W (CLA4) - SH; ScYOL113W (...    66   9e-11
YAR019C (CDC15) [74] chr1 complement(172211..175135) MAP kinase ...    67   1e-10
YCR073C (SSK22) [598] chr3 complement(242584..246579) Map kinase...    67   1e-10
CAGL0G09020g 860266..861351 highly similar to sp|P06245 Saccharo...    65   1e-10
KLLA0F19536g 1808263..1811577 similar to sp|P13186 Saccharomyces...    66   1e-10
YBR274W (CHK1) [453] chr2 (749551..751134) Checkpoint kinase, re...    65   1e-10
KLLA0E17127g complement(1515721..1518279) similar to sp|P38691 S...    66   1e-10
Kwal_23.5668                                                           66   1e-10
Kwal_23.5290                                                           66   1e-10
YPL141C (YPL141C) [5305] chr16 complement(283463..286060) Serine...    65   2e-10
Sklu_2073.3 YER129W, Contig c2073 2194-5742                            66   2e-10
Kwal_26.7861                                                           65   2e-10
CAGL0K02673g complement(240509..243256) similar to sp|Q03497 Sac...    65   2e-10
ACR196C [1243] [Homologous to ScYDL159W (STE7) - SH] (692321..69...    65   2e-10
KLLA0C00979g 73295..74746 similar to sp|P08458 Saccharomyces cer...    65   2e-10
AFR724C [3917] [Homologous to ScYDR523C (SPS1) - SH] (1769897..1...    64   3e-10
Kwal_23.6458                                                           65   3e-10
ABR014W [605] [Homologous to ScYHL007C (STE20) - SH] complement(...    65   3e-10
KLLA0C08525g 744554..749209 similar to sp|P53599 Saccharomyces c...    65   3e-10
ACL053C [996] [Homologous to ScYER129W (PAK1) - SH; ScYGL179C (T...    65   3e-10
CAGL0B01925g 176316..179150 similar to sp|P13185 Saccharomyces c...    64   4e-10
CAGL0M10153g complement(1010688..1013291) some similarities with...    64   4e-10
Scas_668.22                                                            64   4e-10
YLR096W (KIN2) [3511] chr12 (332591..336034) Serine/threonine pr...    64   5e-10
Kwal_26.7154                                                           64   5e-10
KLLA0C03828g 349187..351568 similar to sp|P54199 Saccharomyces c...    64   5e-10
Scas_602.11                                                            64   6e-10
YGL179C (TOS3) [1812] chr7 complement(163413..165095) Serine/thr...    63   6e-10
Scas_720.94                                                            64   7e-10
YHL007C (STE20) [2279] chr8 complement(95113..97932) Serine/thre...    64   8e-10
Scas_675.2                                                             63   8e-10
CAGL0M03729g complement(420316..422901) similar to sp|P48562 Sac...    63   9e-10
CAGL0J03872g 365869..367854 similar to sp|Q01919 Saccharomyces c...    63   9e-10
Kwal_26.8709                                                           63   1e-09
Scas_651.18                                                            62   1e-09
YPL209C (IPL1) [5240] chr16 complement(156489..157592) Serine/th...    62   1e-09
Scas_685.24                                                            62   1e-09
CAGL0M02519g complement(290723..292993) highly similar to tr|Q03...    63   1e-09
ADL315C [1426] [Homologous to ScYPR054W (SMK1) - SH] (146098..14...    62   1e-09
Scas_584.11                                                            63   1e-09
Kwal_33.14167                                                          63   1e-09
AEL284C [2221] [Homologous to ScYGR052W - SH] (106480..107919) [...    62   1e-09
Scas_633.29                                                            62   1e-09
Scas_548.6                                                             62   2e-09
YJL095W (BCK1) [2820] chr10 (247171..251607) Serine/threonine pr...    62   2e-09
YJL187C (SWE1) [2737] chr10 complement(76802..79261) Serine/tyro...    62   2e-09
Scas_713.21                                                            62   2e-09
Scas_700.34                                                            62   3e-09
CAGL0H00979g complement(94328..95527) similar to tr|Q12003 Sacch...    61   3e-09
CAGL0F03311g complement(327599..330736) similar to sp|P38691 Sac...    62   3e-09
AAR009W [195] [Homologous to ScYOL016C (CMK2) - SH; ScYFR014C (C...    60   4e-09
YDL159W (STE7) [712] chr4 (172482..174029) Serine/threonine/tyro...    60   4e-09
ACR281C [1328] [Homologous to ScYOL045W - SH; ScYAL017W (FUN31) ...    61   5e-09
KLLA0B13112g complement(1146006..1148198) similar to sp|P23561 S...    61   5e-09
CAGL0C05005g complement(467626..470856) similar to sp|P27636 Sac...    61   5e-09
KLLA0B13607g 1191592..1194561 weakly similar to sp|Q03497 Saccha...    61   5e-09
AEL149C [2357] [Homologous to ScYJL187C (SWE1) - SH] (348350..35...    60   6e-09
YPL203W (TPK2) [5245] chr16 (166255..167397) Catalytic subunit o...    60   6e-09
YAL017W (PSK1) [51] chr1 (120228..124298) Serine/threonine prote...    61   6e-09
KLLA0F07623g 720246..723935 similar to sp|P31374 Saccharomyces c...    60   7e-09
CAGL0M08404g complement(836791..838179) some similarities with s...    60   7e-09
AEL115C [2391] [Homologous to ScYKL166C (TPK3) - SH; ScYJL164C (...    59   7e-09
Sklu_1603.2 YPR054W, Contig c1603 1858-3324 reverse complement         60   8e-09
CAGL0L03520g complement(401103..405446) similar to sp|Q01389 Sac...    60   1e-08
CAGL0I09504g 909319..910905 similar to sp|P38147 Saccharomyces c...    59   1e-08
YNR031C (SSK2) [4613] chr14 complement(680693..685432) MAP kinas...    60   1e-08
Kwal_55.20326                                                          59   1e-08
Scas_640.14*                                                           59   1e-08
Scas_629.16                                                            59   1e-08
Sklu_1995.2 YLR362W, Contig c1995 1578-3767                            59   1e-08
CAGL0H06259g 615045..619055 similar to sp|P31374 Saccharomyces c...    59   2e-08
YHR082C (KSP1) [2372] chr8 complement(268460..271549) Serine/thr...    59   2e-08
ADR300C [2042] [Homologous to ScYHR082C (KSP1) - SH] (1222346..1...    59   2e-08
Scas_477.5                                                             59   2e-08
ADR313W [2054] [Homologous to ScYDL025C - SH] complement(1255932...    59   2e-08
KLLA0F14190g 1311121..1315137 gi|3021329|emb|CAA06336.1 Kluyvero...    59   2e-08
KLLA0B07205g complement(624606..625973) some similarities with s...    58   2e-08
YCR091W (KIN82) [614] chr3 (274400..276562) Serine/threonine pro...    59   2e-08
YJL164C (TPK1) [2757] chr10 complement(109959..111152) Catalytic...    58   2e-08
KLLA0F01276g complement(120001..121560) similar to sp|P38147 Sac...    58   3e-08
Scas_689.25*                                                           58   3e-08
YOL045W (PSK2) [4773] chr15 (243495..246800) Serine/threonine pr...    59   3e-08
KLLA0C18568g 1639958..1642282 gi|6967028|emb|CAB72435.1 Kluyvero...    58   3e-08
Scas_643.20                                                            58   3e-08
AEL185C [2321] [Homologous to ScYBR274W (CHK1) - SH] (291129..29...    58   3e-08
CAGL0H01639g 158967..160532 similar to sp|P08458 Saccharomyces c...    58   3e-08
KLLA0C04191g 384198..386591 weakly similar to sp|P27636 Saccharo...    58   4e-08
YKL166C (TPK3) [3104] chr11 complement(134514..135710) Catalytic...    57   4e-08
AFR372W [3564] [Homologous to ScYJR059W (PTK2 ) - SH] complement...    58   5e-08
Kwal_14.1273                                                           57   5e-08
Sklu_2429.5 YOL016C, Contig c2429 9000-10298 reverse complement        57   5e-08
ABR177C [770] [Homologous to ScYPR161C (SGV1) - SH] (735828..738...    57   5e-08
CAGL0F00913g 97023..100643 similar to sp|P31374 Saccharomyces ce...    58   5e-08
Scas_720.103                                                           57   6e-08
Scas_711.25                                                            58   6e-08
ABL011C [581] [Homologous to ScYLR362W (STE11) - SH] (378259..38...    57   6e-08
KLLA0B07579g 659591..661759 weakly similar to sp|P32944 Saccharo...    57   7e-08
Kwal_27.10004                                                          57   7e-08
ACR191C [1238] [Homologous to ScYBL105C (PKC1) - SH] (680398..68...    57   8e-08
ADR167W [1909] [Homologous to ScYNR047W - SH; ScYCR091W (KIN82) ...    57   8e-08
Kwal_33.13846                                                          56   8e-08
ADR317C [2058] [Homologous to ScYDL028C (MPS1) - SH] (1263082..1...    57   8e-08
CAGL0D02244g complement(229504..230967) similar to sp|P24719 Sac...    56   9e-08
CAGL0B02739g complement(262590..264620) similar to sp|P23561 Sac...    57   9e-08
KLLA0D03190g 267933..269051 highly similar to sp|P06245 Saccharo...    56   9e-08
Sklu_2066.2 YJL128C, Contig c2066 5081-7000                            56   1e-07
CAGL0K01617g complement(142479..144803) similar to sp|P54199 Sac...    56   1e-07
Kwal_56.24059                                                          55   1e-07
Kwal_55.20189                                                          56   1e-07
KLLA0A02717g 245082..246380 some similarities with sp|P53233 Sac...    55   1e-07
Kwal_56.24584                                                          55   1e-07
YKL048C (ELM1) [3211] chr11 complement(346859..348781) Serine/th...    56   1e-07
YDR283C (GCN2) [1112] chr4 complement(1025062..1030041) Serine/t...    56   1e-07
YFR014C (CMK1) [1695] chr6 complement(172529..173869) Calcium/ca...    55   1e-07
Kwal_27.10581                                                          56   2e-07
Scas_544.6                                                             55   2e-07
YBL105C (PKC1) [98] chr2 complement(14241..17696) Protein kinase...    56   2e-07
Kwal_0.96                                                              55   2e-07
CAGL0F09075g 894761..897001 similar to sp|P11792 Saccharomyces c...    56   2e-07
YPR054W (SMK1) [5484] chr16 (666275..667441) Sporulation-specifi...    55   2e-07
ACR119W [1166] [Homologous to ScYPL141C - SH; ScYOR233W (KIN4) -...    56   2e-07
Scas_703.5                                                             55   2e-07
Scas_683.12                                                            55   2e-07
Kwal_33.14192                                                          55   2e-07
YOL016C (CMK2) [4800] chr15 complement(294777..296120) Calcium/c...    55   2e-07
YLR362W (STE11) [3744] chr12 (849865..852018) MAP kinase kinase ...    55   2e-07
AER222C [2724] [Homologous to ScYAR018C (KIN3) - SH] (1043479..1...    55   3e-07
YMR139W (RIM11) [4096] chr13 (546124..547236) Member of the GSK3...    54   3e-07
Scas_634.5                                                             55   3e-07
Kwal_33.14081                                                          55   3e-07
Kwal_27.9763                                                           55   3e-07
KLLA0D09328g complement(788565..791705) some similarities with s...    55   3e-07
ADR253W [1994] [Homologous to ScYMR139W (RIM11) - SH; ScYDL079C ...    54   4e-07
Sklu_2211.5 YBL105C, Contig c2211 10237-13764                          55   4e-07
Sklu_1886.2 YDL025C, Contig c1886 2790-4733                            55   4e-07
KLLA0B03586g complement(326871..329075) similar to sp|P11792 Sac...    55   4e-07
AFL090W [3103] [Homologous to ScYPL203W (TPK2) - SH] complement(...    54   4e-07
CAGL0M09361g complement(928484..931918) highly similar to sp|P24...    55   4e-07
ADL389W [1352] [Homologous to ScYHR205W (SCH9) - SH] complement(...    54   4e-07
YHR205W (SCH9) [2490] chr8 (509361..511835) Serine/threonine pro...    54   4e-07
KLLA0E15378g 1362851..1365025 some similarities with sp|P08018 S...    54   5e-07
Scas_690.13                                                            54   5e-07
YDL025C (YDL025C) [836] chr4 complement(405341..407203) Serine/t...    54   5e-07
Scas_610.7                                                             54   6e-07
Kwal_27.12559                                                          54   6e-07
Scas_715.34                                                            54   6e-07
YGR052W (YGR052W) [2015] chr7 (593598..594707) Serine/threonine ...    53   7e-07
AFR092W [3284] [Homologous to ScYJL095W (BCK1) - SH] complement(...    54   7e-07
Kwal_47.18307                                                          54   7e-07
YKL116C (PRR1) [3148] chr11 complement(220990..222546) Serine/th...    53   8e-07
Sklu_2436.14 YDR466W, Contig c2436 31299-33653                         54   8e-07
KLLA0C16577g complement(1451181..1452695) some similarities with...    53   8e-07
Kwal_26.8347                                                           53   8e-07
Kwal_47.17868                                                          53   9e-07
YOR267C (HRK1) [5054] chr15 complement(822585..824864) Serine/th...    54   9e-07
KLLA0F24618g complement(2288943..2290613) similar to sp|P38070 S...    53   1e-06
YDR466W (PKH3) [1284] chr4 (1395109..1397805) Serine/threonine p...    53   1e-06
Scas_667.18                                                            53   1e-06
CAGL0I03498g 297344..298699 similar to sp|P06784 Saccharomyces c...    53   1e-06
CAGL0K00693g complement(74637..77267) similar to sp|P32944 Sacch...    53   1e-06
AER232C [2734] [Homologous to ScYHR030C - SH; ScYKL161C (SLT2) -...    53   1e-06
CAGL0F03707g complement(359839..361665) similar to sp|Q08732 Sac...    53   1e-06
CAGL0I08349g complement(813728..815731) similar to sp|P23293 Sac...    53   1e-06
KLLA0D07348g 626999..629728 weakly similar to sgd|S0006062 Sacch...    53   1e-06
KLLA0C03938g complement(358851..360632) some similarities with s...    53   1e-06
Kwal_47.17252                                                          53   1e-06
CAGL0C02893g complement(286017..287966) similar to tr|Q08732 Sac...    53   1e-06
YOL113W (SKM1) [4709] chr15 (104325..106292) Serine/threonine pr...    53   1e-06
CAGL0G05720g complement(547617..549833) similar to sp|P22211 Sac...    53   1e-06
Kwal_33.13681                                                          53   1e-06
AAL083W [104] [Homologous to ScYDR283C (GCN2) - SH] complement(1...    53   2e-06
Scas_678.24                                                            53   2e-06
Scas_653.25                                                            52   2e-06
ABL143C [449] [Homologous to ScYNL183C (NPR1) - SH; ScYDL214C (P...    52   2e-06
KLLA0E03487g complement(323764..325707) similar to sgd|S0002874 ...    52   2e-06
AFL143C [3052] [Homologous to ScYPL236C - SH] (164241..165326) [...    52   2e-06
CAGL0K04301g 404419..405486 similar to sp|P53233 Saccharomyces c...    52   2e-06
KLLA0B11902g 1041657..1043144 gi|7385125|gb|AAF61706.1|AF226711_...    52   2e-06
KLLA0E07414g complement(672690..673787) highly similar to sp|P21...    52   2e-06
Scas_336.1                                                             52   2e-06
YDL214C (PRR2) [660] chr4 complement(74447..76546) Serine/threon...    52   2e-06
KLLA0C14278g 1240990..1242615 similar to sp|P28708 Saccharomyces...    52   2e-06
KLLA0E06413g complement(577669..581154) gi|22858696|gb|AAN05732....    52   2e-06
CAGL0I05390g complement(508677..510041) similar to sp|Q12505 Sac...    52   2e-06
Scas_660.20                                                            52   2e-06
KLLA0C04213g 386815..387999 similar to sp|P22209 Saccharomyces c...    52   2e-06
Kwal_47.16761                                                          52   2e-06
KLLA0F26983g 2489326..2490729 some similarities with sp|P32801 S...    52   2e-06
YPL140C (MKK2) [5306] chr16 complement(287513..289033) MAP kinas...    52   2e-06
YKL161C (YKL161C) [3109] chr11 complement(149391..150692) Serine...    52   2e-06
Kwal_26.8941                                                           52   3e-06
Sklu_2099.2 , Contig c2099 975-2237 reverse complement                 51   3e-06
Kwal_33.13222                                                          49   3e-06
ADL168C [1573] [Homologous to ScYNL307C (MCK1) - SH; ScYOL128C -...    51   3e-06
Kwal_33.14434                                                          52   3e-06
Scas_692.24                                                            52   3e-06
Sklu_1477.2 YKL116C, Contig c1477 684-2414 reverse complement          51   3e-06
Scas_201.1*                                                            50   3e-06
Scas_593.14d                                                           51   4e-06
ABL028W [564] [Homologous to ScYKL126W (YPK1) - SH; ScYMR104C (Y...    51   4e-06
KLLA0E12177g 1080245..1081612 gi|4096112|gb|AAC99804.1 Kluyverom...    51   4e-06
YNL307C (MCK1) [4306] chr14 complement(56446..57573) Member of t...    50   4e-06
Kwal_14.2497                                                           51   4e-06
KLLA0F01507g 144356..145774 some similarities with sp|P47042 Sac...    51   5e-06
KLLA0C07535g 658746..660620 some similarities with sgd|S0005793 ...    51   5e-06
Scas_640.16                                                            50   6e-06
Scas_635.1                                                             50   6e-06
AFL217C [2978] [Homologous to ScYJL128C (PBS2) - SH] (30765..328...    51   6e-06
ACL054W [995] [Homologous to ScYGL180W (APG1) - SH] complement(2...    51   6e-06
ADR379C [2120] [Homologous to ScYOR351C (MEK1) - SH] (1386601..1...    50   7e-06
KLLA0F11143g complement(1026129..1028570) similar to sp|P22216 S...    50   7e-06
Kwal_55.22001                                                          50   7e-06
KLLA0D10527g 892955..894892 similar to sp|P23293 Saccharomyces c...    50   7e-06
CAGL0E01683g complement(166584..167711) highly similar to sp|P21...    50   7e-06
KLLA0B11946g complement(1048033..1049352) similar to sp|P41808 S...    50   7e-06
ACR117W [1164] [Homologous to ScYOR231W (MKK1) - SH; ScYPL140C (...    50   8e-06
CAGL0D01694g complement(176981..178279) similar to sp|P41808 Sac...    50   8e-06
AER223C [2725] [Homologous to ScYAR019C (CDC15) - SH] (1044971.....    50   8e-06
YNL161W (CBK1) [4436] chr14 (332597..334867) Serine/threonine pr...    50   8e-06
CAGL0F04741g 478256..479584 similar to sp|P22517 Saccharomyces c...    50   8e-06
Scas_649.30                                                            50   9e-06
Scas_654.12                                                            50   9e-06
CAGL0J06072g complement(572377..574698) similar to sp|P53894 Sac...    50   1e-05
Scas_623.11                                                            49   1e-05
CAGL0L05632g 610481..612514 similar to sp|P08018 Saccharomyces c...    50   1e-05
CAGL0L06820g 767038..768138 highly similar to sp|P38615 Saccharo...    49   1e-05
Scas_688.14                                                            50   1e-05
Scas_673.20*                                                           50   1e-05
KLLA0D11990g join(complement(1023928..1023944), gi|2499590|sp|Q9...    49   1e-05
Scas_619.5*                                                            50   1e-05
AFR035W [3227] [Homologous to ScYNL161W (CBK1) - SH] complement(...    50   1e-05
AGR334W [4645] [Homologous to ScYMR291W - SH] complement(1354612...    49   1e-05
Sklu_1722.2 YJL187C, Contig c1722 1158-3587 reverse complement         50   1e-05
KLLA0F23507g complement(2198603..2200066) similar to sp|P24719 S...    49   1e-05
KLLA0C10802g complement(926916..931934) similar to sp|P15442 Sac...    50   1e-05
Scas_655.2                                                             50   1e-05
ABR088C [679] [Homologous to ScYKL048C (ELM1) - SH] (546324..547...    49   1e-05
CAGL0J11308g 1097845..1100031 similar to sp|P22211 Saccharomyces...    50   1e-05
Kwal_33.14554                                                          50   1e-05
Scas_628.9                                                             49   1e-05
KLLA0F23155g 2157146..2158429 similar to sp|P22517 Saccharomyces...    49   1e-05
YDL101C (DUN1) [768] chr4 complement(280307..281848) Protein kin...    49   1e-05
Sklu_2118.2 YAR018C, Contig c2118 1397-2677                            49   1e-05
AGL242C [4070] [Homologous to ScYPL031C (PHO85) - SH] (246896..2...    49   2e-05
Kwal_23.3590                                                           49   2e-05
Scas_698.37                                                            49   2e-05
CAGL0K04169g 383738..384934 similar to sp|P14681 Saccharomyces c...    49   2e-05
Sklu_2392.6 YNL161W, Contig c2392 12867-15293 reverse complement       49   2e-05
CAGL0J00539g 47095..48561 highly similar to sp|Q00772 Saccharomy...    49   2e-05
CAGL0F03245g complement(316924..320034) similar to sp|P32361 Sac...    49   2e-05
KLLA0D08415g 714473..716797 similar to sp|P22211 Saccharomyces c...    49   2e-05
Scas_718.90                                                            49   2e-05
YNL183C (NPR1) [4417] chr14 complement(293137..295509) Serine/th...    49   2e-05
YKL126W (YPK1) [3140] chr11 (205353..207395) Serine/threonine pr...    49   3e-05
Sklu_2277.8 YOR267C, Contig c2277 9591-11441 reverse complement        49   3e-05
Sklu_2186.4 YHR030C, Contig c2186 5713-7278 reverse complement         48   3e-05
KLLA0D07810g complement(669095..671251) gi|401646|sp|P31034|YL44...    49   3e-05
CAGL0K10604g complement(1029226..1030566) similar to sp|P27466 S...    48   3e-05
Sklu_2354.4 YNL307C, Contig c2354 4429-5520 reverse complement         48   3e-05
KLLA0D14905g 1256065..1257768 gi|28565036|gb|AAO32601.1 Kluyvero...    48   4e-05
KLLA0B06501g complement(576636..579089) some similarities with s...    48   4e-05
ADR174C [1916] [Homologous to ScYOR267C - SH] (1008798..1010813)...    48   4e-05
YHR030C (SLT2) [2317] chr8 complement(168882..170336) Serine/thr...    48   4e-05
ADR033W [1774] [Homologous to ScYGR092W (DBF2) - SH; ScYPR111W (...    48   4e-05
CAGL0H01199g 110610..115556 highly similar to sp|P15442 Saccharo...    48   5e-05
AGL249C [4063] [Homologous to ScYPL042C (SSN3) - SH] (234347..23...    48   5e-05
AEL083W [2423] [Homologous to ScYBR028C - SH] complement(470964....    47   5e-05
Kwal_56.22788                                                          47   5e-05
Kwal_55.21900                                                          47   6e-05
Kwal_14.1416                                                           47   6e-05
Scas_618.8                                                             47   7e-05
KLLA0A02497g 218592..219680 highly similar to sp|P14681 Saccharo...    47   7e-05
Sklu_2430.5 YKL126W, Contig c2430 8144-10345                           47   7e-05
Kwal_27.9773                                                           47   7e-05
KLLA0F17006g complement(1561859..1563106) gi|3127831|emb|CAA6115...    47   7e-05
KLLA0C17160g 1498959..1501454 similar to sp|P53104 Saccharomyces...    47   7e-05
KLLA0E04136g 382874..383995 similar to sp|P15790 Saccharomyces c...    47   8e-05
Sklu_2417.13 YMR139W, Contig c2417 24824-25915 reverse complement      47   8e-05
Scas_582.1                                                             47   8e-05
Scas_717.69                                                            47   9e-05
YPR161C (SGV1) [5576] chr16 complement(864443..866416) Serine/th...    47   9e-05
Kwal_26.7635                                                           47   9e-05
CAGL0H10318g complement(1006299..1007222) highly similar to sp|P...    46   9e-05
Kwal_26.7552                                                           47   9e-05
ABL055C [537] [Homologous to ScYKL116C (PRR1) - SH] (295497..297...    47   9e-05
CAGL0M13167g complement(1291524..1293356) similar to sp|P32801 S...    47   1e-04
YDL079C (MRK1) [789] chr4 complement(312951..314044,314337..3147...    47   1e-04
CAGL0J03828g 362722..364125 similar to sp|P32490 Saccharomyces c...    46   1e-04
ACL191C [858] [Homologous to ScYGR040W (KSS1) - SH] (26475..2757...    46   1e-04
KLLA0B12716g 1109939..1112089 similar to sp|P12688 Saccharomyces...    47   1e-04
Kwal_27.11919                                                          45   1e-04
Scas_683.6                                                             46   1e-04
CAGL0K03399g complement(310487..312598) highly similar to sp|P12...    46   1e-04
Kwal_26.7276                                                           46   1e-04
CAGL0M13541g 1332296..1334164 similar to sp|Q03533 Saccharomyces...    46   1e-04
YIL035C (CKA1) [2632] chr9 complement(287789..288907) Casein kin...    45   2e-04
CAGL0J04290g complement(400939..402012) similar to sp|P16892 Sac...    45   2e-04
CAGL0I05192g complement(493635..494756) highly similar to sp|P15...    45   2e-04
AAL029W [158] [Homologous to ScYLR248W (RCK2) - SH; ScYGL158W (R...    46   2e-04
YOR351C (MEK1) [5128] chr15 complement(995013..996506) Serine/th...    45   2e-04
ADR058C [1799] [Homologous to ScYBR160W (CDC28) - SH] (810941..8...    45   2e-04
Scas_568.9*                                                            45   2e-04
ADL283W [1458] [Homologous to ScYDL108W (KIN28) - SH] complement...    45   2e-04
Scas_721.124                                                           45   2e-04
KLLA0D07304g 623352..624749 some similarities with sp|P32491 Sac...    45   2e-04
CAGL0J04972g 472984..474003 some similarities with tr|Q12100 Sac...    45   2e-04
AEL118C [2388] [Homologous to ScYKL168C (KKQ8) - SH; ScYJL165C (...    45   2e-04
Sklu_2401.9 YGR092W, Contig c2401 17788-19521                          45   2e-04
CAGL0K11550g 1118142..1119758 similar to sp|P28708 Saccharomyces...    45   3e-04
Scas_700.35                                                            45   3e-04
CAGL0B04147g 402798..404498 highly similar to sp|P22204 Saccharo...    45   3e-04
Sklu_1843.3 YOR231W, Contig c1843 2632-4092 reverse complement         45   3e-04
CAGL0K01661g complement(146952..148400) some similarities with t...    45   3e-04
Kwal_23.5576                                                           45   3e-04
YKL168C (KKQ8) [3102] chr11 complement(131293..133497) Serine/th...    45   3e-04
KLLA0E14828g complement(1323743..1324675) gi|27526973|emb|CAD369...    44   3e-04
Scas_716.33                                                            45   3e-04
CAGL0K12562g 1234866..1239914 similar to sp|P43565 Saccharomyces...    45   3e-04
CAGL0G03047g 282299..283918 highly similar to sp|P22204 Saccharo...    45   3e-04
YPL031C (PHO85) [5407] chr16 complement(492014..492914,493017..4...    44   3e-04
Scas_704.50                                                            45   3e-04
CAGL0H07535g 736241..737137 highly similar to sp|P00546 Saccharo...    44   4e-04
Scas_721.61                                                            45   4e-04
CAGL0L07326g 808532..810052 similar to sp|P39009 Saccharomyces c...    45   4e-04
CAGL0K07458g complement(736336..738450) similar to sp|P12688 Sac...    45   4e-04
Scas_721.110                                                           45   4e-04
YHR135C (YCK1) [2422] chr8 complement(372695..374311) Casein kin...    45   4e-04
CAGL0I05896g 560169..562505 some similarities with sp|P14680 Sac...    45   4e-04
Scas_710.28                                                            44   4e-04
CAGL0B03509g complement(349638..351431) similar to sp|P38623 Sac...    44   5e-04
Kwal_56.23841                                                          44   5e-04
Scas_613.13*                                                           44   5e-04
Sklu_2255.4 YGR040W, Contig c2255 6834-7940 reverse complement         44   5e-04
Sklu_2307.1 YPL042C, Contig c2307 215-1945                             44   5e-04
Kwal_26.7682                                                           44   6e-04
Kwal_26.8703                                                           44   6e-04
Scas_680.20                                                            44   6e-04
YGL158W (RCK1) [1831] chr7 (207036..208574) Serine/threonine pro...    44   6e-04
CAGL0J05940g 560563..562023 similar to sp|P23291 Saccharomyces c...    44   6e-04
Scas_713.7                                                             44   7e-04
Sklu_2104.1 YBR160W, Contig c2104 694-1593                             43   7e-04
CAGL0K06479g 636296..639271 some similarities with tr|Q03306 Sac...    44   8e-04
Scas_713.38                                                            43   9e-04
Kwal_27.11830                                                          44   0.001
Sklu_2385.2 YLR113W, Contig c2385 3805-5109 reverse complement         43   0.001
YOR231W (MKK1) [5022] chr15 (772601..774127) Serine/threonine pr...    44   0.001
KLLA0D11814g complement(1007240..1009021) similar to sp|P39073 S...    44   0.001
Kwal_23.3992                                                           44   0.001
ADL102C [1639] [Homologous to ScYIL035C (CKA1) - SH] (503670..50...    43   0.001
YDL108W (KIN28) [761] chr4 (267698..267725,267807..268699) Cycli...    43   0.001
YMR291W (YMR291W) [4245] chr13 (852629..854389) Serine/threonine...    43   0.001
Scas_654.17                                                            43   0.001
CAGL0B04301g 420544..422172 similar to sp|P38070 Saccharomyces c...    43   0.001
YBR160W (CDC28) [345] chr2 (560034..560930) Cyclin-dependent pro...    42   0.001
KLLA0F20053g 1867209..1868543 highly similar to sp|P32485 Saccha...    43   0.001
YKL139W (CTK1) [3128] chr11 (182963..184549) C-terminal domain (...    43   0.001
CAGL0D02002g 207419..209080 similar to sp|Q03957 Saccharomyces c...    43   0.001
Sklu_2232.2 YOR061W, Contig c2232 1216-2340 reverse complement         42   0.001
YBR028C (YBR028C) [220] chr2 complement(294387..295964) Serine/t...    43   0.002
AFR205C [3397] [Homologous to ScYKL139W (CTK1) - SH] (805583..80...    42   0.002
Sklu_1484.2 YDL108W, Contig c1484 2977-3825 reverse complement         42   0.002
YJL128C (PBS2) [2790] chr10 complement(178015..180021) MAP kinas...    43   0.002
AGR048C [4358] [Homologous to ScYLR113W (HOG1) - SH] (807470..80...    42   0.002
Scas_721.46                                                            42   0.002
AFR150C [3342] [Homologous to ScYFL029C (CAK1) - SH] (707306..70...    42   0.002
Kwal_23.3471                                                           42   0.002
Sklu_2342.5 YMR291W, Contig c2342 6908-8599 reverse complement         42   0.002
YLR113W (HOG1) [3526] chr12 (371621..372928) MAP kinase (MAPK), ...    42   0.002
CAGL0L12474g complement(1345044..1345952) highly similar to sp|P...    42   0.002
Scas_684.28                                                            42   0.002
KLLA0B09790g complement(855327..856214) highly similar to sp|P00...    42   0.002
YMR104C (YPK2) [4061] chr13 complement(473419..475452) Serine/th...    42   0.002
Sklu_1436.3 YIL035C, Contig c1436 2418-3536 reverse complement         42   0.002
CAGL0L06006g complement(670707..673535) similar to sp|P53104 Sac...    42   0.002
Scas_711.15                                                            42   0.003
CAGL0L12650g 1357789..1359492 similar to sp|P39073 Saccharomyces...    42   0.003
Kwal_0.307                                                             42   0.003
Scas_22.1                                                              41   0.003
YBL016W (FUS3) [179] chr2 (192416..193477) Serine/threonine prot...    41   0.004
Kwal_17.2687                                                           41   0.004
YGR092W (DBF2) [2052] chr7 (668191..669909) Serine/threonine pro...    41   0.004
YPR111W (DBF20) [5532] chr16 (747302..748996) Cell cycle protein...    41   0.004
YGR040W (KSS1) [2006] chr7 (575400..576506) Serine/threonine pro...    41   0.005
YPL026C (SKS1) [5412] chr16 complement(500671..502179) Serine/th...    41   0.005
KLLA0F01408g 135424..136302 weakly similar to sgd|S0002183 Sacch...    40   0.005
Scas_721.132                                                           41   0.005
KLLA0A09713g 851952..853625 similar to sp|Q03533 Saccharomyces c...    41   0.005
AER195C [2697] [Homologous to ScYCR008W (SAT4) - SH] (1005431..1...    41   0.005
Kwal_23.4276                                                           41   0.006
Sklu_2389.4 YJL057C, Contig c2389 7783-9576                            41   0.006
Sklu_1436.2 , Contig c1436 2420-3329 reverse complement                40   0.006
CAGL0I04422g 394159..395427 some similarities with sp|P22209 Sac...    40   0.006
KLLA0E11979g complement(1060048..1061892) some similarities with...    41   0.006
Sklu_2442.21 YLR248W, Contig c2442 39541-41052 reverse complement      41   0.006
Kwal_55.20221                                                          41   0.006
Kwal_47.18098                                                          40   0.007
YFL033C (RIM15) [1651] chr6 complement(69113..74425) Serine/thre...    41   0.007
Kwal_27.11803                                                          40   0.007
YGL180W (ATG1) [1811] chr7 (160069..162762) Serine/threonine pro...    41   0.007

>YBR059C (AKL1) [250] chr2 complement(356821..360147) Serine/threonine
            protein kinase of unknown function [3327 bp, 1108 aa]
          Length = 1108

 Score = 1847 bits (4783), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 915/1083 (84%), Positives = 915/1083 (84%)

Query: 1    MSITNGTSRSVSAMGHPAVERYTPGHIVCVGTHKVEVVNYLAEGGFAQIYVVKFLEYLNE 60
            MSITNGTSRSVSAMGHPAVERYTPGHIVCVGTHKVEVVNYLAEGGFAQIYVVKFLEYLNE
Sbjct: 1    MSITNGTSRSVSAMGHPAVERYTPGHIVCVGTHKVEVVNYLAEGGFAQIYVVKFLEYLNE 60

Query: 61   FDNTASVPLKIGDVACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRD 120
            FDNTASVPLKIGDVACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRD
Sbjct: 61   FDNTASVPLKIGDVACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRD 120

Query: 121  GVQGFEVLLLMELCPNKSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHR 180
            GVQGFEVLLLMELCPNKSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHR
Sbjct: 121  GVQGFEVLLLMELCPNKSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHR 180

Query: 181  DIKIENVLVDAKNNFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLY 240
            DIKIENVLVDAKNNFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLY
Sbjct: 181  DIKIENVLVDAKNNFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLY 240

Query: 241  RCLPINEKSDIWALGVFLYKLLFFTTPFEMTGQFAILHSKYEFPVNKYSSKLINLIIIML 300
            RCLPINEKSDIWALGVFLYKLLFFTTPFEMTGQFAILHSKYEFPVNKYSSKLINLIIIML
Sbjct: 241  RCLPINEKSDIWALGVFLYKLLFFTTPFEMTGQFAILHSKYEFPVNKYSSKLINLIIIML 300

Query: 301  AENPNLRPNIYQVLYHLCEILNVEVPIEDKYAEGAYNFSKYTQFQNKXXXXXXXXXXXXX 360
            AENPNLRPNIYQVLYHLCEILNVEVPIEDKYAEGAYNFSKYTQFQNK             
Sbjct: 301  AENPNLRPNIYQVLYHLCEILNVEVPIEDKYAEGAYNFSKYTQFQNKLQNVQLQMYQLQQ 360

Query: 361  KKIMQNNKLSDSEENLLNDMFLSSFEISSKLPMNASDGHAAVSRIPSQNVGQELEEEKES 420
            KKIMQNNKLSDSEENLLNDMFLSSFEISSKLPMNASDGHAAVSRIPSQNVGQELEEEKES
Sbjct: 361  KKIMQNNKLSDSEENLLNDMFLSSFEISSKLPMNASDGHAAVSRIPSQNVGQELEEEKES 420

Query: 421  QSDQRKSTLSEDKXXXXXXXXXXXXXXXXPQEINTIQSPGIEDKSIFENKTPGELYYPSV 480
            QSDQRKSTLSEDK                PQEINTIQSPGIEDKSIFENKTPGELYYPSV
Sbjct: 421  QSDQRKSTLSEDKSSRTTSNANSSGTANNPQEINTIQSPGIEDKSIFENKTPGELYYPSV 480

Query: 481  SELDTYLDKELVKQSSDPTISEQSPRLNTQSLPXXXXXXXXXXXXXXXXXXXXXGAATIG 540
            SELDTYLDKELVKQSSDPTISEQSPRLNTQSLP                     GAATIG
Sbjct: 481  SELDTYLDKELVKQSSDPTISEQSPRLNTQSLPQRQKSTSSYSSGGRSMKSTSYGAATIG 540

Query: 541  SDEALANEKTAGINKMKQHKSNNPFPKMNVAYHSTNELSNDASNFFLEEXXXXXXXXXXX 600
            SDEALANEKTAGINKMKQHKSNNPFPKMNVAYHSTNELSNDASNFFLEE           
Sbjct: 541  SDEALANEKTAGINKMKQHKSNNPFPKMNVAYHSTNELSNDASNFFLEEQQQGQRYQQAQ 600

Query: 601  XXXXXXXXXFPDESXXXXXXXXXXXXXXXPKGPANYSQRNFYTGRDRSNKPMQLGGTIAG 660
                     FPDES               PKGPANYSQRNFYTGRDRSNKPMQLGGTIAG
Sbjct: 601  NQTGTQGNTFPDESQYQSRVEQQQQQQDQPKGPANYSQRNFYTGRDRSNKPMQLGGTIAG 660

Query: 661  DSGNRRVNFQNISQNYATNSQSGYLPSQNSPAIPMVRPVISXXXXXXXXXXXXXXXXXXX 720
            DSGNRRVNFQNISQNYATNSQSGYLPSQNSPAIPMVRPVIS                   
Sbjct: 661  DSGNRRVNFQNISQNYATNSQSGYLPSQNSPAIPMVRPVISMNQQQAQQIQAQQLQAQQM 720

Query: 721  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGTYVSDRTNHTTEDMRNAQGGEPPILAG 780
                                            GTYVSDRTNHTTEDMRNAQGGEPPILAG
Sbjct: 721  QAKQQMQAKQQMQVQQQLQVQQQMQIQNANNNGTYVSDRTNHTTEDMRNAQGGEPPILAG 780

Query: 781  NSANEPMHSSSKNEALLIELSPLKEDAGKQSFQDTNEPQTGGIEDAGGSGTIKGSNNNRN 840
            NSANEPMHSSSKNEALLIELSPLKEDAGKQSFQDTNEPQTGGIEDAGGSGTIKGSNNNRN
Sbjct: 781  NSANEPMHSSSKNEALLIELSPLKEDAGKQSFQDTNEPQTGGIEDAGGSGTIKGSNNNRN 840

Query: 841  GVLNLSLNEMDLSRDDTGXXXXXXXXXXXXXXIQQAKLSGRKGSSKRNNYSTDELGDSMV 900
            GVLNLSLNEMDLSRDDTG              IQQAKLSGRKGSSKRNNYSTDELGDSMV
Sbjct: 841  GVLNLSLNEMDLSRDDTGAAVSSFSSSSSSASIQQAKLSGRKGSSKRNNYSTDELGDSMV 900

Query: 901  SSESIDIDLDDARRGKTAERRPLHNERGHKDQARSSDASKSNQFKSKDFSSVSTRQPRQS 960
            SSESIDIDLDDARRGKTAERRPLHNERGHKDQARSSDASKSNQFKSKDFSSVSTRQPRQS
Sbjct: 901  SSESIDIDLDDARRGKTAERRPLHNERGHKDQARSSDASKSNQFKSKDFSSVSTRQPRQS 960

Query: 961  LDLNFQEVNLSSPTLTQEHRNKNDSPAPNSHHSYRVSPHASTAITENKRHSTGHELSTRS 1020
            LDLNFQEVNLSSPTLTQEHRNKNDSPAPNSHHSYRVSPHASTAITENKRHSTGHELSTRS
Sbjct: 961  LDLNFQEVNLSSPTLTQEHRNKNDSPAPNSHHSYRVSPHASTAITENKRHSTGHELSTRS 1020

Query: 1021 NGKHETHRTGSKQRHDLERYRHXXXXXXXXXXXXXXXXXXEMRKSFARARQSLDLERVRR 1080
            NGKHETHRTGSKQRHDLERYRH                  EMRKSFARARQSLDLERVRR
Sbjct: 1021 NGKHETHRTGSKQRHDLERYRHSKDKDSNSSITISTSTPSEMRKSFARARQSLDLERVRR 1080

Query: 1081 EAM 1083
            EAM
Sbjct: 1081 EAM 1083

>Scas_661.27
          Length = 1095

 Score =  644 bits (1660), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/504 (63%), Positives = 372/504 (73%), Gaps = 15/504 (2%)

Query: 1   MSITNGTSRSVSAMGHPAVERYTPGHIVCVGTHKVEVVNYLAEGGFAQIYVVKFLEYLNE 60
           MS T+G     +    P  ERYTPG  V VG HKVE++ Y+AEGGFAQIY VKF+E+LNE
Sbjct: 1   MSTTSGPVSVNNTTVKPNNERYTPGTQVAVGAHKVEIIKYIAEGGFAQIYAVKFIEFLNE 60

Query: 61  FDNTASVP-LKIGDVACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRR 119
           F+N    P L++GDVACLKRVLVQDENGLNEMRNEVEVMK+L+GAPNIVQY+DSNASRR 
Sbjct: 61  FENNRMKPKLQMGDVACLKRVLVQDENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRH 120

Query: 120 DGVQGFEVLLLMELCPNKSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIH 179
           +G  GFEVLLLMELCPNKSLLDYMNQRL+TKLTE EI+KIMYDV  ++SQMHYLP  L+H
Sbjct: 121 NGFPGFEVLLLMELCPNKSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLH 180

Query: 180 RDIKIENVLVDAKNNFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDL 239
           RDIKIENVLVDA+NNFKL DFGSTST FP+VTTHQDIA+LTQNIYVHTTPQYRSPEMIDL
Sbjct: 181 RDIKIENVLVDAQNNFKLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDL 240

Query: 240 YRCLPINEKSDIWALGVFLYKLLFFTTPFEMTGQFAILHSKYEFPVNKYSSKLINLIIIM 299
           YRCLPI+EKSDIWALG+FLYKLLFFTTPFE+TGQFAILHSKYEFP N YSSKLINLIIIM
Sbjct: 241 YRCLPIDEKSDIWALGIFLYKLLFFTTPFELTGQFAILHSKYEFPKNNYSSKLINLIIIM 300

Query: 300 LAENPNLRPNIYQVLYHLCEILNVEVPIEDKYAEGAYNFSKYTQFQNKXXXXXXXXXXXX 359
           LAENPNLRPNIYQVL+++C I  ++VPIED+YAEG Y+F KYT FQNK            
Sbjct: 301 LAENPNLRPNIYQVLHNICSISGMKVPIEDQYAEGPYDFEKYTHFQNKVQSVQYQLYLLQ 360

Query: 360 XKKIMQNNKLSDSEENLLNDMFLSSFEISSKLPMNAS-----DGHAAVSRIPSQNVGQEL 414
            KK   N KL  ++ NLLND+F++SF+I+SK+P          G++A   IP  N  ++ 
Sbjct: 361 EKKFKTNGKLPQADINLLNDLFVTSFDIASKVPFELKVPTPLPGYSA--EIPESNFAKQE 418

Query: 415 EEEKESQSDQRKSTLSEDKXXXXXXXXXXXXXXXXPQEINTIQSPG-IEDKSIFENKTPG 473
           ++ +          L+E++                      I +P   E K     K+PG
Sbjct: 419 QQYEPRNIPTAGDYLNENRKSFTSNDALSRHTSNTADTSRDIATPSNFEKKENVNEKSPG 478

Query: 474 ------ELYYPSVSELDTYLDKEL 491
                 E Y+P+V ELD YLD EL
Sbjct: 479 KPIENTEQYFPTVGELDYYLDNEL 502

 Score = 80.9 bits (198), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 84/324 (25%), Positives = 133/324 (41%), Gaps = 61/324 (18%)

Query: 786  PMHSSSKNEALLIELSPLKEDAGKQSFQDTNEPQTGGIEDAGGSGTIKGSNNNRNGVLNL 845
            P  S  K E LLI+LSP ++  G++  + T+  +           ++  +N  R   LNL
Sbjct: 793  PHPSKEKEEQLLIDLSPPRDLPGRKPRESTSPLRLEDDTSRMARRSLSLNNPKRQVTLNL 852

Query: 846  SLNEMDLSRDDTGXXXXXXXXXXXXXXIQQAKLSGRKGSSKRNNYSTDELGDSMVSSESI 905
            S    D+S  +                                ++ST  +  S+ S+ESI
Sbjct: 853  S----DMSNAEV-----------------------------MESFSTGGVESSVASTESI 879

Query: 906  DIDLDDARRGKTAER----RPLHNERGHKDQARSSDASKSNQFKSKDFSSVSTRQPRQSL 961
            ++DL+D +  K  +       +   R  +++    +  K    K KD + +     R+SL
Sbjct: 880  NLDLEDMKHKKGGQEDDNLAEMVARRSIEERETPLNVPKRENLKQKDENRLENITGRRSL 939

Query: 962  DLNFQEVNLSSPTLTQEHRNKNDSPAPNSHHSYRVSPHASTAITENKRHSTGHELSTRSN 1021
            DL +QE+N S P L ++  N + S     HH   +    S    +++   T +E   R  
Sbjct: 940  DLRYQEINFS-PDLRKDKSNSSTS----VHHISSIREDESVNEDDSELTLTENEKRQRQQ 994

Query: 1022 GKHETH-------------------RTGSKQRHDLERYRHXXXXXXXXXXXXXXXXXXEM 1062
             +H  H                   R   + + DLE Y+H                  EM
Sbjct: 995  PRHHQHTHFDSSSNLNSKGANRSSSRGNIRGKQDLESYKHSTKNNSNSSIPISTTNTNEM 1054

Query: 1063 RKSFARARQSLDLERVRREAMASS 1086
            +KSFA+ARQSLDLERVRREA+ +S
Sbjct: 1055 KKSFAKARQSLDLERVRREALLNS 1078

 Score = 37.7 bits (86), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 16/21 (76%), Positives = 17/21 (80%)

Query: 557 KQHKSNNPFPKMNVAYHSTNE 577
           KQHKSNNPFPKM  A+ S NE
Sbjct: 609 KQHKSNNPFPKMTHAFQSANE 629

>CAGL0H10208g complement(996853..999936) similar to sp|P38080
           Saccharomyces cerevisiae YBR059c AKL1 Ark-family
           Kinase-Like protein, hypothetical start
          Length = 1027

 Score =  593 bits (1528), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/603 (51%), Positives = 394/603 (65%), Gaps = 39/603 (6%)

Query: 8   SRSVSAMGHPAVERYTPGHIVCVGTHKVEVVNYLAEGGFAQIYVVKFLEYLNEFDNTAS- 66
           SRS++++  P  E+Y  G ++ VG H+VE+V+YLAEGGFAQIYVVKF+EYLNEF++  S 
Sbjct: 6   SRSMTSLNSPNEEKYPNGQMISVGAHRVEIVSYLAEGGFAQIYVVKFVEYLNEFESLGSK 65

Query: 67  VPLKIGDVACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFE 126
             + +GD+ACLKRV+V DE GLNEMRNEVEVMKKLK +PNIVQYFDSNASRR DG  GFE
Sbjct: 66  SAITVGDIACLKRVIVNDEMGLNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFE 125

Query: 127 VLLLMELCPNKSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIEN 186
           VLLLMELCPNKSLLDYMNQRL TKL+E+EI+KIMYDV++ IS MHYL   LIHRDIKIEN
Sbjct: 126 VLLLMELCPNKSLLDYMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIEN 185

Query: 187 VLVDAKNNFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPIN 246
           VLVDA NNFKL D GSTS C P + ++QDIA++TQNIYVHTTPQYR+PEMIDLYR LPIN
Sbjct: 186 VLVDANNNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPIN 245

Query: 247 EKSDIWALGVFLYKLLFFTTPFEMTGQFAILHSKYEFPVNKYSSKLINLIIIMLAENPNL 306
           EKSDIWALG+FLYKLLF+TTPFE+TGQ AILHSKY+FP NKYSSK+INLIIIMLAENPNL
Sbjct: 246 EKSDIWALGIFLYKLLFYTTPFEITGQMAILHSKYDFPPNKYSSKIINLIIIMLAENPNL 305

Query: 307 RPNIYQVLYHLCEILNVEVPIEDKYAEGAYNFSKYTQFQNKXXXXXXXXXXXXXKKIMQN 366
           RPNI+QV+YH+C I+N+ VPIED+Y  G YNF  YT+FQ+K             K +   
Sbjct: 306 RPNIFQVVYHICSIMNLPVPIEDRYGLGPYNFDLYTKFQSKVQTIQNQINYLQNKVVSSK 365

Query: 367 NKLSDSEENLLNDMFLSSFEISSKLP--------------MNA---SDGHAAVSRIPSQN 409
           +KLS  +  +L+++++ +FE+  K+P              +N+    D H  V+     N
Sbjct: 366 SKLSKEDGLVLDELYIKTFEMIPKIPNPRLSEKQPTLEIGLNSPSIQDQHLDVN-----N 420

Query: 410 VGQELEEEKESQSDQRKSTLSEDKXXXXXXXXXXXXXXXXPQEINTIQSPGIEDKSIFEN 469
             + + E   S+  Q    +S+                   +E +    P   D+S    
Sbjct: 421 KRRSMHESINSR--QASDNISQKSVRTSSNTIEKTFSQTSNKEFSKETDPESHDES---- 474

Query: 470 KTPGELYYPSVSELDTYLDKELVKQSS------DPTISEQSPRLNTQSLPXXXXXXXXXX 523
              GE Y+PSV+EL+TYLDKE  +Q +      +  I+     +N+ +            
Sbjct: 475 ---GEPYFPSVNELNTYLDKEFKQQKAQDNVVKNQIINNSGGNMNSSNPERQKSISSFSS 531

Query: 524 XXXXXXXXXXXGAATIGSDEALANEKTAGINKMKQHKSNNPFPKM-NVAYHSTNELSNDA 582
                       +A     +A    K  G  K + HKSNNPFP M      ST  L+N  
Sbjct: 532 SGKSMKSSSHVPSAGFVGADATEGPKMVGYLKSQNHKSNNPFPFMAGDRQRSTESLNNKH 591

Query: 583 SNF 585
           +N+
Sbjct: 592 NNY 594

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 82/318 (25%), Positives = 131/318 (41%), Gaps = 84/318 (26%)

Query: 792  KNEALLIELSPLKEDAGKQSFQDTNEPQTGGIEDAGGSGTIKGSNNNRNGVLNLSLNEMD 851
            +NE LLI++SP ++       + T+ PQ            +     +   VL+L LNEMD
Sbjct: 758  QNEQLLIDISPPRD------IKRTSSPQK----------ELSNVKTHAPQVLDLQLNEMD 801

Query: 852  LSRDDTGXXXXXXXXXXXXXXIQQAKLSGRKGSSKRNNYSTDELGDSMVSSESIDIDLDD 911
            +S                              +S  ++ + +++  S++SSES+D+D+ +
Sbjct: 802  ISE-----------------------------ASIADSSNGNDVDSSLLSSESVDLDVTN 832

Query: 912  ARRGKTAERRPLHNERGHKDQARSSDASKSNQFKSKDFSSVSTRQPRQSLDLNFQEVNLS 971
                    R  +H   G++ Q +   A K  Q K KD +    +  R+SLDL+ QEV+ +
Sbjct: 833  --------RLKMHYPFGNQRQTKL--AQKPIQSKVKD-TDKQQKNGRRSLDLSVQEVHFN 881

Query: 972  SP-------------------TLTQEHRNKNDSPAPNSHHSYRVSPHASTAITENKRHST 1012
            S                    ++++E         P S+   R       + + N R S 
Sbjct: 882  SEAGKNNLLHNKNTHRPGIKGSMSEESVEDTIKSLPPSNTLPRSQSSKVISQSTNARTSL 941

Query: 1013 GHELSTRSNGKH-ETHRTGSKQR-HDLERYRHXXXXXXXXXXXXXXXXXXEMRKSFARAR 1070
                  R   +H E   + S+ R H LE Y                    EM++SFA+AR
Sbjct: 942  D-----RQRQRHIEPRDSKSRSRSHGLEEY--TSSNGSNSSINISTSNKFEMKRSFAKAR 994

Query: 1071 QSLDLERVRREAMASSAS 1088
            QSLDLER RR+AM+ S S
Sbjct: 995  QSLDLERARRDAMSRSNS 1012

>Sklu_1752.2 YBR059C, Contig c1752 577-3153 reverse complement
          Length = 858

 Score =  585 bits (1508), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/565 (53%), Positives = 375/565 (66%), Gaps = 61/565 (10%)

Query: 7   TSRSVSAMGHPAVERYTPGHIVCVGTHKVEVVNYLAEGGFAQIYVVKFLEYLNEFDNTAS 66
           T+RS S+   P +E+  PG ++ VG+HKVE+V YLAEGGFA IYVVKF+E+ NE + T S
Sbjct: 17  TTRSASSSASPTLEKLAPGTLIIVGSHKVEIVKYLAEGGFAHIYVVKFVEFSNELE-TPS 75

Query: 67  VPLKIGDVACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFE 126
             LK GD+ACLKRVLV DENGLNE+RNEVEVMK+LK + NIVQY+DSNASRRRDG  G+E
Sbjct: 76  SSLKEGDLACLKRVLVTDENGLNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYE 135

Query: 127 VLLLMELCPNKSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIEN 186
           VLLLMELCPNKSLLDYMNQRL+TKL+E E++KIMYDV  +++QMH+LP  LIHRDIKIEN
Sbjct: 136 VLLLMELCPNKSLLDYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIEN 195

Query: 187 VLVDAKNNFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPIN 246
           VLVD++NNFKL DFGSTS+CFPI+TTHQDIALLT NIYVHTTPQYR+PEMIDLYRCLPI+
Sbjct: 196 VLVDSENNFKLCDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPID 255

Query: 247 EKSDIWALGVFLYKLLFFTTPFEMTGQFAILHSKYEFPVNKYSSKLINLIIIMLAENPNL 306
           EKSDIWALG+FLYKLLF+TTPFE+TGQFAILHSKY+ P N YSSKLINLIIIMLAENPNL
Sbjct: 256 EKSDIWALGIFLYKLLFYTTPFELTGQFAILHSKYDIPANNYSSKLINLIIIMLAENPNL 315

Query: 307 RPNIYQVLYHLCEILNVEVPIEDKYAEGAYNFSKYTQFQNKXXXXXXXXXXXXXKKIMQN 366
           RPNIYQV+Y +C I+ V+VP EDKY  G Y+F KY+++Q K             +K    
Sbjct: 316 RPNIYQVIYQVCAIMKVDVPFEDKYQTGPYDFDKYSKYQEKLQAFQYQLYISYHQK---- 371

Query: 367 NKLSDSEENLLNDMFLSSFEISSKLPMNASDGHAAVSRIPSQNVGQELEEEKESQSDQRK 426
                 + + LND+F++ FEI+ K PM+   G   ++  P      E  E+ ++Q D RK
Sbjct: 372 -----QDVDTLNDLFINCFEIAPKQPMDM--GKRDLAEKP------ENLEKIQNQQDSRK 418

Query: 427 STLSEDKXXXXXXXXXXXXXXXXPQEINTIQSPGIEDKSIFENKTPGELYYPSVSELDTY 486
                D+                 ++I  +Q                  ++PSV +L+ Y
Sbjct: 419 QIPIRDE-----------------EDIKMVQQ-----------------HFPSVEDLEIY 444

Query: 487 LDKELVKQSSDPTISEQSPRLNTQSLPXXXXXXXXXXXXXXXXXXXXXGAAT---IGSDE 543
           L  E            +S RL++ ++P                        +   +    
Sbjct: 445 LHSEATH------FENKSDRLSSLAVPNRSKSLGSSSHASSVTDLSNGSGNSPEEVSPGV 498

Query: 544 ALANEKTAGINKMKQHKSNNPFPKM 568
             +N        +KQHKSNNPFPKM
Sbjct: 499 MSSNPTAKSTASIKQHKSNNPFPKM 523

 Score = 37.7 bits (86), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 17/29 (58%), Positives = 23/29 (79%)

Query: 1061 EMRKSFARARQSLDLERVRREAMASSASS 1089
            EMRKS +RAR+SLDLE V+RE+   S ++
Sbjct: 818  EMRKSLSRARKSLDLEGVKRESAGGSDTT 846

>Kwal_27.10945
          Length = 935

 Score =  572 bits (1475), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 263/385 (68%), Positives = 309/385 (80%), Gaps = 9/385 (2%)

Query: 17  PAVERYTPGHIVCVGTHKVEVVNYLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGDVAC 76
           P +E+   G  V VG H+VE+V YLAEGGFA IYVV+F+EY NE +   ++ L++GD+AC
Sbjct: 66  PVLEQLKTGSQVIVGNHRVEIVKYLAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLAC 125

Query: 77  LKRVLVQDENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPN 136
           LKRVLV DENGLNEMRNEV VMK+L G PNIVQY+DS+ASR RDG  GFEV LLMELCPN
Sbjct: 126 LKRVLVTDENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPN 185

Query: 137 KSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFK 196
            SLLDYMNQRL+TKL+E EI+KIM+DV  +++QMHYLPV LIHRD+KIENVLVDA +NFK
Sbjct: 186 NSLLDYMNQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFK 245

Query: 197 LADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGV 256
           L DFGSTSTCFP+  THQ+IA+LT NIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALG+
Sbjct: 246 LCDFGSTSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGI 305

Query: 257 FLYKLLFFTTPFEMTGQFAILHSKYEFPVNKYSSKLINLIIIMLAENPNLRPNIYQVLYH 316
           FLYKLLF+TTPFE+TGQFAILHSKYEFPVN YSSKLINLIIIMLAENPNLRPNIYQV+ +
Sbjct: 306 FLYKLLFYTTPFELTGQFAILHSKYEFPVNNYSSKLINLIIIMLAENPNLRPNIYQVMDN 365

Query: 317 LCEILNVEVPIEDKYAEGAYNFSKYTQFQNKXXXXXXXXXXXXXKKIMQNNKLSDSEENL 376
           LC IL V+ P+EDKY  G+Y+F KY+Q+Q K              K          + + 
Sbjct: 366 LCSILKVKNPLEDKYQLGSYSFEKYSQYQAKLQKVQYQMYLAYENK---------QQIDT 416

Query: 377 LNDMFLSSFEISSKLPMNASDGHAA 401
           LNDMF++ FE++ K P++ SD   A
Sbjct: 417 LNDMFINCFEVAPKQPVDISDKKWA 441

 Score = 34.3 bits (77), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 14/22 (63%), Positives = 19/22 (86%)

Query: 1061 EMRKSFARARQSLDLERVRREA 1082
            E +KSF+RAR+SLDLER +R+ 
Sbjct: 894  EPKKSFSRARKSLDLERTKRDT 915

>CAGL0K11990g complement(1155395..1158370) some similarities with
           sp|P38080 Saccharomyces cerevisiae YBR059c AKL1
           Ark-family Kinase-Like protein, hypothetical start
          Length = 991

 Score =  563 bits (1450), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/397 (67%), Positives = 317/397 (79%), Gaps = 12/397 (3%)

Query: 9   RSVSAMGHPAVE-RYTPGHIVCVGTHKVEVVNYLAEGGFAQIYVVKFLEYLNEF----DN 63
           +S+  +  P +E ++  G +V VG+H+VEVV+YLAEGGFAQIYVVKF+EY NEF    D 
Sbjct: 82  QSIPPVAQPQIEEKFPAGKVVTVGSHRVEVVSYLAEGGFAQIYVVKFVEYTNEFERKNDE 141

Query: 64  TASVPLKIGDVACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDG-- 121
           + + PLK G  ACLKRVLVQDE GLN+MR+EVEVMKKL+GAPNIVQYFDSNASR RD   
Sbjct: 142 SMNQPLKPGSPACLKRVLVQDEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSG 201

Query: 122 --VQGFEVLLLMELCPNKSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIH 179
              QGFEVLLLMELCPNKSLLDYMNQRL+TKLTE EI KIMYD+ L+++QMHYLPV LIH
Sbjct: 202 NITQGFEVLLLMELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIH 261

Query: 180 RDIKIENVLVDAKNNFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDL 239
           RDIKIENVLVDA NNFKL DFGSTSTCFP  T+ QDIA+L+Q++Y+HTTPQYRSPEMIDL
Sbjct: 262 RDIKIENVLVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDL 321

Query: 240 YRCLPINEKSDIWALGVFLYKLLFFTTPFEMTGQFAILHSKYEFPVNKYSSKLINLIIIM 299
           ++ +PINEKSDIWALGVFLYKLLFFTTPFE TGQFA+LHSK+EFP N YSSKLINLII+M
Sbjct: 322 FKYIPINEKSDIWALGVFLYKLLFFTTPFERTGQFAMLHSKFEFPPNSYSSKLINLIIVM 381

Query: 300 LAENPNLRPNIYQVLYHLCEILNVEVP---IEDKYAEGAYNFSKYTQFQNKXXXXXXXXX 356
           LAENP+LRPNIYQVLY+L E+ N EVP   + DKY +G YNF KYT+FQ +         
Sbjct: 382 LAENPSLRPNIYQVLYYLSEVTNREVPPTVLSDKYGQGPYNFEKYTRFQKESQQVQLQLS 441

Query: 357 XXXXKKIMQNNKLSDSEENLLNDMFLSSFEISSKLPM 393
               K    N+ +  ++  L + M++S+F I  +LP+
Sbjct: 442 TLQAKINDPNSTMQPADWELYDRMYMSAFTIVPQLPV 478

>KLLA0F18612g 1711131..1713575 some similarities with sp|P38080
           Saccharomyces cerevisiae YBR059c AKL1 Ark-family
           Kinase-Like protein, hypothetical start
          Length = 814

 Score =  551 bits (1421), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/390 (66%), Positives = 309/390 (79%), Gaps = 7/390 (1%)

Query: 10  SVSAMGHPAVERYTPGHIVCVGTHKVEVVNYLAEGGFAQIYVVKFLEYLNEFD-NTASVP 68
           + SAM  P     +P   V VGTH+ E++ +LAEGGFA IY VKFLE  NE D    S  
Sbjct: 18  ATSAMI-PNSHLLSPNTQVVVGTHRCEILEHLAEGGFANIYKVKFLELTNEMDAGIDSKL 76

Query: 69  LKIGDVACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVL 128
           LK GD+ACLKRV+V DENGLNE+RNEVE MK+L+G+PNIVQY+DSNASR  DG  GFE+L
Sbjct: 77  LKAGDIACLKRVIVPDENGLNELRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEIL 136

Query: 129 LLMELCPNKSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVL 188
           LLMELCP KSLLDYMN +L+TKLTEAEI+KIMYDV+ +I+QMHYLP  LIHRDIKIENVL
Sbjct: 137 LLMELCPKKSLLDYMNNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVL 196

Query: 189 VDAKNNFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEK 248
           VD  +NFKL DFGSTS CFPIV+THQDIA+LT NIYVHTTPQYRSPEMIDLYRCLPINEK
Sbjct: 197 VDKDDNFKLCDFGSTSMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEK 256

Query: 249 SDIWALGVFLYKLLFFTTPFEMTGQFAILHSKYEFPVNKYSSKLINLIIIMLAENPNLRP 308
           SDIWALG+FLYKLLF+TTPFE+TGQFAILHSKYE P N YSSKLINLIIIMLAENP+LRP
Sbjct: 257 SDIWALGIFLYKLLFYTTPFELTGQFAILHSKYEIPQNGYSSKLINLIIIMLAENPSLRP 316

Query: 309 NIYQVLYHLCEILNVEVPIEDKYAEGAYNFSKYTQFQNKXXXXXXXXXXXXXKKIMQNNK 368
           NIYQV++H+C IL  +VP  DKY  G Y+F+KY+Q+  K              ++ +N K
Sbjct: 317 NIYQVMHHVCSILKCDVPFTDKYELGPYDFAKYSQYHLKLQQIQYQMF-----ELYKNEK 371

Query: 369 LSDSEENLLNDMFLSSFEISSKLPMNASDG 398
           ++  + + LND+F+ +FEI+ K P++   G
Sbjct: 372 VTSGDVDKLNDLFIQNFEIAPKQPIDKGIG 401

 Score = 35.0 bits (79), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 29/92 (31%), Positives = 47/92 (51%), Gaps = 15/92 (16%)

Query: 891 STDELGDSMVSSESIDIDLDDARRGKTAERRPLHNERGHKDQARSSDASKSNQFKSKDFS 950
           S  EL +S++S ESI +DL          ++P   E   + +  +S  S+S     K+F 
Sbjct: 692 SDTELEESIISDESISLDL----------KQPKLKEPVTQPRQTTSPGSES-----KEFL 736

Query: 951 SVSTRQPRQSLDLNFQEVNLSSPTLTQEHRNK 982
             +    R+SLDL +QE+NLS+    +  +NK
Sbjct: 737 KPAKVPKRRSLDLKYQEINLSNDDQRKHRKNK 768

>AGR027C [4337] [Homologous to ScYBR059C (AKL1) - SH]
           (763309..766194) [2886 bp, 961 aa]
          Length = 961

 Score =  519 bits (1336), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 248/407 (60%), Positives = 295/407 (72%), Gaps = 16/407 (3%)

Query: 19  VERYTPGHIVCVGTHKVEVVNYLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGDVACLK 78
           +E    G  V VG H+VEV+ YLAEGGFA IY V F+ Y NE D    + L+ GD  CLK
Sbjct: 26  LEMLQAGSTVLVGVHQVEVIEYLAEGGFAHIYKVSFVGYTNELDRQDRI-LQPGDTVCLK 84

Query: 79  RVLVQDENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKS 138
           RV V DENGLNE+RNEVEVMKKL+   NIVQY+DSNASR  DG  G+EVLLLMELCPN S
Sbjct: 85  RVRVSDENGLNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGS 144

Query: 139 LLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLA 198
           LLDYMNQRL+TKL+EAE++KIMYD+ + +S MHY    LIHRDIKIENVLVDA NNFKL 
Sbjct: 145 LLDYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLC 204

Query: 199 DFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGVFL 258
           DFGSTS C P V +HQ+IA+L  NIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALG+FL
Sbjct: 205 DFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFL 264

Query: 259 YKLLFFTTPFEMTGQFAILHSKYEFPVNKYSSKLINLIIIMLAENPNLRPNIYQVLYHLC 318
           YKLLF+TTPFE+TGQFAILHSKYE P N +SSKLINL+IIMLAENP LRPN+YQV+YH+C
Sbjct: 265 YKLLFYTTPFELTGQFAILHSKYEIPRNSFSSKLINLVIIMLAENPYLRPNVYQVMYHIC 324

Query: 319 EILNVEVPIEDKYAEGAYNFSKYTQFQNKXXXXX---XXXXXXXXKKIMQNNKLSDSEEN 375
            ++  EV I+D Y +G YNF  Y ++Q K                + I+  +K       
Sbjct: 325 SMMECEVKIDDLYGQGPYNFDMYGRYQEKLQRLQYDMLMSHQLAQRGIINTDK------- 377

Query: 376 LLNDMFLSSFEISSKLPMNASDGHAAVSRI----PSQNVGQELEEEK 418
            +ND+F+S+FE + K PM       A  +I    PS N    ++ ++
Sbjct: 378 -VNDLFISTFECAPKQPMVMGQNAVAQQQIFVAPPSTNTSMPVDMQQ 423

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 45/80 (56%), Gaps = 9/80 (11%)

Query: 896 GDSMVSSESIDIDLDDARRGKTAERRPLHNERGHKDQARSSDASK--SNQFKSK-DFSSV 952
           G S++++ESI ++L +A      E RP+        Q   +  S+  S+ +  + D   V
Sbjct: 809 GSSVLTNESIAMELPNA------EERPVPPSTSGATQPAENIHSRQESDSYHDREDSRHV 862

Query: 953 STRQPRQSLDLNFQEVNLSS 972
           +   PR+SL+L+FQE++LSS
Sbjct: 863 TGHVPRRSLELDFQEIDLSS 882

 Score = 30.8 bits (68), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 13/24 (54%), Positives = 17/24 (70%)

Query: 545 LANEKTAGINKMKQHKSNNPFPKM 568
           + +E+ A   K KQ+K NNPFPKM
Sbjct: 509 VQHEQLANTPKSKQYKKNNPFPKM 532

>Kwal_27.11542
          Length = 791

 Score =  314 bits (805), Expect = 8e-93,   Method: Compositional matrix adjust.
 Identities = 157/319 (49%), Positives = 203/319 (63%), Gaps = 10/319 (3%)

Query: 14  MGHPAVERYTPGHIVCVGTHKVEVVNYLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGD 73
           M  P+   YT G  + VG+H+  ++ YL  GGFA IY  +          + + P  IG+
Sbjct: 1   MNQPSSGIYTQGTALTVGSHQARIIKYLTSGGFAHIYSAEI---------SPADPNSIGN 51

Query: 74  VACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMEL 133
           VACLKRVLV D+  LN +R EV+ MK L+G  ++V Y DS+A++       +EV LLME 
Sbjct: 52  VACLKRVLVPDKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEY 111

Query: 134 CPNKSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKN 193
           C    L+D+MN RL  +LTE E++KIM D+   I+ MH L   LIHRDIKIENVL+    
Sbjct: 112 CSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDK 171

Query: 194 NFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253
            FK+ DFGS           Q+ + +  +I  +TT QYRSPEMIDLYR  PINEKSDIWA
Sbjct: 172 TFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDIWA 231

Query: 254 LGVFLYKLLFFTTPFEMTGQFAILHSKYEFPV-NKYSSKLINLIIIMLAENPNLRPNIYQ 312
           LGVFLYKL ++TTPFE  G  AILHS+++FP   +YS +L NLI +ML+ENPN RPNI Q
Sbjct: 232 LGVFLYKLCYYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQ 291

Query: 313 VLYHLCEILNVEVPIEDKY 331
           VL  +  I NV  P+ + Y
Sbjct: 292 VLEEVSRIQNVPCPLRNFY 310

>Scas_601.6
          Length = 661

 Score =  305 bits (780), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 154/319 (48%), Positives = 207/319 (64%), Gaps = 10/319 (3%)

Query: 14  MGHPAVERYTPGHIVCVGTHKVEVVNYLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGD 73
           M  P +  Y PG ++ VG+HKV+VV YL  GGFAQIY V+ +   ++F NT        +
Sbjct: 1   MNQPQIPLYQPGTLLTVGSHKVQVVKYLTSGGFAQIYTVQ-ISPPDKFTNT--------N 51

Query: 74  VACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMEL 133
           VACLKRV+V D+  LN +R EV+ MK L+   ++V Y DS+A++       +EV LLME 
Sbjct: 52  VACLKRVIVPDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEY 111

Query: 134 CPNKSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKN 193
           C    L+D+MN RL  +L E EI+ IM  V   I+ MH L   L+HRDIKIENVL+ +K 
Sbjct: 112 CDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKG 171

Query: 194 NFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253
            +K+ DFGS        +  Q+++ +  +I  +TT QYR+PEMIDLYR LPI+EKSDIWA
Sbjct: 172 EYKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWA 231

Query: 254 LGVFLYKLLFFTTPFEMTGQFAILHSKYEFP-VNKYSSKLINLIIIMLAENPNLRPNIYQ 312
           LGVFLYKL ++TTPFE  G+ AILH+ ++FP   +YS +L  LI  ML E P+ RPN YQ
Sbjct: 232 LGVFLYKLCYYTTPFEKNGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQ 291

Query: 313 VLYHLCEILNVEVPIEDKY 331
           VL  +  + NV+ PI + Y
Sbjct: 292 VLEEVSSMQNVQCPIPNFY 310

>Scas_671.16
          Length = 723

 Score =  305 bits (781), Expect = 4e-90,   Method: Compositional matrix adjust.
 Identities = 152/325 (46%), Positives = 206/325 (63%), Gaps = 10/325 (3%)

Query: 14  MGHPAVERYTPGHIVCVGTHKVEVVNYLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGD 73
           M  P +  Y PG ++ VG+H  +++ YL  GGFAQIY  + +  +N ++N+ +       
Sbjct: 1   MNQPNIPTYPPGTLLTVGSHYCKIIKYLTSGGFAQIYTTE-ISPINPYNNSQT------- 52

Query: 74  VACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMEL 133
            ACLKRV+V D+ GLN +R EV+ MK LK   ++V Y DS+A+R       +EV LLME 
Sbjct: 53  -ACLKRVIVPDKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEY 111

Query: 134 CPNKSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKN 193
           C    L+D+MN RL  +LTE EI+ I+      +S MH L  +LIHRDIKIENVL+ AK 
Sbjct: 112 CKGGGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKG 171

Query: 194 NFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253
            FK+ DFGS  +        Q++A +  ++  +TT QYR+PEM+DLYR LPINEKSDIWA
Sbjct: 172 EFKICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWA 231

Query: 254 LGVFLYKLLFFTTPFEMTGQFAILHSKYEFPVNK-YSSKLINLIIIMLAENPNLRPNIYQ 312
           LGVFLYKL ++TTPFE  G+ AILHS+Y++P    Y+ KL NLI   L E+P+ RPNI Q
Sbjct: 232 LGVFLYKLCYYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQ 291

Query: 313 VLYHLCEILNVEVPIEDKYAEGAYN 337
           +L  +  I  +  PI + Y     N
Sbjct: 292 LLEEISRIQGIPCPINNFYLSRTIN 316

>ADL217W [1524] [Homologous to ScYIL095W (PRK1) - SH; ScYNL020C
           (ARK1) - SH] complement(321493..323745) [2253 bp, 750
           aa]
          Length = 750

 Score =  302 bits (773), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 154/313 (49%), Positives = 205/313 (65%), Gaps = 15/313 (4%)

Query: 24  PGHIVCVGTHKVEVVNYLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGDVACLKRVLVQ 83
           PG I+ VG+H+V+++ YL  GGFAQIY  + L         +  P++ G +ACLKRV V 
Sbjct: 11  PGIILTVGSHEVKIIQYLTSGGFAQIYSCEVL---------SPGPIQ-GSLACLKRVHVP 60

Query: 84  DENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASR--RRDGVQGFEVLLLMELCPNKSLLD 141
           D+  LN +R EV+ MK LKG  ++V Y DS+A++  R DG   +EV LLME C    L+D
Sbjct: 61  DKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGT--YEVYLLMEYCLRGGLID 118

Query: 142 YMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFG 201
           +MN RL T+L+E E++KIM  VA  I  MH L   LIHRDIKIENVL+    +FK+ DFG
Sbjct: 119 FMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFG 178

Query: 202 STSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGVFLYKL 261
           S S          +   +  +I  +TT QYR+PEMIDLYR LP++EKSDIWALGVFLYK+
Sbjct: 179 SVSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKV 238

Query: 262 LFFTTPFEMTGQFAILHSKYEFP-VNKYSSKLINLIIIMLAENPNLRPNIYQVLYHLCEI 320
            +FTTPFE  G+ AIL +K++FP   +Y+ +L NLI +ML+E+P  RPNI QVL  +  I
Sbjct: 239 CYFTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEVSRI 298

Query: 321 LNVEVPIEDKYAE 333
             V  P+ + Y E
Sbjct: 299 QGVPCPLPNFYLE 311

>Sklu_2226.7 YIL095W, Contig c2226 8986-11373
          Length = 795

 Score =  300 bits (769), Expect = 8e-88,   Method: Compositional matrix adjust.
 Identities = 152/321 (47%), Positives = 201/321 (62%), Gaps = 11/321 (3%)

Query: 14  MGHPAVERYTPGHIVCVGTHKVEVVNYLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGD 73
           M  P +E Y  G ++ VG+HK  ++ YL  GGFA IY  +    ++  D  +S       
Sbjct: 1   MSQPPLETYPSGTVLTVGSHKARIIKYLTSGGFAHIYSAE----ISPPDPNSS------S 50

Query: 74  VACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMEL 133
           +ACLKRVLV D+  LN +R EV+ MK LK    +V Y DS+A++       +EV LLME 
Sbjct: 51  IACLKRVLVPDKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEY 110

Query: 134 CPNKSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKN 193
           C    L+D+MN RL  +L E E++KIM  V+  ++ MH L   LIHRDIKIENVL+    
Sbjct: 111 CARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDG 170

Query: 194 NFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253
           NFK+ DFGS           Q++  +  +I  +TT QYRSPEMIDLYR LP++EKSDIWA
Sbjct: 171 NFKVCDFGSVCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIWA 230

Query: 254 LGVFLYKLLFFTTPFEMTGQFAILHSKYEFPV-NKYSSKLINLIIIMLAENPNLRPNIYQ 312
           LGVFLYKL ++TTPFE  G+ AILHSK++FP   +YS +L NLI  +L ENP  RPNI Q
Sbjct: 231 LGVFLYKLCYYTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQ 290

Query: 313 VLYHLCEILNVEVPIEDKYAE 333
           +L  +  I  V  P+++ Y E
Sbjct: 291 LLAEVSRIQGVPCPVKNFYLE 311

>YIL095W (PRK1) [2580] chr9 (183934..186366) Serine/threonine
           protein kinase involved in regulation of actin
           cytoskeleton organization [2433 bp, 810 aa]
          Length = 810

 Score =  301 bits (770), Expect = 9e-88,   Method: Compositional matrix adjust.
 Identities = 150/332 (45%), Positives = 206/332 (62%), Gaps = 11/332 (3%)

Query: 14  MGHPAVERYTPGHIVCVGTHKVEVVNYLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGD 73
           M  P +  Y PG I+ VG+H  +++ YL  GGFAQ+Y  +          +   P    +
Sbjct: 1   MNTPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEI---------SPPDPYSNAN 51

Query: 74  VACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMEL 133
           +ACLKRV+V  + GLN +R EV+ MK L+   ++V Y DS+A+R  +G+  +EV +LME 
Sbjct: 52  IACLKRVIVPHKQGLNTLRAEVDAMKLLRNNKHVVSYIDSHAARSVNGI-AYEVFVLMEF 110

Query: 134 CPNKSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKN 193
           C    L+D+MN RL  +L E+EI++IM      I+ MH L   LIHRDIKIENVL+    
Sbjct: 111 CERGGLIDFMNTRLQNRLQESEILEIMSQTVQGITAMHALQPPLIHRDIKIENVLISHDG 170

Query: 194 NFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253
            +K+ DFGS S         Q+   +  +I  +TT QYRSPEMIDLYR LPI+EKSDIWA
Sbjct: 171 LYKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWA 230

Query: 254 LGVFLYKLLFFTTPFEMTGQFAILHSKYEFP-VNKYSSKLINLIIIMLAENPNLRPNIYQ 312
           LGVFLYK+ ++TTPFE +G+  ILH++Y++P   +YS +L NLI +ML E P+ RPNI Q
Sbjct: 231 LGVFLYKICYYTTPFEKSGEAGILHARYQYPSFPQYSDRLKNLIRLMLMEAPSQRPNICQ 290

Query: 313 VLYHLCEILNVEVPIEDKYAEGAYNFSKYTQF 344
           VL  +  + N   PI + Y   A N +  TQ 
Sbjct: 291 VLEEVSRLQNKPCPIRNFYLLRAMNQNANTQL 322

>KLLA0E08371g complement(756205..758538) similar to sp|P40494
           Saccharomyces cerevisiae YIL095w PRK1 serine/threonine
           protein kinase involved in regulation of actin
           cytoskeleton organization, start by similarity
          Length = 777

 Score =  297 bits (760), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 152/319 (47%), Positives = 202/319 (63%), Gaps = 10/319 (3%)

Query: 14  MGHPAVERYTPGHIVCVGTHKVEVVNYLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGD 73
           M  P +E+Y  G I+ VG+H+V+V+ YLA GGFA +Y V+          +   P+   +
Sbjct: 1   MNQPQIEKYASGTILPVGSHQVKVLKYLASGGFAHVYSVEI---------SPPDPVCPDN 51

Query: 74  VACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMEL 133
           VACLKRV+V D+  LN +R EV+ MK L+G   IV Y DS+A++    V  +EV LLME 
Sbjct: 52  VACLKRVVVPDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEY 111

Query: 134 CPNKSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKN 193
           C    L+D+MN RL  +L E EI+ IM  V+  ++ MH L   LIHRDIKIENVL+   +
Sbjct: 112 CSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNH 171

Query: 194 NFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253
            FKL DFGS S         ++   +  +I  +TT QYR PEMIDLYR LPI+EKSDIWA
Sbjct: 172 EFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWA 231

Query: 254 LGVFLYKLLFFTTPFEMTGQFAILHSKYEFPV-NKYSSKLINLIIIMLAENPNLRPNIYQ 312
           LGVFLYK  ++TTPFE  G+ AIL SK+EFP   +YS ++ NLI +ML  +P  RPNI Q
Sbjct: 232 LGVFLYKTCYYTTPFEKNGESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQ 291

Query: 313 VLYHLCEILNVEVPIEDKY 331
           V+  +  I  +  PI++ Y
Sbjct: 292 VVEEVSRIQGIPCPIKNFY 310

>CAGL0G02607g complement(240244..242310) similar to sp|P40494
           Saccharomyces cerevisiae YIL095w PRK1, start by
           similarity
          Length = 688

 Score =  285 bits (730), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 149/319 (46%), Positives = 199/319 (62%), Gaps = 10/319 (3%)

Query: 14  MGHPAVERYTPGHIVCVGTHKVEVVNYLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGD 73
           M  P ++R   G  + VGTH V+++ YL  GGFAQIY V+ L  +  F+ +        +
Sbjct: 1   MNQPELDRINVGTQLTVGTHSVKILKYLTSGGFAQIYAVEILS-MGLFNGS--------N 51

Query: 74  VACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMEL 133
           VACLKRV V D+  LN +R EV+ MK L    ++V Y DS+A+R       +EV LLME 
Sbjct: 52  VACLKRVKVPDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEY 111

Query: 134 CPNKSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKN 193
           C    L+D+MN RL  +LTE EI+ IM      I+ MH L   L+HRDIKIENVL+    
Sbjct: 112 CEGGGLIDFMNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGG 171

Query: 194 NFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253
            +K+ DFGS S         Q++  +  +I  +TT QYR PEM+DLYR LPI+EK+DIWA
Sbjct: 172 IYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIWA 231

Query: 254 LGVFLYKLLFFTTPFEMTGQFAILHSKYEFP-VNKYSSKLINLIIIMLAENPNLRPNIYQ 312
           LGVFLYKL ++TTPFE  G+ AILH++++FP    YS +L NLI  ML E+P+ RPN+ Q
Sbjct: 232 LGVFLYKLCYYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQ 291

Query: 313 VLYHLCEILNVEVPIEDKY 331
           VL  +  + NV  PI + Y
Sbjct: 292 VLEEVSRMQNVPCPIRNFY 310

>YNL020C (ARK1) [4567] chr14 complement(595621..597537)
           Serine/threonine protein kinase associated with cortical
           actin cytoskeleton [1917 bp, 638 aa]
          Length = 638

 Score =  284 bits (726), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 147/317 (46%), Positives = 196/317 (61%), Gaps = 10/317 (3%)

Query: 14  MGHPAVERYTPGHIVCVGTHKVEVVNYLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGD 73
           M  P +  Y  G  + VG+H+VE++ YL  GGFAQ+Y       +N  D     P     
Sbjct: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSA----LINPPD-----PHSNSS 51

Query: 74  VACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMEL 133
           VACLKRV+V D+  LN +R EV+ M+ LK    +V Y DS+A++       +EV +LME 
Sbjct: 52  VACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEY 111

Query: 134 CPNKSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKN 193
           C    L+D+MN RL  +L E EI++IM  V   ++ MH L   LIHRDIKIENVL+ A N
Sbjct: 112 CERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANN 171

Query: 194 NFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253
            +KL DFGS           Q+++ + Q+I  +TT QYRSPEMID +R LPI+EKSDIWA
Sbjct: 172 EYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWA 231

Query: 254 LGVFLYKLLFFTTPFEMTGQFAILHSKYEFPVN-KYSSKLINLIIIMLAENPNLRPNIYQ 312
           LG+FLYKL ++TTPFE  G  AIL  K+EFP+   YS +L  LI  +L ++P  RPN+YQ
Sbjct: 232 LGIFLYKLCYYTTPFEKGGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQ 291

Query: 313 VLYHLCEILNVEVPIED 329
           +L  +  + NV  PI D
Sbjct: 292 LLKRISIMQNVPCPIND 308

>CAGL0J03432g 327428..329296 similar to sp|P53974 Saccharomyces
           cerevisiae YNL020c ARK1 or sp|P40494 Saccharomyces
           cerevisiae YIL095w PRK1, start by similarity
          Length = 622

 Score =  278 bits (711), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 141/315 (44%), Positives = 200/315 (63%), Gaps = 10/315 (3%)

Query: 14  MGHPAVERYTPGHIVCVGTHKVEVVNYLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGD 73
           M  P + +Y PG  V VG+H V ++ YL  GG+AQIY  + +   ++F  T        +
Sbjct: 1   MNTPHIPKYEPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMP-ADQFLGT--------N 51

Query: 74  VACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMEL 133
           +A LKRV+V D++ LN +R EV+ MK+LK    IV Y DS+A++ +     +EV L+ME 
Sbjct: 52  MAVLKRVIVPDKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEY 111

Query: 134 CPNKSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKN 193
           C    L+D+MN RL  +LTE EI+ I   ++  ++ MH L   LIHRDIKIENVL+   +
Sbjct: 112 CSRGGLIDFMNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDH 171

Query: 194 NFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253
            +KL DFGS S       T +++A +  +I + TT QYR+PEM+DL +   +N+KSDIWA
Sbjct: 172 KYKLCDFGSVSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWA 231

Query: 254 LGVFLYKLLFFTTPFEMTGQFAILHSKYEF-PVNKYSSKLINLIIIMLAENPNLRPNIYQ 312
           LGVFLYKL ++TTPFE TG+  IL+   EF P   YS  +  LI+ MLA+NP  RPNI+Q
Sbjct: 232 LGVFLYKLCYYTTPFEQTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQ 291

Query: 313 VLYHLCEILNVEVPI 327
           ++  + ++LNV  PI
Sbjct: 292 IIQTVSKLLNVNCPI 306

>KLLA0C06138g 540409..542535 similar to sp|P32562 Saccharomyces
           cerevisiae YMR001c CDC5 involved in regulation of DNA
           replication, start by similarity
          Length = 708

 Score =  105 bits (261), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 84/284 (29%), Positives = 142/284 (50%), Gaps = 47/284 (16%)

Query: 39  NYLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGDVACLKRVLVQDENGLNEMRNEVEVM 98
           ++L EGGFA+ + +K        D+      K+     + ++ ++ E    ++ +E+++ 
Sbjct: 94  HFLGEGGFARCFQMK--------DDKG----KVFAAKTVAKLSIKSEKTRRKLLSEIQIH 141

Query: 99  KKLKGAPNIVQYFDSNASRRRDGVQGFE----VLLLMELCPNKSLLDYMNQRLSTKLTEA 154
           K +K  PNIVQ+ D            FE    V +L+E+CPN S+++ + QR    LTE 
Sbjct: 142 KSMK-HPNIVQFTDC-----------FEDDTNVYILLEICPNGSVMELLRQR--KHLTEP 187

Query: 155 EIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTSTCFPIVTTHQ 214
           E+   M  +  +I  MH   V  IHRD+K+ N+  D + N K+ DFG  +    ++   +
Sbjct: 188 EVRFCMIQIIGAIRYMHSRRV--IHRDLKLGNIFFDKEYNLKIGDFGLAA----VLANDK 241

Query: 215 DIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGVFLYKLLFFTTPFEM---- 270
           +     +   +  TP Y +PE++   +    + + DIW++GV LY LLF   PF+     
Sbjct: 242 E-----RKYTICGTPNYIAPEVLT-GKHTGHSYEVDIWSIGVMLYALLFGKPPFQAKEVE 295

Query: 271 TGQFAILHSKYEFPVNK-YSSKLINLIIIMLAENPNLRPNIYQV 313
           T    I    + FP +K  SS   NLI  +L  NP  RP++Y++
Sbjct: 296 TIYERIKCRDFIFPADKPVSSDAKNLISHLLQLNPAARPSLYEI 339

>Sklu_2419.9 YMR001C, Contig c2419 14049-16136
          Length = 695

 Score = 99.8 bits (247), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 82/286 (28%), Positives = 144/286 (50%), Gaps = 49/286 (17%)

Query: 39  NYLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGDVACLKRVLVQDENGLNEMRNEVEVM 98
           ++L EGGFA+ + +K        D++     KI     + ++ ++ E    ++ +E+++ 
Sbjct: 81  HFLGEGGFARCFQMK--------DDSG----KIFAAKTVAKISIKSEKTRKKLLSEIQIH 128

Query: 99  KKLKGAPNIVQYFDSNASRRRDGVQGFE----VLLLMELCPNKSLLDYMNQRLSTKLTEA 154
           K +K  PNIVQ+ D            FE    V +L+E+CPN SL+D + +R    LTE 
Sbjct: 129 KSMK-HPNIVQFIDC-----------FEDDTNVYILLEICPNGSLMDLLKKR--KVLTEP 174

Query: 155 EIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTSTCFPIVTTHQ 214
           E+      +  +I  MH   V  IHRD+K+ N+  D+  N K+ DFG  +    ++   +
Sbjct: 175 EVRYFTTQIVGAIKYMHNRRV--IHRDLKLGNIFFDSNYNLKIGDFGLAA----VLANDR 228

Query: 215 DIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGVFLYKLLFFTTPFEMTGQF 274
           +     +   V  TP Y +PE++         E  DIW++GV +Y LL    PF+   + 
Sbjct: 229 E-----RKYTVCGTPNYIAPEVLAGKHSGHSYE-VDIWSIGVMIYALLIGKPPFQ-AKEV 281

Query: 275 AILHSK-----YEFPVNKYSSK-LINLIIIMLAENPNLRPNIYQVL 314
            I++ +     Y FP  K +SK ++ LI  +L+ +P  RP++ +++
Sbjct: 282 NIIYERIKSGDYIFPREKPTSKEVMVLIQDILSIDPIERPSLDEIM 327

>Scas_700.28
          Length = 896

 Score = 97.1 bits (240), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 62/196 (31%), Positives = 99/196 (50%), Gaps = 22/196 (11%)

Query: 126 EVLLLMELCPNKSLLDYMNQRLST-KLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKI 184
           +V + +E CP K L D +   LS  ++   E V++   +   +   H L  + +HRD+K+
Sbjct: 103 KVWMALEYCPGKELYDRV---LSMHRVPTDECVQLFAQIVGGVHYAHSL--NCVHRDLKL 157

Query: 185 ENVLVDAKNNFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLP 244
           EN+L+D   + KL DFG T  C    T             +  T  Y +PE+I+  R   
Sbjct: 158 ENILLDKSGDAKLTDFGFTRECMTKTTLET----------ICGTTVYMAPELIE--RKSY 205

Query: 245 INEKSDIWALGVFLYKLLFFTTPF----EMTGQFAILHSKYEFPVNKYSSKLINLIIIML 300
              K DIW+LGV LY ++  + PF    E   ++ I+H   +   N  ++   +LI+ +L
Sbjct: 206 DGFKIDIWSLGVILYTMINGSMPFDEDDETKTEWKIVHQTPQLNENIVTADAKDLILRLL 265

Query: 301 AENPNLRPNIYQVLYH 316
           A+NPN RP + Q+L H
Sbjct: 266 AKNPNDRPTVEQILKH 281

>ACL006W [1043] [Homologous to ScYMR001C (CDC5) - SH]
           complement(344395..346521) [2127 bp, 708 aa]
          Length = 708

 Score = 96.7 bits (239), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 79/287 (27%), Positives = 143/287 (49%), Gaps = 47/287 (16%)

Query: 40  YLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGDVACLKRVLVQDENGLNEMRNEVEVMK 99
           +L EGGFA+ + +K        D++     K+     + ++ ++ E    ++ +E+++ K
Sbjct: 78  FLGEGGFARCFQMK--------DDSG----KVFAAKTVAKISIKSEKTRKKLLSEIQIHK 125

Query: 100 KLKGAPNIVQYFDSNASRRRDGVQGFE----VLLLMELCPNKSLLDYMNQRLSTKLTEAE 155
            +K  PNIVQ+ D            FE    V +L+E+CPN SL+D + QR   +LTE E
Sbjct: 126 SMK-HPNIVQFTDC-----------FEDDTNVYILLEICPNGSLMDLLKQR--KQLTEPE 171

Query: 156 IVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTSTCFPIVTTHQD 215
           +      +  +I  MH     +IHRD+K+ N+  D   N K+ DFG  +    ++   ++
Sbjct: 172 VRFFTTQIVGAIKYMH--SRRIIHRDLKLGNIFFDKHFNLKIGDFGLAA----VLANDRE 225

Query: 216 IALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGVFLYKLLFFTTPFEM----T 271
                +   +  TP Y +PE++   +    + + DIW++GV +Y LL    PF+     T
Sbjct: 226 -----RKYTICGTPNYIAPEVLT-GKHTGHSFEVDIWSIGVMIYALLIGKPPFQAKEVNT 279

Query: 272 GQFAILHSKYEFPVNK-YSSKLINLIIIMLAENPNLRPNIYQVLYHL 317
               I    + FP +K  SS+   LI  +L+ +P  RP++ +++ ++
Sbjct: 280 IYERIKVCDFSFPKDKPISSEAKVLIKDILSLDPLERPSLAEIMEYV 326

>Scas_644.15
          Length = 726

 Score = 95.9 bits (237), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 80/285 (28%), Positives = 141/285 (49%), Gaps = 47/285 (16%)

Query: 39  NYLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGDVACLKRVLVQDENGLNEMRNEVEVM 98
           ++L EGGFA+ + +K        D +     KI     + ++ ++ E    ++ +E+++ 
Sbjct: 96  HFLGEGGFARCFQIK--------DESG----KIFAAKTVAKISIKTEKTKKKLLSEIQIH 143

Query: 99  KKLKGAPNIVQYFDSNASRRRDGVQGFE----VLLLMELCPNKSLLDYMNQRLSTKLTEA 154
           K +K  PNIV + D            FE    V +L+E+C N SL+D M +R +  LTE 
Sbjct: 144 KSMK-HPNIVHFVDC-----------FEDDTNVYILLEICSNGSLMDLMKKRKT--LTEP 189

Query: 155 EIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTSTCFPIVTTHQ 214
           E+      +  ++  MH   V  IHRD+K+ N+  D   N K+ DFG  +    ++  ++
Sbjct: 190 EVRFFTTQICGAVKYMHSRRV--IHRDLKLGNIFFDKDYNLKVGDFGLAA----VLANNR 243

Query: 215 DIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGVFLYKLLFFTTPFEMTGQF 274
           +     +   V  TP Y +PE++ + +    + + DIW++GV +Y LL    PF+     
Sbjct: 244 E-----RKYTVCGTPNYIAPEVL-MGKHAGHSFEVDIWSIGVMIYALLVGKPPFQAKDVN 297

Query: 275 AILH----SKYEFPVNKY-SSKLINLIIIMLAENPNLRPNIYQVL 314
            I       +Y +P +KY SS+   LI  +L  +P  RP+I +++
Sbjct: 298 VIYDRIKACQYGYPKDKYVSSEAKTLIADILCVDPVERPSIREII 342

>Sklu_2361.3 YPL150W, Contig c2361 3677-6331
          Length = 884

 Score = 95.5 bits (236), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 82/316 (25%), Positives = 145/316 (45%), Gaps = 48/316 (15%)

Query: 5   NGTSRSVSAMGHPAVERYTPGHIVCVGTHKVEVVNYLAEGGFAQIYVVKFLEYLNEFDNT 64
           N    +++A  +    +++   +V +G +K+  V  + EG F ++Y+       N     
Sbjct: 9   NNLKATIAASYNKLYGQFSSNELVDIGNYKI--VKLIGEGSFGKVYLA------NHRLTH 60

Query: 65  ASVPLKIGDVACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQG 124
             V LK G+           +N  N +R EV   ++    P+I + ++   +  +     
Sbjct: 61  QKVVLKTGN-----------KNDPNVVR-EVFYHRQF-DFPHITKLYEVIVTESK----- 102

Query: 125 FEVLLLMELCPNKSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKI 184
             V + +E CP K L +Y+   +  +++  E  K+   +  ++   H L    +HRD+K+
Sbjct: 103 --VWMALEYCPGKELYEYL--LMQHRISLEESGKLFAQIVSAVYYAHSL--QCVHRDLKL 156

Query: 185 ENVLVDAKNNFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLP 244
           EN+L+D K   K+ DFG T  C          A  T    V  T  Y +PE+I+  R   
Sbjct: 157 ENILLDKKGRAKITDFGFTREC----------ATKTMLETVCGTTVYMAPELIE--RKSY 204

Query: 245 INEKSDIWALGVFLYKLLFFTTPF----EMTGQFAILHSKYEFPVNKYSSKLINLIIIML 300
              K DIW+LGV LY ++  T PF    E   ++ I++ +  +  +  S    +LI  +L
Sbjct: 205 DGFKIDIWSLGVILYTMIHGTMPFDEEDETKTKWKIINEEPFYNDDVVSKDAKDLISQLL 264

Query: 301 AENPNLRPNIYQVLYH 316
            ++P+ RP + QVL H
Sbjct: 265 CKDPSQRPQLSQVLAH 280

>CAGL0J11638g complement(1128620..1130860) highly similar to
           sp|P32562 Saccharomyces cerevisiae YMR001c CDC5 involved
           in regulation of DNA replication, hypothetical start
          Length = 746

 Score = 94.4 bits (233), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 76/280 (27%), Positives = 139/280 (49%), Gaps = 39/280 (13%)

Query: 40  YLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGDVACLKRVLVQDENGLNEMRNEVEVMK 99
           +L EGGFA+ + +K        D++     KI     + ++ ++ E    ++ +E+++ K
Sbjct: 86  FLGEGGFARCFQIK--------DDSG----KIFAAKTVAKISIKSEKTRKKLLSEIQIHK 133

Query: 100 KLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMNQRLSTKLTEAEIVKI 159
            +    NIVQ+ D       D V    V +L+E+CPN SL++ + +R +  +TE E+   
Sbjct: 134 SMSHT-NIVQFIDC----FEDNVN---VYILLEICPNGSLMELIKKRKT--ITEPEVRFF 183

Query: 160 MYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTSTCFPIVTTHQDIALL 219
           M  +   I  MH     +IHRD+K+ N+  D   N K+ DFG  +    ++   ++    
Sbjct: 184 MTQICGGIQYMH--SNRVIHRDLKLGNIFFDEHYNLKIGDFGLAA----VLANDRE---- 233

Query: 220 TQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGVFLYKLLFFTTPFEM----TGQFA 275
            +   +  TP Y +PE++ + +    + + DIW++GV LY LL    PF+     T    
Sbjct: 234 -RKFTICGTPNYIAPEVL-MGKHSGHSYEVDIWSIGVMLYALLIGKPPFQAKDVNTIYER 291

Query: 276 ILHSKYEFPVNKYSSKLINLII-IMLAENPNLRPNIYQVL 314
           I    + +P +K  S+    +I  +L+ NP  RP+I +++
Sbjct: 292 IKQRNFAYPKDKKISQDAKYLIDDILSLNPMERPSIQEIM 331

>YPL150W (YPL150W) [5297] chr16 (268187..270892) Serine/threonine
           protein kinase with unknown role [2706 bp, 901 aa]
          Length = 901

 Score = 93.2 bits (230), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 87/306 (28%), Positives = 135/306 (44%), Gaps = 60/306 (19%)

Query: 21  RYTPGHIVCVGTHKVEVVNYLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGDVACLKRV 80
           ++T   +  VG +K+  +  + EG F ++Y+              ++        CLK  
Sbjct: 29  QFTSDELTEVGNYKI--LKQIGEGSFGKVYL--------------ALHRPTHRKVCLK-- 70

Query: 81  LVQDENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLL 140
              D+N  N +R EV   ++    P I + ++   +  +       V + +E CP K L 
Sbjct: 71  -TSDKNDPNIVR-EVFYHRQFD-FPYITKLYEVIVTESK-------VWMALEYCPGKELY 120

Query: 141 DYMNQRLSTKLTEA-EIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLAD 199
           D++       L E  E+   +         MH      +HRD+K+EN+L+D   N KL D
Sbjct: 121 DHLLSLRRISLLECGELFAQISGAVYYAHSMH-----CVHRDLKLENILLDKNGNAKLTD 175

Query: 200 FGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGVFLY 259
           FG T  C    T             V  T  Y +PE+I+  R      K DIW+LGV LY
Sbjct: 176 FGFTRECMTKTTLET----------VCGTTVYMAPELIE--RRTYDGFKIDIWSLGVILY 223

Query: 260 KLLFFTTPF----EMTGQFAILHSKYEFPVNKYSSKLI-----NLIIIMLAENPNLRPNI 310
            L+    PF    E   ++ I++   E P  KY +K+I     +LI  +LA+NP  RP++
Sbjct: 224 TLITGYLPFDDDDEAKTKWKIVN---EEP--KYDAKVIPDDARDLISRLLAKNPGERPSL 278

Query: 311 YQVLYH 316
            QVL H
Sbjct: 279 SQVLRH 284

>YMR001C (CDC5) [3966] chr13 complement(269019..271136)
           Serine/threonine protein kinase required for exit from
           mitosis and for inactivation of the Rad53p checkpoint
           kinase during adaptation to unrepaired DNA damage,
           member of the polo family of protein kinases [2118 bp,
           705 aa]
          Length = 705

 Score = 92.0 bits (227), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 80/286 (27%), Positives = 140/286 (48%), Gaps = 49/286 (17%)

Query: 39  NYLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGDVACLKRVLVQDENGLNEMRNEVEVM 98
           ++L EGGFA+ + +K        D++     +I     + +  ++ E    ++ +E+++ 
Sbjct: 86  HFLGEGGFARCFQIK--------DDSG----EIFAAKTVAKASIKSEKTRKKLLSEIQIH 133

Query: 99  KKLKGAPNIVQYFDSNASRRRDGVQGFE----VLLLMELCPNKSLLDYMNQRLSTKLTEA 154
           K +   PNIVQ+ D            FE    V +L+E+CPN SL++ + +R    LTE 
Sbjct: 134 KSM-SHPNIVQFIDC-----------FEDDSNVYILLEICPNGSLMELLKRR--KVLTEP 179

Query: 155 EIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTSTCFPIVTTHQ 214
           E+      +  +I  MH   V  IHRD+K+ N+  D+  N K+ DFG  +          
Sbjct: 180 EVRFFTTQICGAIKYMHSRRV--IHRDLKLGNIFFDSNYNLKIGDFGLAAV--------- 228

Query: 215 DIALLTQNIY-VHTTPQYRSPEMIDLYRCLPINEKSDIWALGVFLYKLLFFTTPFEM--- 270
            +A  ++  Y +  TP Y +PE++ + +    + + DIW+LGV LY LL    PF+    
Sbjct: 229 -LANESERKYTICGTPNYIAPEVL-MGKHSGHSFEVDIWSLGVMLYALLIGKPPFQARDV 286

Query: 271 -TGQFAILHSKYEFPVNK-YSSKLINLIIIMLAENPNLRPNIYQVL 314
            T    I    + FP +K  S +   LI  +L+ +P  RP++ +++
Sbjct: 287 NTIYERIKCRDFSFPRDKPISDEGKILIRDILSLDPIERPSLTEIM 332

>Kwal_56.22476
          Length = 697

 Score = 91.7 bits (226), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 76/286 (26%), Positives = 142/286 (49%), Gaps = 49/286 (17%)

Query: 39  NYLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGDVACLKRVLVQDENGLNEMRNEVEVM 98
           ++L EGGFA+ + +K        D+      KI     + ++ ++ E    ++ +E+++ 
Sbjct: 83  HFLGEGGFARCFQIK--------DDGG----KIFAAKTVAKISIKSEKTRKKLLSEIQIH 130

Query: 99  KKLKGAPNIVQYFDSNASRRRDGVQGFE----VLLLMELCPNKSLLDYMNQRLSTKLTEA 154
           K ++   NIVQ+ D            FE    V +L+E+CPN SL+D + +R    LTE 
Sbjct: 131 KSMRHT-NIVQFVDC-----------FEDDTNVYILLEICPNGSLMDLLKRR--KMLTEP 176

Query: 155 EIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTSTCFPIVTTHQ 214
           E+      +  ++  MH   V  IHRD+K+ N+  D   N K+ DFG  +    ++   +
Sbjct: 177 EVRFFTTQIVGAVKYMHSRRV--IHRDLKLGNIFFDKHYNLKVGDFGLAA----VLANDR 230

Query: 215 DIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGVFLYKLLFFTTPFEMTGQF 274
           +     +   V  TP Y +PE++   +    + + DIW+ GV +Y LL    PF+   + 
Sbjct: 231 E-----RKYTVCGTPNYIAPEVLT-GKHTGHSYEVDIWSCGVMIYALLIGKPPFQ-AKEV 283

Query: 275 AILHSK-----YEFPVNKY-SSKLINLIIIMLAENPNLRPNIYQVL 314
            I++ +     + FP +K+ S + + LI  +L+ +P  RP++ +++
Sbjct: 284 NIIYERIKCGDFVFPKDKFISPEALVLIKDILSIDPLERPSLDEII 329

>Kwal_26.8751
          Length = 848

 Score = 90.5 bits (223), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 59/196 (30%), Positives = 96/196 (48%), Gaps = 24/196 (12%)

Query: 127 VLLLMELCPNKSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIEN 186
           V + +E CP K L +Y+  +    L E    ++   +  ++   H +    +HRD+K+EN
Sbjct: 103 VWMALEYCPGKELYEYLLAKKHIPLEECS--ELFSQIVGAVYYAHSM--KCVHRDLKLEN 158

Query: 187 VLVDAKNNFKLADFGSTSTCFPIVTTHQDIALLTQNIY--VHTTPQYRSPEMIDLYRCLP 244
           +L+D K + KL DFG T  C             T+ I   +  T  Y +PE+I+  R   
Sbjct: 159 ILLDKKGHAKLTDFGFTREC------------ATKGILETICGTTVYMAPELIE--RKPY 204

Query: 245 INEKSDIWALGVFLYKLLFFTTPF----EMTGQFAILHSKYEFPVNKYSSKLINLIIIML 300
              K D W+LG+ LY ++  T PF    E+  ++ I+H    +  +   S    LI  +L
Sbjct: 205 EGYKIDTWSLGIILYTMIHGTMPFDEVDEVKTKYKIVHYNPTYDNDYIDSNGKELISQLL 264

Query: 301 AENPNLRPNIYQVLYH 316
            ++PN RP++ QVL H
Sbjct: 265 EKDPNQRPSLTQVLQH 280

>KLLA0F11319g 1042436..1044967 similar to sgd|S0006071 Saccharomyces
           cerevisiae YPL150w, start by similarity
          Length = 843

 Score = 89.0 bits (219), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 63/196 (32%), Positives = 104/196 (53%), Gaps = 24/196 (12%)

Query: 127 VLLLMELCPNKSLLDYM--NQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKI 184
           V +++E C    L +++   QRLS  L E++  K+   +A ++   H L    +HRD+K+
Sbjct: 103 VWMVLEYCSGHELYEHLLKEQRLS--LEESK--KLFSQIASAVYYAHEL--KCVHRDLKL 156

Query: 185 ENVLVDAKNNFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLP 244
           ENVL+D   + KL DFG T          +++A  +Q   +  T  Y +PE+I+  +C  
Sbjct: 157 ENVLLDGNGHAKLTDFGFT----------REMATRSQLETICGTTVYMAPELIE-RKCYD 205

Query: 245 INEKSDIWALGVFLYKLLFFTTPF----EMTGQFAILHSKYEFPVNKYSSKLINLIIIML 300
              K DIW+LG+ LY ++    PF    ++  +  I++ + +F     S   I+LI  ML
Sbjct: 206 -GFKVDIWSLGIILYTMINGYMPFDEDDDIKTKLKIVNDELDFNQEWISDDAIDLIQGML 264

Query: 301 AENPNLRPNIYQVLYH 316
            +NPN R ++ QVL H
Sbjct: 265 RKNPNERISLAQVLSH 280

>AFL101C [3094] [Homologous to ScYPL209C (IPL1) - SH]
           (249144..250247) [1104 bp, 367 aa]
          Length = 367

 Score = 83.2 bits (204), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 71/237 (29%), Positives = 106/237 (44%), Gaps = 42/237 (17%)

Query: 36  EVVNYLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGDVACLKRVLVQDENGLN---EMR 92
           E+   L +G F ++Y V+ +E               G V  LK +  +D    N   + R
Sbjct: 110 EIGKVLGKGKFGRVYCVRHIES--------------GFVCALKAMEKKDIIQYNIEKQFR 155

Query: 93  NEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMNQRLSTKLT 152
            EVE+   L+  PN+ Q +      +R       V LLME   N  L  ++  R  +   
Sbjct: 156 REVEIQSSLR-HPNLTQLYGYFHDEKR-------VYLLMEYLVNGELYKHLKGR--SHFN 205

Query: 153 EAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTSTCFPIVTT 212
           +      +Y +A ++  MH    +++HRDIK EN+++   N  KL DFG  S   P  + 
Sbjct: 206 DVVASYYVYQMADALDYMH--ERNILHRDIKPENIIIGFNNTIKLTDFG-WSVITPKGSK 262

Query: 213 HQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGVFLYKLLFFTTPFE 269
            + +           T  Y SPE+I   R    NEK D+WALGV  Y+LL  + PFE
Sbjct: 263 RKTLC---------GTVDYLSPELI---RSREYNEKVDVWALGVLTYELLVGSPPFE 307

>CAGL0M02299g 273725..276406 similar to tr|Q12152 Saccharomyces
           cerevisiae YPL150w, start by similarity
          Length = 893

 Score = 85.1 bits (209), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 81/309 (26%), Positives = 134/309 (43%), Gaps = 66/309 (21%)

Query: 21  RYTPGHIVCVGTHKVEVVNYLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGDVACLKRV 80
           +++   +  VG +K++    + EG F ++Y+               V LK GD +     
Sbjct: 30  QFSSSELTEVGNYKIQ--KQIGEGSFGKVYLA------THRPTKQKVVLKTGDKS----- 76

Query: 81  LVQDENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLL 140
              D N + E+        +    P I + ++   +  +       V + +E CP K L 
Sbjct: 77  ---DPNVVREV-----FYHRQFDYPYITKLYEVIVTETK-------VWMALEYCPGKELY 121

Query: 141 DYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADF 200
           D++  +  ++L   E  ++   +  ++   H L  + +HRD+K+ENVL+D   N KL DF
Sbjct: 122 DHLLSK--SRLPTLECAELFAQITGAVHYAHTL--NCVHRDLKLENVLLDKNGNAKLTDF 177

Query: 201 GST--STCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINE-KSDIWALGVF 257
           G T  S    ++ T            V  T  Y +PEMI   +  P +  K DIW+LGV 
Sbjct: 178 GFTRESMTKAVLET------------VCGTTVYMAPEMI---QHKPYDGFKVDIWSLGVI 222

Query: 258 LYKLLFFTTPFE-----MTGQFAI-----LHSKYEFPVNKYSSKLINLIIIMLAENPNLR 307
           LY LL    PF+     +T Q  I     +  +   P  +      NLI  +L+++P  R
Sbjct: 223 LYTLLCGCLPFDEDDDLLTKQKIINDTPVIDERITIPEAQ------NLIEQLLSKDPTER 276

Query: 308 PNIYQVLYH 316
           PN   +L H
Sbjct: 277 PNTSAILLH 285

>Sklu_2419.10 , Contig c2419 14439-16135
          Length = 566

 Score = 83.2 bits (204), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 68/220 (30%), Positives = 111/220 (50%), Gaps = 36/220 (16%)

Query: 105 PNIVQYFDSNASRRRDGVQGFE----VLLLMELCPNKSLLDYMNQRLSTKLTEAEIVKIM 160
           PNIVQ+ D            FE    V +L+E+CPN SL+D + +R    LTE E+    
Sbjct: 4   PNIVQFIDC-----------FEDDTNVYILLEICPNGSLMDLLKKR--KVLTEPEVRYFT 50

Query: 161 YDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTSTCFPIVTTHQDIALLT 220
             +  +I  MH   V  IHRD+K+ N+  D+  N K+ DFG  +    ++   ++     
Sbjct: 51  TQIVGAIKYMHNRRV--IHRDLKLGNIFFDSNYNLKIGDFGLAA----VLANDRE----- 99

Query: 221 QNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGVFLYKLLFFTTPFEMTGQFAILHSK 280
           +   V  TP Y +PE++         E  DIW++GV +Y LL    PF+   +  I++ +
Sbjct: 100 RKYTVCGTPNYIAPEVLAGKHSGHSYE-VDIWSIGVMIYALLIGKPPFQ-AKEVNIIYER 157

Query: 281 -----YEFPVNKYSSK-LINLIIIMLAENPNLRPNIYQVL 314
                Y FP  K +SK ++ LI  +L+ +P  RP++ +++
Sbjct: 158 IKSGDYIFPREKPTSKEVMVLIQDILSIDPIERPSLDEIM 197

>ACR133C [1180] [Homologous to ScYPL150W - SH] (581468..584023)
           [2556 bp, 851 aa]
          Length = 851

 Score = 83.2 bits (204), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 63/198 (31%), Positives = 96/198 (48%), Gaps = 28/198 (14%)

Query: 127 VLLLMELCPNKSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIEN 186
           V + +E CP   L DY+   L  ++   E  ++   +  ++   H L    +HRD+K+EN
Sbjct: 103 VWMALEYCPGNELYDYL--LLKQRIPLDETRRLFAQIVSAVFYAHSLQC--VHRDLKLEN 158

Query: 187 VLVDAKNNFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPIN 246
           +L+D      L DFG T  C          A  TQ   V  T  Y +PE+I   R     
Sbjct: 159 ILLDKNGYAMLTDFGFTREC----------ATKTQLETVCGTTVYMAPELIK--REAYDG 206

Query: 247 EKSDIWALGVFLYKLLFFTTPFE-----MTGQFAILHSKYEFP--VNKYSS-KLINLIII 298
            K D W+LG+ LY +L    PF+      TG   I+H   E P  +++Y+S +  +LI+ 
Sbjct: 207 YKVDTWSLGIILYTMLHGYMPFDEDDTVRTG-LKIMH---EEPAVLDEYTSPQAKDLIVR 262

Query: 299 MLAENPNLRPNIYQVLYH 316
           +L +N   RPN+ +VL H
Sbjct: 263 LLDKNAAQRPNLNEVLQH 280

>Kwal_56.24274
          Length = 346

 Score = 80.5 bits (197), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 88/351 (25%), Positives = 145/351 (41%), Gaps = 75/351 (21%)

Query: 27  IVCVGT----------HKVEVVNYLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGDVAC 76
           I C G+           K  +   L EGG + +Y+V+  E               G++  
Sbjct: 8   ICCCGSSQRSFVSINGRKYRIQKLLGEGGLSFVYLVESKE---------------GELFA 52

Query: 77  LK--RVLVQDENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELC 134
           LK  R        ++    EV   ++   +P I Q  DS   + +DG +   V +L+   
Sbjct: 53  LKKTRCPFGSIGSISPAMKEVANYQRFS-SPYIAQIVDSQVVQEKDGSK--TVYVLLPYF 109

Query: 135 PNKSLLDYMNQRL--STKLTEAEIVKIMY------------------DVALSISQMHYLP 174
              SL D +N+ L   T+++E +I+++                    DVA SI    Y  
Sbjct: 110 AKGSLQDLINRHLLDCTQMSELDILRMALGIARGLLCIHEANPNHETDVAYSIVSAPYAE 169

Query: 175 VSLI-----------------HRDIKIENVLVDAKNNFKLADFGSTSTCFPIVTTHQDIA 217
            S +                 HRD+K  N+++  ++   ++D GS S     + + Q + 
Sbjct: 170 DSSLLNDLELDTFGESQQSYAHRDVKPSNIMISPEDLPVISDLGSCSRARIDINSRQALL 229

Query: 218 LLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGVFLYKLLFFTTPFEMTGQ---- 273
              +    + T  Y +PE++D+     I EK DIW+ G  +Y + F  +PFE   Q    
Sbjct: 230 RFQEWSSDNCTLSYAAPEILDVKLNSVITEKCDIWSFGCTMYSMCFGISPFEREEQISGA 289

Query: 274 ---FAILHSKYEFPV-NKYSSKLINLIIIMLAENPNLRPNIYQVLYHLCEI 320
              +AI   KY  P    YSS LI LI   L+ NP  RP++ +++  L E+
Sbjct: 290 SVTYAITTGKYTVPRGTSYSSSLIELIGKCLSVNPEQRPSVNELIALLMEL 340

>AFR696C [3889] [Homologous to ScYDR507C (GIN4) - SH; ScYCL024W
           (KCC4) - SH] (1721689..1725117) [3429 bp, 1142 aa]
          Length = 1142

 Score = 82.8 bits (203), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 67/231 (29%), Positives = 111/231 (48%), Gaps = 38/231 (16%)

Query: 97  VMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMNQRLSTKLTEAEI 156
           ++ KL   PN+++ +D   + +       ++ +++E      L + + QR    L E E 
Sbjct: 80  IIMKLLNHPNVLRLYDVWETAQ-------DLYMVLEYVEKGELFNLLVQR--GPLPENEA 130

Query: 157 VKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTSTCFPIVTTHQDI 216
           V+    + + IS  H L   ++HRD+K EN+L+D K N KLADFG               
Sbjct: 131 VRFFRQIIIGISYCHAL--GIVHRDLKPENLLLDHKFNIKLADFGMA------------- 175

Query: 217 ALLTQNIYVHT---TPQYRSPEMIDLYRCLPINE-KSDIWALGVFLYKLLFFTTPF-EMT 271
           AL +++  + T   +P Y +PE++     LP +  +SD+W+ GV LY LL    PF E  
Sbjct: 176 ALESKDKLLETSCGSPHYAAPEIVS---GLPYHGFESDVWSCGVILYALLTGRLPFDEED 232

Query: 272 GQ-----FAILHSKYEFP-VNKYSSKLINLIIIMLAENPNLRPNIYQVLYH 316
           G        +   KYE P  ++ S +  +LI+ +L   P  R    ++L H
Sbjct: 233 GNIRNLLLKVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKH 283

>YPL236C (YPL236C) [5213] chr16 complement(101608..102702)
           Serine/threonine protein kinase of unknown function
           [1095 bp, 364 aa]
          Length = 364

 Score = 79.7 bits (195), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 80/333 (24%), Positives = 145/333 (43%), Gaps = 61/333 (18%)

Query: 30  VGTHKVEVVNYLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGDVACLKRVLVQDENGLN 89
           V   +  +   L EGG + +Y+V+  +     DN  + P    ++  LK+++      ++
Sbjct: 25  VNDKRYRIQRLLGEGGMSFVYLVQLSKNSLIIDNGIATP----ELYALKKIICPSVESIS 80

Query: 90  EMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMNQRL-- 147
               E+E  K+ + +P +++  DS   + +DG +   + +++      SL D +N+RL  
Sbjct: 81  NGMREIENYKRFQ-SPYVIKSIDSQVMQEKDGSK--TIYIVLPYYSLGSLQDSINRRLLE 137

Query: 148 STKLTEAEIVKIMYDV------------------------ALSIS--------------Q 169
            T ++EAE V+IM  V                        A+S++              +
Sbjct: 138 GTFVSEAECVRIMLGVTRGLLCLHDPASRQDNATSRVNVDAVSMTYSDETAMLLEDTPLE 197

Query: 170 MHYLP------VSLIHRDIKIENVLVDAKNNFKLADFGSTSTCFPIVTTHQDIALLTQNI 223
           M  L       ++  HRDI   N+L  +     + D GS S     +     ++ L + +
Sbjct: 198 MDMLSSNSAGSIAYAHRDITPSNILFSSDGLPVIGDLGSCSQADITIENRHQLSELQEWV 257

Query: 224 YVHTTPQYRSPEMIDLYRCLPINEKSDIWALGVFLYKLLFFTTPFEMTGQ-------FAI 276
             + T  Y  PE+++L     ++ K DIW+LG   Y L+F  +PFE   Q       +AI
Sbjct: 258 NDNCTLPYTPPELLNLKLNQVLSSKVDIWSLGCTFYTLMFGISPFEREEQIHGASLTYAI 317

Query: 277 LHSKYEFPVN-KYSSKLINLIIIMLAENPNLRP 308
              KY FP N ++S  L+++I   +  +P  RP
Sbjct: 318 NTGKYSFPRNSRFSEGLLSVIKKCIQVDPIQRP 350

>Kwal_33.13112
          Length = 505

 Score = 80.9 bits (198), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 64/253 (25%), Positives = 120/253 (47%), Gaps = 33/253 (13%)

Query: 72  GDVACLKRV-LVQDENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLL 130
           G++  +K + L + ++ ++ +  E+  + +L+ AP +  Y+ +        V+   + ++
Sbjct: 59  GEMVAVKIINLEETQDDIDVLAQEIYFLSELR-APFVTTYYKTY-------VEDVSMWIV 110

Query: 131 MELCPNKSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVD 190
           ME C   S  D +      +L E ++  I+ +V   +  +H      IHRD+K  N+L+ 
Sbjct: 111 MEFCGGGSCADLLKHLPEHRLPENKVAYIIREVLYGLEYLH--SQRKIHRDVKAANILLT 168

Query: 191 AKNNFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSD 250
            +   KL DFG +          Q +A L +N +V  TP + +PE+I   R    +EK+D
Sbjct: 169 DEGEVKLGDFGVSG---------QIMATLKRNTFV-GTPYWMAPEIIA--RDNGYDEKAD 216

Query: 251 IWALGVFLYKLLFFTTPFEMTGQFAILHSKYEFPVNK-------YSSKLINLIIIMLAEN 303
           IW+LG+   +LL    P+       +L +    P+ K       ++S   + I + L ++
Sbjct: 217 IWSLGITAMELLTGQPPYAKYDPMKVLMN---IPLRKPPRLQGRFTSSARDFIALCLTKD 273

Query: 304 PNLRPNIYQVLYH 316
           P LRP    +L H
Sbjct: 274 PALRPTASDLLSH 286

>KLLA0C01650g 128119..131457 similar to sp|Q12263 Saccharomyces
           cerevisiae YDR507c GIN4 ser/thr protein kinase, start by
           similarity
          Length = 1112

 Score = 81.3 bits (199), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 66/231 (28%), Positives = 112/231 (48%), Gaps = 38/231 (16%)

Query: 97  VMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMNQRLSTKLTEAEI 156
           ++ KL   PN+++ +D   + +       ++ +++E      L + + +R    L E E 
Sbjct: 78  IIMKLLNHPNVLRLYDVWETSK-------DLYMVLEYVEKGELFNLLVER--GPLPENEA 128

Query: 157 VKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTSTCFPIVTTHQDI 216
           V+    + + IS  H L   ++HRD+K EN+L+D K N KLADFG               
Sbjct: 129 VRFFRQIIIGISYCHAL--GIVHRDLKPENLLLDHKFNVKLADFGMA------------- 173

Query: 217 ALLTQNIYVHT---TPQYRSPEMIDLYRCLPINE-KSDIWALGVFLYKLLFFTTPF-EMT 271
           AL +++  + T   +P Y +PE++     LP +  +SD+W+ GV LY LL    PF E  
Sbjct: 174 ALESKDKLLETSCGSPHYAAPEIVS---GLPYHGFESDVWSCGVILYALLTGRLPFDEED 230

Query: 272 GQ-----FAILHSKYEFPV-NKYSSKLINLIIIMLAENPNLRPNIYQVLYH 316
           G        +   K+E P  ++ SS+  +LI  +L  +P  R    ++L H
Sbjct: 231 GNIRNLLLKVQSGKFEMPGDDEISSEAQDLIARILTVDPEQRIKTREILKH 281

>Sklu_1962.2 YPL236C, Contig c1962 744-1838 reverse complement
          Length = 364

 Score = 79.0 bits (193), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 94/364 (25%), Positives = 152/364 (41%), Gaps = 86/364 (23%)

Query: 25  GHIVCVGTHKVEVVN--------YLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGDVAC 76
           G   C G +   ++N         L EGGF+ +Y+V+  E  N+      +    G++  
Sbjct: 10  GCFPCCGRNSSVLINGQHYAIQRLLGEGGFSFVYLVQSREN-NDLFALKKIHCPFGNI-- 66

Query: 77  LKRVLVQDENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPN 136
                      ++E   EV   KK + +P I     S   + +DG +   V +L+   P 
Sbjct: 67  ---------ESVSEAMREVNSYKKFR-SPYITHCVSSQVLQEQDGSK--TVFILLPYFPT 114

Query: 137 KSLLDYMNQRL--STKLTEAEIVKIMYDVALSISQMH-------------YLPVSLIHR- 180
            SLLD +N  L   T ++E EIV+I+  VA  +  MH              +   L +R 
Sbjct: 115 GSLLDKINTHLLDGTTISEEEIVRILVSVARGLRTMHNPAGQEDSIEDQTSVNTDLQYRD 174

Query: 181 --------DIKIEN------VLVDAKNNF------------KLADFGSTSTCFPIVT--- 211
                   D+++ N      VL    ++F            K A+   +S   P++    
Sbjct: 175 TVSMTYNEDLRLLNDSLELDVLSGNTSSFMASTTAYSHKDIKPANIMFSSDGLPVICDLG 234

Query: 212 ----THQDIALLTQNIYV------HTTPQYRSPEMIDLYRCLPINEKSDIWALGVFLYKL 261
                H DI+  +Q +        H T  +RSPE++++     I+EK DIW+LG  LY +
Sbjct: 235 SCSRAHVDISSRSQLVEFQEWCNEHCTLPFRSPELLNVTLNSKIDEKVDIWSLGCTLYCM 294

Query: 262 LFFTTPFEMTGQ-------FAILHSKYEFPVNK-YSSKLINLIIIMLAENPNLRPNIYQV 313
            F  +PFE   Q       +AI   K+  P N  YS +LI +I   +  +   RP+I ++
Sbjct: 295 CFGISPFEREEQLSGASMTYAIATGKFSIPPNTNYSPELIKIIKDCIEVDSKKRPSIDEL 354

Query: 314 LYHL 317
           L  L
Sbjct: 355 LARL 358

>ABL034W [558] [Homologous to ScYKL101W (HSL1) - SH]
           complement(333434..337711) [4278 bp, 1425 aa]
          Length = 1425

 Score = 80.9 bits (198), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 67/230 (29%), Positives = 105/230 (45%), Gaps = 39/230 (16%)

Query: 97  VMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMNQRLSTKLTEAEI 156
           ++ KL   PNI+  ++   ++        E+ L++E      L DY+  R   KL E E 
Sbjct: 116 IIMKLITHPNIMALYEVWENKS-------ELYLVLEYVEGGELFDYLIAR--GKLPEQEA 166

Query: 157 VKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKN-NFKLADFGSTSTCFPIVTTHQD 215
           +     +   +S  H    ++ HRD+K EN+L+D KN   K+ADFG              
Sbjct: 167 IHYFKQIVQGVSYCHNF--NICHRDLKPENLLLDKKNKTVKIADFGMA------------ 212

Query: 216 IALLTQNIYVHT---TPQYRSPEMI--DLYRCLPINEKSDIWALGVFLYKLLFFTTPFEM 270
            AL T N  + T   +P Y SPE++    Y   P    SD+W+ G+ L+ LL    PF  
Sbjct: 213 -ALETTNRLLETSCGSPHYASPEIVMGQKYHGSP----SDVWSCGIILFALLTGHLPFND 267

Query: 271 TGQFAIL----HSKYEFPVNKYSSKLINLIIIMLAENPNLRPNIYQVLYH 316
                +L    H +Y+ P N  S +  +LI  +L  +P  R  + ++L H
Sbjct: 268 DNVRKLLLKVQHGRYQMPSN-VSKEAKDLISKILVVDPEKRITVDKILEH 316

>Kwal_55.21545
          Length = 865

 Score = 79.0 bits (193), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 71/260 (27%), Positives = 121/260 (46%), Gaps = 30/260 (11%)

Query: 75  ACLKRVLVQD--ENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLME 132
            C  +VL  D  ++ + +++ E++ +  LK  PNI  Y+ S        +   ++ ++ME
Sbjct: 44  VCAIKVLNLDSADDEVEDVQKEIQFLSSLKQVPNITHYYGSY-------LNDTKLWVIME 96

Query: 133 LCPNKSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAK 192
            C   SL   +      K+ E  I  IM ++  ++  MH     +IHRDIK  NVL+   
Sbjct: 97  YCAGGSLRTLLR---PGKIGEQYIGVIMRELLTAL--MHIHKDGVIHRDIKAANVLITND 151

Query: 193 NNFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIW 252
            + KL DFG  +         Q +A          TP + +PE+I     +  + K DIW
Sbjct: 152 GHIKLCDFGVAAQLSQTKIRRQTMA---------GTPYWMAPEVI--MEGVYYDTKVDIW 200

Query: 253 ALGVFLYKLLFFTTPF-EMTGQFAI-LHSKYEFPV---NKYSSKLINLIIIMLAENPNLR 307
           +LG+  Y++     P+ E+    A+ L +K + P     ++SS L  +I + L E+P  R
Sbjct: 201 SLGITAYEIATGNPPYCEVEALRAMQLITKSKPPRLEGRQHSSALKEIIALCLDEDPKER 260

Query: 308 PNIYQVLYHLCEILNVEVPI 327
           P+   +L      L+  VP+
Sbjct: 261 PSAEDLLKTKFIKLHKNVPV 280

>Scas_707.36
          Length = 915

 Score = 78.6 bits (192), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 63/226 (27%), Positives = 105/226 (46%), Gaps = 39/226 (17%)

Query: 86  NGLNEMRNEVEVMKKL--KGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDY- 142
           N  N+++ E+ +MKK   K    +++  D  +SR+        + L++E C    +L   
Sbjct: 139 NDPNKIKKEIAIMKKCNNKHVVKLIEILDDLSSRK--------IYLVLEYCEKGPILWCP 190

Query: 143 -----MNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKL 197
                ++ R   +L+     +I  DV L +  +H     +IHRDIK  N+L+D     K+
Sbjct: 191 RDQLEIDSRGPPQLSFQRAREIFRDVILGLEYLH--SQGIIHRDIKPANLLMDKNGVVKI 248

Query: 198 ADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMI--------------DLYRCL 243
           +DFG +      + T+ D   LT+ +    TP + +PE+               +L+   
Sbjct: 249 SDFGVSLAANGNIDTNDDELELTKTV---GTPVFYAPEICLGAAAMERFNLDKDELFNGS 305

Query: 244 PINEKSDIWALGVFLYKLLF----FTTPFEMTGQFAILHSKYEFPV 285
            I+ K DIWALG+ LY LLF    F + FE+     I++ K  FP 
Sbjct: 306 CISFKIDIWALGITLYCLLFGMLPFVSEFELKLFEKIVNEKLRFPT 351

>YOL100W (PKH2) [4721] chr15 (129236..132481) Serine/threonine
           protein kinase with similarity to mammalian
           3-phosphoinositide-dependent protein kinase,
           phosphorylates and activates Ypk2p, required for
           endocytosis [3246 bp, 1081 aa]
          Length = 1081

 Score = 78.2 bits (191), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 66/243 (27%), Positives = 112/243 (46%), Gaps = 32/243 (13%)

Query: 94  EVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMNQRLSTKLTE 153
           E   ++KL  +P++V+ F +             +  L+E  PN   L  M +  S   T 
Sbjct: 227 EKTALQKLNNSPSVVRLFSTFQDES-------SLYFLLEYAPNGDFLSLMKKYGSLDETC 279

Query: 154 AEIVKIMYDVALSISQMHYLPVS-LIHRDIKIENVLVDAKNNFKLADFGSTSTCFPI--V 210
           A      Y  A  I  + YL  + +IHRDIK EN+L+D +   KL DFG+     P    
Sbjct: 280 AR-----YYAAQIIDAIDYLHSNGIIHRDIKPENILLDGEMKIKLTDFGTAKLLNPTNNS 334

Query: 211 TTHQDIALLTQNIYVHTTPQYRSPEMID----LYRCLPINEKSDIWALGVFLYKLLFFTT 266
            +  +  L T++     T +Y SPE+++     YRC       DIWA G  L++++    
Sbjct: 335 VSKPEYDLSTRSKSFVGTAEYVSPELLNDSFTDYRC-------DIWAFGCILFQMIAGKP 387

Query: 267 PFEMTGQF----AILHSKYEFPVNKYSSKLINLIIIMLAENPNLRPNIYQVL-YHLCEIL 321
           PF+ T ++     ++  +Y F    +   + +L+  +L +N + R  I Q+  +H  + L
Sbjct: 388 PFKATNEYLTFQKVMKVQYAF-TPGFPLIIRDLVKKILVKNLDRRLTISQIKEHHFFKDL 446

Query: 322 NVE 324
           N +
Sbjct: 447 NFK 449

>CAGL0K05709g complement(555903..559214) similar to sp|Q12263
           Saccharomyces cerevisiae YDR507c GIN4, start by
           similarity
          Length = 1103

 Score = 78.2 bits (191), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 65/231 (28%), Positives = 110/231 (47%), Gaps = 38/231 (16%)

Query: 97  VMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMNQRLSTKLTEAEI 156
           ++ KL   PN+++ FD   +         ++ L++E      L + + +R    L E E 
Sbjct: 81  IIMKLLNHPNVLRLFDVWET-------NSDLYLVLEYAEKGELFNMLVER--GPLPENEA 131

Query: 157 VKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTSTCFPIVTTHQDI 216
           V+    + + IS  H L V  +HRD+K EN+L+D K N K+ADFG               
Sbjct: 132 VRAFRQIIIGISYCHSLGV--VHRDLKPENLLLDNKLNIKIADFGMA------------- 176

Query: 217 ALLTQNIYVHT---TPQYRSPEMIDLYRCLPINE-KSDIWALGVFLYKLLFFTTPF-EMT 271
           AL +++  + T   +P Y +PE+I     LP     SD+W+ GV L+ LL    PF E  
Sbjct: 177 ALESEDKLLETSCGSPHYAAPEIIS---GLPYEGFSSDVWSCGVILFALLTGRLPFDEED 233

Query: 272 GQ-----FAILHSKYEFP-VNKYSSKLINLIIIMLAENPNLRPNIYQVLYH 316
           G        +   ++E P  ++ + +  +L+  +L  +P+ R  I ++L H
Sbjct: 234 GNIRNLLLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKH 284

>CAGL0L11550g 1229719..1232937 similar to sp|P38692 Saccharomyces
           cerevisiae YHR102w NRK1 ser/thr protein kinase, start by
           similarity
          Length = 1072

 Score = 77.0 bits (188), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 65/252 (25%), Positives = 116/252 (46%), Gaps = 29/252 (11%)

Query: 69  LKIGDVACLKRV-LVQDENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEV 127
           +K   V  +K + L   E+ + +++ E++ +  LK  PNI +Y+ S        ++G  +
Sbjct: 36  VKTKQVYAIKVLNLDSSEDEVEDVQREIQFLASLKQIPNITRYYGSY-------LRGTSL 88

Query: 128 LLLMELCPNKSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENV 187
            ++ME C   SL   +      K+ E  I  IM ++ +++  +H    ++IHRDIK  NV
Sbjct: 89  WIIMEYCAGGSLRSLLR---PGKIDEKYIGVIMRELLVALKVIHK--DNVIHRDIKAANV 143

Query: 188 LVDAKNNFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINE 247
           L+  +   KL DFG  +         Q +A          TP + +PE+I     +  + 
Sbjct: 144 LITNEGQVKLCDFGVAAQLNQTSLRRQTMA---------GTPYWMAPEVI--MEGVYYDT 192

Query: 248 KSDIWALGVFLYKLLFFTTPF----EMTGQFAILHSK-YEFPVNKYSSKLINLIIIMLAE 302
           K DIW+LG+  Y++     P+     +     I+ SK        Y+ +L   I + L E
Sbjct: 193 KVDIWSLGITAYEIATGNPPYCDVEALRAMQLIIKSKPPRLEERNYTPQLKEFIALCLDE 252

Query: 303 NPNLRPNIYQVL 314
           +P  R +  ++L
Sbjct: 253 DPQERLSAEELL 264

>Kwal_23.6325
          Length = 1542

 Score = 77.0 bits (188), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 71/267 (26%), Positives = 126/267 (47%), Gaps = 29/267 (10%)

Query: 65   ASVPLKIGDVACLKRVLVQDENGLNE----MRNEVEVMKKLKGAPNIVQYFDSNASRRRD 120
            ++V L  G++  +K + +QD   + +    ++ E+ V++ L   PN+VQY+     R + 
Sbjct: 1265 SAVNLDTGEILAVKEIKIQDRKSMKQVFPAIKEEMSVLEMLN-HPNVVQYYGVEVHRDK- 1322

Query: 121  GVQGFEVLLLMELCPNKSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYL-PVSLIH 179
                  V L ME C   SL     Q L     E E+V  +Y + + +  + YL   S++H
Sbjct: 1323 ------VNLFMEYCEGGSL----AQLLEHGRIEDEMVTQIYALQM-LEGLAYLHQSSVVH 1371

Query: 180  RDIKIENVLVDAKNNFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHT---TPQYRSPEM 236
            RDIK EN+L+D     K  DFG+  +     T   ++    +   V++   TP Y SPE 
Sbjct: 1372 RDIKPENILLDFNGVIKYVDFGAARSLAANGTKAPNVGAEGKADGVNSMMGTPMYMSPES 1431

Query: 237  IDLYRCLPINEKSDIWALGVFLYKLLFFTTP-FEMTGQFAILHSKY-----EFPVN-KYS 289
            I   +        DIW+LG  + +++    P F +  ++AI++        + P   + S
Sbjct: 1432 ITGAKKGKFG-SGDIWSLGCVILEMVTGRRPWFNLDNEWAIMYHVAAGHVPQLPTKEELS 1490

Query: 290  SKLINLIIIMLAENPNLRPNIYQVLYH 316
             + I+ ++  L ++PN R    ++L H
Sbjct: 1491 PQGIDFLLRCLKQDPNKRSTAMELLLH 1517

>KLLA0B02332g complement(206863..207948) similar to sp|P38991
           Saccharomyces cerevisiae YPL209c IPL1 ser/thr protein
           kinase, start by similarity
          Length = 361

 Score = 75.1 bits (183), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 83/286 (29%), Positives = 126/286 (44%), Gaps = 43/286 (15%)

Query: 36  EVVNYLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGDVACLKRVLVQDENGLNEMRNEV 95
           E+   L +G F ++Y VK  E            L     A  K+ +VQ      + R EV
Sbjct: 101 EIGKILGKGKFGKVYCVKHRE----------TGLICALKAMEKKEIVQ-YTIQKQFRREV 149

Query: 96  EVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMNQRLSTKLTEAE 155
           E+    K   N+ Q +      +R       V LLME      L  ++    +  L E  
Sbjct: 150 EIQGSFKHK-NLTQLYGFFYDEKR-------VYLLMEYVYYGELYKFLKN--NGPLNETL 199

Query: 156 IVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTSTCFPIVTTHQD 215
               +Y +A ++  MH    +++HRDIK EN+L+   N  KL DFG +         ++D
Sbjct: 200 ASYFVYQMANALDYMH--SKNILHRDIKPENILIGFNNTIKLTDFGWS-------VYNED 250

Query: 216 IALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGVFLYKLLFFTTPF-----EM 270
                +   +  T  Y SPE+I   +    N K D+WALGV  Y+LL  + PF     EM
Sbjct: 251 GQ---KRKTLCGTIDYLSPELI---KSREYNNKVDVWALGVLTYELLVGSPPFEEDTKEM 304

Query: 271 TGQFAILHSKYEFPVNKYSSKLINLIIIMLAENPNLRPNIYQVLYH 316
           T +  IL    +FP+N  S +  +LI+ +L   P+ R  + +V  H
Sbjct: 305 TYR-RILRCDLKFPLN-VSPQARDLIVRLLQFEPSKRIPLSEVKSH 348

>KLLA0E21780g complement(1936438..1939488) similar to sp|P38692
           Saccharomyces cerevisiae YHR102w NRK1 ser/thr protein
           kinase that interacts with CDC31P, start by similarity
          Length = 1016

 Score = 76.3 bits (186), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 72/285 (25%), Positives = 122/285 (42%), Gaps = 52/285 (18%)

Query: 29  CVGTHKVEVVNYLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGDVACLKRVLVQDENGL 88
            +G  K  VV         Q+Y +K L      DNT                    E+ +
Sbjct: 21  IIGRGKFGVVYKAFHVKTQQVYAIKVLN----LDNT--------------------EDEV 56

Query: 89  NEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMNQRLS 148
            ++R E++ +  LK  PNI  Y+ S        +   ++ ++ME C   SL   +   + 
Sbjct: 57  EDIRKEIQFLSSLKQTPNITHYYGSY-------LIDTKLWVIMEYCAGGSLRTLLRPGI- 108

Query: 149 TKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTSTCFP 208
             + E  I  IM ++ +++  +H    ++IHRDIK  N+L+    + KL DFG  +    
Sbjct: 109 --IEEKYIGVIMREILVALISIHR--DNVIHRDIKAANILIANNGSVKLCDFGVAAQLSQ 164

Query: 209 IVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGVFLYKLLFFTTPF 268
            +   Q +A          TP + +PE+I     +  + K DIW+LG+  Y++     P+
Sbjct: 165 SMLKRQTMA---------GTPYWMAPEVI--MEGVYYDTKVDIWSLGITAYEIATGNPPY 213

Query: 269 -EMTGQFAI-LHSKYEFPV---NKYSSKLINLIIIMLAENPNLRP 308
             M    A+ + +K + P     +YS  L   I + L E+P  RP
Sbjct: 214 CHMEAIRAMQMITKSKPPRLEGREYSQPLKEFIALCLDEDPKERP 258

>YHR102W (KIC1) [2390] chr8 (316574..319816) Serine/threonine
           protein kinase involved in regulation of cell wall beta
           1,6-glucan levels, interacts with Cdc31p [3243 bp, 1080
           aa]
          Length = 1080

 Score = 75.9 bits (185), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 65/245 (26%), Positives = 112/245 (45%), Gaps = 29/245 (11%)

Query: 69  LKIGDVACLKRV-LVQDENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEV 127
           +K G V  +K + L  D + + +++ E++ +  LK   NI +Y+ S        ++   +
Sbjct: 43  VKTGRVYAIKVLNLDSDSDEVEDVQREIQFLASLKQISNITRYYGSY-------LKDTSL 95

Query: 128 LLLMELCPNKSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENV 187
            ++ME C   SL   +      K+ E  I  IM ++ +++  +H    ++IHRDIK  NV
Sbjct: 96  WIIMEHCAGGSLRSLLRP---GKIDEKYIGVIMRELLVALKCIHK--DNVIHRDIKAANV 150

Query: 188 LVDAKNNFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINE 247
           L+  + N KL DFG  +         Q +A          TP + +PE+I     +  + 
Sbjct: 151 LITNEGNVKLCDFGVAAQVNQTSLRRQTMA---------GTPYWMAPEVI--MEGVYYDT 199

Query: 248 KSDIWALGVFLYKLLFFTTPF----EMTGQFAILHSK-YEFPVNKYSSKLINLIIIMLAE 302
           K DIW+LG+  Y++     P+     +     I+ SK        YS+ L   I + L E
Sbjct: 200 KVDIWSLGITTYEIATGNPPYCDVEALRAMQLIIKSKPPRLEDRSYSTSLKEFIALCLDE 259

Query: 303 NPNLR 307
           +P  R
Sbjct: 260 DPKER 264

>Scas_580.6
          Length = 1015

 Score = 75.5 bits (184), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 64/232 (27%), Positives = 110/232 (47%), Gaps = 28/232 (12%)

Query: 81  LVQDENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLL 140
           L  DE+ + +++ EV+ +  LK  PNI +Y+ S        ++   + ++ME C   SL 
Sbjct: 70  LDSDEDEVEDVQREVQFLSSLKQIPNITRYYGSY-------LKDTSLWIIMEYCAGGSLR 122

Query: 141 DYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADF 200
             +      K+ E  I  IM ++ +++  +H    ++IHRDIK  NVL+  + + KL DF
Sbjct: 123 SLLR---PGKIDEKYIGVIMRELLVALKYIHK--DNVIHRDIKAANVLITNEGSVKLCDF 177

Query: 201 GSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGVFLYK 260
           G  +         Q +A          TP + +PE+I     +  + K DIW+LG+  Y+
Sbjct: 178 GVAAQLNQSTLRRQTMA---------GTPYWMAPEVI--MEGVYYDTKVDIWSLGITAYE 226

Query: 261 LLFFTTPF-EMTGQFAI-LHSKYEFP---VNKYSSKLINLIIIMLAENPNLR 307
           +     P+ E+    A+ L +K + P      Y+  L   I + L E+P  R
Sbjct: 227 IATGNPPYCEVEALRAMQLITKSKPPRLESRSYTPLLKEFIALCLDEDPKER 278

>Sklu_2323.3 YPL209C, Contig c2323 5241-6443
          Length = 400

 Score = 73.9 bits (180), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 77/254 (30%), Positives = 118/254 (46%), Gaps = 33/254 (12%)

Query: 70  KIGDVACLK---RVLVQDENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFE 126
           K G +  LK   +  +   N   + R EVE+   L+  PN+ Q +      +R       
Sbjct: 161 KTGFICALKAMEKKEITQYNVQKQFRREVEIQASLRH-PNLTQLYGYFYDDKR------- 212

Query: 127 VLLLMELCPNKSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIEN 186
           V LLME   N  L  Y + R++    +      +  +A +++ MH    +++HRDIK EN
Sbjct: 213 VYLLMEYLVNGEL--YRHLRVNGPFNDILASYYVNQMADALNYMH--DRNVLHRDIKPEN 268

Query: 187 VLVDAKNNFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPIN 246
           +L+  +N  KL DFG +     I TT      L   +       Y SPE++  YR    +
Sbjct: 269 ILIGFQNTLKLTDFGWSV----ISTTGAKRKTLCGTL------DYLSPELVK-YR--EYD 315

Query: 247 EKSDIWALGVFLYKLLFFTTPFEMTGQ----FAILHSKYEFPVNKYSSKLINLIIIMLAE 302
           EK D+WALGV  Y+LL  T PFE   +      I+     FP ++ S    +LI  +L  
Sbjct: 316 EKVDVWALGVLAYELLVGTPPFEEASKELTYKRIVRRDLRFP-DQMSIDARDLIGRLLEN 374

Query: 303 NPNLRPNIYQVLYH 316
           +P+ R ++  VL H
Sbjct: 375 DPSTRISLKDVLSH 388

>AFR335C [3527] [Homologous to ScYOL100W (PKH2) - SH; ScYDR490C
           (PKH1) - SH] (1046762..1049863) [3102 bp, 1033 aa]
          Length = 1033

 Score = 75.1 bits (183), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 60/196 (30%), Positives = 97/196 (49%), Gaps = 17/196 (8%)

Query: 127 VLLLMELCPNKSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYL-PVSLIHRDIKIE 185
           +  L+E  PN   L  M +R  T L+E E  K  Y  A  +  +H+L    +IHRD+K E
Sbjct: 276 LYFLLEYAPNGDFLSVM-KRFGT-LSE-ECTK--YYGAQILDAIHHLHKQGIIHRDVKPE 330

Query: 186 NVLVDAKNNFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMI-DLYRCLP 244
           N+L+D     KL DFG T+        ++   L T++     T +Y SPE++ D Y    
Sbjct: 331 NILLDKTMKIKLTDFG-TAKLIGREDENKPYDLNTRSKSFVGTAEYVSPELLNDNY---- 385

Query: 245 INEKSDIWALGVFLYKLLFFTTPFEMTGQF----AILHSKYEFPVNKYSSKLINLIIIML 300
           ++ + DIWA G  L++++    PF+ T ++     ++  +Y F    +   L +LI  +L
Sbjct: 386 VDSRCDIWAFGCILFQMVAGKPPFKATNEYLTFQKVMRVQYAFTAG-FPMILRDLIKQLL 444

Query: 301 AENPNLRPNIYQVLYH 316
            + P  R  I Q+  H
Sbjct: 445 VKKPEQRLTILQIEKH 460

>YDR507C (GIN4) [1321] chr4 complement(1462346..1465774)
           Serine/threonine-protein kinase required for septin
           organization at the bud neck, has similarity to Ycl024p
           [3429 bp, 1142 aa]
          Length = 1142

 Score = 74.7 bits (182), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 60/231 (25%), Positives = 106/231 (45%), Gaps = 38/231 (16%)

Query: 97  VMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMNQRLSTKLTEAEI 156
           ++ KL   PN+++ +D   +         ++ L++E      L + + +R    L E E 
Sbjct: 83  IIMKLLNHPNVLRLYDVWET-------NTDLYLVLEYAEKGELFNLLVER--GPLPEHEA 133

Query: 157 VKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTSTCFPIVTTHQDI 216
           ++    + + +S  H L   ++HRD+K EN+L+D K N K+ADFG               
Sbjct: 134 IRFFRQIIIGVSYCHAL--GIVHRDLKPENLLLDHKYNIKIADFGMA------------- 178

Query: 217 ALLTQNIYVHT---TPQYRSPEMIDLYRCLPINE-KSDIWALGVFLYKLLFFTTPFE--- 269
           AL T+   + T   +P Y +PE++     +P     SD+W+ GV L+ LL    PF+   
Sbjct: 179 ALETEGKLLETSCGSPHYAAPEIVS---GIPYQGFASDVWSCGVILFALLTGRLPFDEED 235

Query: 270 ---MTGQFAILHSKYEFPV-NKYSSKLINLIIIMLAENPNLRPNIYQVLYH 316
               T    +   ++E P  ++ S +  +LI  +L  +P  R     +L H
Sbjct: 236 GNIRTLLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKH 286

>Kwal_26.7788
          Length = 1267

 Score = 74.7 bits (182), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 65/230 (28%), Positives = 104/230 (45%), Gaps = 39/230 (16%)

Query: 97  VMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMNQRLSTKLTEAEI 156
           ++ KL   PN++  ++   ++        E+ L++E      L DY+  R   +L E E 
Sbjct: 109 IIMKLISHPNVMGLYEVWENK-------LELFLVLEYVDGGELFDYLVSR--GRLPEKEA 159

Query: 157 VKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNN-FKLADFGSTSTCFPIVTTHQD 215
           +     +    +  H    ++ HRD+K EN+L+D KN   K+ADFG              
Sbjct: 160 IHYFRQIIEGTAYCHGF--NICHRDLKPENLLLDKKNKRIKIADFGMA------------ 205

Query: 216 IALLTQNIYVHT---TPQYRSPEMI--DLYRCLPINEKSDIWALGVFLYKLLFFTTPFEM 270
            AL T N  + T   +P Y SPE++    Y   P    SD+W+ G+ L+ LL    PF  
Sbjct: 206 -ALQTSNKLLETSCGSPHYASPEIVMGKNYNGGP----SDVWSCGIILFALLTGHLPFND 260

Query: 271 TGQFAIL----HSKYEFPVNKYSSKLINLIIIMLAENPNLRPNIYQVLYH 316
                +L      KY+ P    SS   +LI  +L  +P+ R +I ++L H
Sbjct: 261 DNIKRLLLKVQAGKYQMP-QSVSSGAQDLISRILVVDPDKRISINEILAH 309

>AEL230W [2276] [Homologous to ScYDR477W (SNF1) - SH]
           complement(198401..200227) [1827 bp, 608 aa]
          Length = 608

 Score = 73.6 bits (179), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 80/309 (25%), Positives = 147/309 (47%), Gaps = 54/309 (17%)

Query: 34  KVEVVNYLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGDVACLKRVLVQ-DENGLNEMR 92
           K +V+  L EG F ++ +       +       V LKI +    K+VL + D  G   + 
Sbjct: 38  KYQVIKTLGEGSFGKVKLA------HHVSTGQKVALKIIN----KKVLAKSDMQG--RIE 85

Query: 93  NEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMNQRLSTKLT 152
            E+  ++ L+  P+I++ +D   S+        E+++++E   N+ L DY+ QR   K++
Sbjct: 86  REISYLRLLR-HPHIIKLYDVIKSKD-------EIIMVIEYAGNE-LFDYIVQR--DKMS 134

Query: 153 EAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTSTCFPIVTT 212
           E E  +    +  ++   H   +  +HRD+K EN+L+D   N K+ADFG ++        
Sbjct: 135 ENEARRFFQQIISAVEYCHRHKI--VHRDLKPENLLLDEHLNVKIADFGLSN-------- 184

Query: 213 HQDIALLTQNIYVHT---TPQYRSPEMID--LYRCLPINEKSDIWALGVFLYKLLFFTTP 267
                ++T   ++ T   +P Y +PE+I   LY       + D+W+ GV LY +L    P
Sbjct: 185 -----IMTDGNFLKTSCGSPNYAAPEVISGKLYA----GPEVDVWSSGVILYVMLCRRLP 235

Query: 268 FEMTGQFAILH--SKYEFPVNKYSSK-LINLIIIMLAENPNLRPNIYQVL---YHLCEIL 321
           F+      +    S   + + K+ S+   NLI  ML  NP  R  I++++   +   ++ 
Sbjct: 236 FDDESIPVLFKNISNGVYSIPKFLSQGAANLIKRMLIVNPLNRITIHEIMEDEWFKVDLP 295

Query: 322 NVEVPIEDK 330
           +  VP++ K
Sbjct: 296 DYLVPVDMK 304

>Kwal_56.22693
          Length = 984

 Score = 73.9 bits (180), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 55/195 (28%), Positives = 95/195 (48%), Gaps = 15/195 (7%)

Query: 127 VLLLMELCPNKSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIEN 186
           +  L+E  PN   L  + +  S  L++   V     +  +I  +H+    ++HRDIK EN
Sbjct: 232 LYFLLEYAPNGDFLSVIKKFGS--LSQECAVYYSAQILDAIDYLHH--KGIVHRDIKPEN 287

Query: 187 VLVDAKNNFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMI-DLYRCLPI 245
           +L+D     KL DFG T+       T Q   LL ++     T +Y SPE++ D Y    +
Sbjct: 288 ILLDKDMKVKLTDFG-TARILEKDETTQTFNLLERSKSFVGTAEYVSPELLNDNY----V 342

Query: 246 NEKSDIWALGVFLYKLLFFTTPFEMTGQF----AILHSKYEFPVNKYSSKLINLIIIMLA 301
           + K DIWA G  L++++    PF+ T ++     ++  +Y F    +   + +LI  +L 
Sbjct: 343 DYKCDIWAFGCILFQMIAGKPPFKATNEYLTFQKVMKVQYAFTAG-FPLVIRDLIKKILV 401

Query: 302 ENPNLRPNIYQVLYH 316
           ++P  R +  Q+  H
Sbjct: 402 KSPEQRLDASQIKKH 416

>KLLA0A03806g complement(338807..340615) gi|2181934|emb|CAA61235.1
           Kluyveromyces lactis putative kinase, start by
           similarity
          Length = 602

 Score = 73.6 bits (179), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 82/318 (25%), Positives = 148/318 (46%), Gaps = 54/318 (16%)

Query: 31  GTH--KVEVVNYLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGDVACLKRVLVQ-DENG 87
           G H  K +++  L EG F ++ +   +           V LKI +    K+VL + D  G
Sbjct: 29  GQHIGKYQIIKTLGEGSFGKVKLAYHIS------TGQKVALKIIN----KKVLAKSDMQG 78

Query: 88  LNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMNQRL 147
              +  E+  ++ L+  P+I++ +D   S+        E+++++E   N+ L DY+ QR 
Sbjct: 79  --RIEREISYLRLLR-HPHIIKLYDVIKSKD-------EIIMVIEYAGNE-LFDYIVQR- 126

Query: 148 STKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTSTCF 207
             K+ E E  +    +  ++   H   +  +HRD+K EN+L+D   N K+ADFG ++   
Sbjct: 127 -DKMPEQEARRFFQQIISAVDYCHRHKI--VHRDLKPENLLLDEHLNVKIADFGLSN--- 180

Query: 208 PIVTTHQDIALLTQNIYVHT---TPQYRSPEMIDLYRCLPINEKSDIWALGVFLYKLLFF 264
                     ++T   ++ T   +P Y +PE+I     L    + D+W+ GV LY +L  
Sbjct: 181 ----------IMTDGNFLKTSCGSPNYAAPEVIS--GKLYAGPEVDVWSSGVILYVMLCR 228

Query: 265 TTPFE---MTGQFA-ILHSKYEFPVNKYSSKLINLIIIMLAENPNLRPNIYQVL---YHL 317
             PF+   +   F  I +  Y  P N  S    +LI  ML  NP  R  +++++   +  
Sbjct: 229 RLPFDDESIPVLFKNISNGVYTIP-NFLSQGAASLIKKMLIVNPVNRITVHEIMQDEWFK 287

Query: 318 CEILNVEVPIEDKYAEGA 335
            ++ +  VP E  + E +
Sbjct: 288 VDLPDYLVPAESTHQENS 305

>ACL104C [945] [Homologous to ScYHR102W (KIC1) - SH]
           (157357..160200) [2844 bp, 947 aa]
          Length = 947

 Score = 73.6 bits (179), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 62/235 (26%), Positives = 111/235 (47%), Gaps = 28/235 (11%)

Query: 85  ENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMN 144
           E+ + +++ E++ +  LK  PNI +Y+ S        +   ++ ++ME C   SL   + 
Sbjct: 62  EDEVEDVQKEIQFLASLKQVPNITRYYGSY-------LYDTKLWVIMEYCAGGSLRTLLR 114

Query: 145 QRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTS 204
                K+ E  +  I+  + +++  +H    ++IHRDIK  NVL+  + + KL DFG  +
Sbjct: 115 ---PGKIDEKYLGVIVRKLLIALVYIHK--DNVIHRDIKAANVLITNEGHVKLCDFGVAA 169

Query: 205 TCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGVFLYKLLFF 264
                    Q +A          TP + +PE+I     +  N K+DIW+LG+  Y++   
Sbjct: 170 QLTAANHKRQTMA---------GTPYWMAPEVI--MEGVYYNTKADIWSLGITAYEIATG 218

Query: 265 TTPF-EMTGQFAI-LHSKYEFPV---NKYSSKLINLIIIMLAENPNLRPNIYQVL 314
             P+ ++    A+ L +K + P      YS  L   I + L E+P  RP    +L
Sbjct: 219 NPPYCDVEALRAMQLITKSKPPRLEGRNYSPLLKEFIALCLDEDPEERPTAEDLL 273

>KLLA0F13552g complement(1252906..1256709)
           gi|33386566|emb|CAD87727.1 Kluyveromyces lactis protein
           kinase, start by similarity
          Length = 1267

 Score = 73.9 bits (180), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 64/230 (27%), Positives = 106/230 (46%), Gaps = 39/230 (16%)

Query: 97  VMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMNQRLSTKLTEAEI 156
           ++ KL   PN++  ++   ++        E+ L++E      L DY+  +   KL E+E 
Sbjct: 126 IIMKLISHPNVMGLYEVWENKS-------ELYLVLEYVEGGELFDYLVSK--GKLPESEA 176

Query: 157 VKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKN-NFKLADFGSTSTCFPIVTTHQD 215
           +     +  +++  H    ++ HRD+K EN+L+D K  + K+ADFG              
Sbjct: 177 IHYFKQIVQAVAYCHGF--NICHRDLKPENLLLDKKKRSIKIADFGMA------------ 222

Query: 216 IALLTQNIYVHT---TPQYRSPEMI--DLYRCLPINEKSDIWALGVFLYKLLFFTTPFEM 270
            AL T +  + T   +P Y SPE++    Y   P    SD+W+ G+ L+ LL    PF  
Sbjct: 223 -ALETSDKLLETSCGSPHYASPEIVLGRKYHGSP----SDVWSCGIILFALLTGHLPFND 277

Query: 271 TGQFAIL----HSKYEFPVNKYSSKLINLIIIMLAENPNLRPNIYQVLYH 316
                +L      KY+ P    S +  +LI  +L  +PN R  I Q+L H
Sbjct: 278 DNVKKLLLKVQSGKYQMP-QWLSVEAKDLISRILVVDPNRRITIDQILQH 326

>Scas_660.28
          Length = 623

 Score = 72.8 bits (177), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 67/247 (27%), Positives = 119/247 (48%), Gaps = 50/247 (20%)

Query: 31  GTH--KVEVVNYLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGDVACLKRVLVQ-DENG 87
           G+H    ++V  L EG F ++ +   +           V LKI +    K+VL + D  G
Sbjct: 40  GSHIGNYQIVKTLGEGSFGKVKLAYHMT------TGQKVALKIIN----KKVLAKSDMQG 89

Query: 88  LNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMNQRL 147
              +  E+  ++ L+  P+I++ +D   S+        E++++ME   N+ L DY+ QR 
Sbjct: 90  --RIEREISYLRLLR-HPHIIKLYDVIKSKD-------EIIMVMEYAGNE-LFDYIVQR- 137

Query: 148 STKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTSTCF 207
             K++E E  +    +  ++   H   +  +HRD+K EN+L+D   N K+ADFG ++   
Sbjct: 138 -DKMSEDEARRFFQQIISAVEYCHRHKI--VHRDLKPENLLLDEHLNVKIADFGLSN--- 191

Query: 208 PIVTTHQDIALLTQNIYVHT---TPQYRSPEMID--LYRCLPINEKSDIWALGVFLYKLL 262
                     ++T   ++ T   +P Y +PE+I   LY       + D+W+ GV LY +L
Sbjct: 192 ----------IMTDGNFLKTSCGSPNYAAPEVISGKLYA----GPEVDVWSCGVILYVML 237

Query: 263 FFTTPFE 269
               PF+
Sbjct: 238 CRRLPFD 244

>Scas_458.1
          Length = 367

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 79/312 (25%), Positives = 131/312 (41%), Gaps = 64/312 (20%)

Query: 68  PLKIGDVACLKRVLVQ--DENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGF 125
           P + G +  LKR+     D   ++   NE+   KK  G  +I+   D    ++ DG +  
Sbjct: 55  PFENGPLFVLKRIYCPFGDIESVSAAMNEISYYKKFAGNSHIISCLDYQLHQKYDGSKQI 114

Query: 126 EVLLLMELCPNKSLLDYMNQRL-------STKLTEAEIVKIMYDVALSISQMH------- 171
           +VL         S+ D +N+ L        T + E + +KIM  +   +  +H       
Sbjct: 115 DVLF--PFYHYGSVQDDINRHLLSSSTALGTVIPEKDCIKIMIGLCRGLLPLHDPKLREQ 172

Query: 172 ----------Y----------LP-----------VSLIHRDIKIENVLVDAKNNFKLADF 200
                     Y          LP           V   + +++ + +L+  + N  +AD 
Sbjct: 173 GSPDDMAIMSYSENAPLLLNDLPMELSKDNENENVCFAYYNLRPDLILLSEQGNAIIADL 232

Query: 201 GSTSTCFPI-VTTHQDIAL--LTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGVF 257
            S   CF   +T   +I L    Q I  H T Q+ +PE++ L     I  K DIW+LG  
Sbjct: 233 QS---CFRTNITISTEIQLNRFQQWIEEHCTLQFSAPELLTLKMGDKITAKVDIWSLGCV 289

Query: 258 LYKLLFFTTPFEMTGQ-------FAILHSKYEFPVNK--YSSKLINLIIIMLAENPNLRP 308
           LY ++F  +PFE   Q       + I   KY  P  K  YS ++I+++   L  +P+ RP
Sbjct: 290 LYSMMFGISPFEREEQLNGGVVKYCIKMGKYSIPDTKGTYSQEIIDILNTCLKVDPSERP 349

Query: 309 NIYQVLYHLCEI 320
           ++  +L +L EI
Sbjct: 350 SLNGILNNLQEI 361

>YKL101W (HSL1) [3161] chr11 (248566..253122) Serine/threonine
           protein kinase that genetically interacts with histone
           mutants and negatively regulates Swe1p protein kinase
           [4557 bp, 1518 aa]
          Length = 1518

 Score = 71.6 bits (174), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 65/230 (28%), Positives = 102/230 (44%), Gaps = 39/230 (16%)

Query: 97  VMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMNQRLSTKLTEAEI 156
           V+ KL    N++  F+   ++        E+ L++E      L DY+  +   KL E E 
Sbjct: 166 VIMKLISHTNVMALFEVWENKS-------ELYLVLEYVDGGELFDYLVSK--GKLPEREA 216

Query: 157 VKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKN-NFKLADFGSTSTCFPIVTTHQD 215
           +     +   +S  H    ++ HRD+K EN+L+D KN   K+ADFG  +   P       
Sbjct: 217 IHYFKQIVEGVSYCHSF--NICHRDLKPENLLLDKKNRRIKIADFGMAALELP------- 267

Query: 216 IALLTQNIYVHT---TPQYRSPEMI--DLYRCLPINEKSDIWALGVFLYKLLFFTTPFEM 270
                 N  + T   +P Y SPE++    Y   P    SD+W+ G+ L+ LL    PF  
Sbjct: 268 ------NKLLKTSCGSPHYASPEIVMGRPYHGGP----SDVWSCGIVLFALLTGHLPFND 317

Query: 271 TGQFAIL----HSKYEFPVNKYSSKLINLIIIMLAENPNLRPNIYQVLYH 316
                +L      KY+ P N  SS+  +LI  +L  +P  R    ++L H
Sbjct: 318 DNIKKLLLKVQSGKYQMPSN-LSSEARDLISKILVIDPEKRITTQEILKH 366

>Kwal_56.24091
          Length = 381

 Score = 70.1 bits (170), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 59/199 (29%), Positives = 92/199 (46%), Gaps = 25/199 (12%)

Query: 71  IGDVACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLL 130
           I  +  +K+  +   N   + R EVE+   LK  PN+ + +      +R       V LL
Sbjct: 148 ICALKAMKKSEIVQYNVQKQFRREVEIQSSLK-HPNLTRLYGYFHDEKR-------VYLL 199

Query: 131 MELCPNKSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVD 190
           ME   N  L  Y + R      +      ++ +A +++ MH    +++HRDIK EN+L+ 
Sbjct: 200 MEYLVNGEL--YKHLRSHGPFNDITASHFVHQMADALNYMH--SKNILHRDIKPENILLG 255

Query: 191 AKNNFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSD 250
            +N  KL DFG + +    V   +   L         T  Y SPE+I   +    + K D
Sbjct: 256 FQNTLKLTDFGWSVSN---VGNSKRKTLC-------GTMDYLSPELI---KSREYDNKVD 302

Query: 251 IWALGVFLYKLLFFTTPFE 269
           +WALGV  Y+LL  + PFE
Sbjct: 303 VWALGVLTYELLVGSPPFE 321

>YDR490C (PKH1) [1306] chr4 complement(1431956..1434256)
           Serine/threonine protein kinase, functions similarly to
           mammalian 3-phosphoinositide-dependent protein kinase,
           phosphorylates and activates Ypk1p, required for
           endocytosis [2301 bp, 766 aa]
          Length = 766

 Score = 71.2 bits (173), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 75/322 (23%), Positives = 134/322 (41%), Gaps = 39/322 (12%)

Query: 6   GTSRSVSAMGHPAVERYTPGHIVCVGTHKVEVVNYLAEGGFAQIYVVKFLEYLNEFDNTA 65
           G ++ V  +  PA    T  H+V +G    +    L +G ++ + +            TA
Sbjct: 97  GAAKIVKDVVDPATGELT-KHVVKMGIKDFKFGEQLGDGSYSSVVLA-----------TA 144

Query: 66  SVPLKIGDVACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGF 125
               K   V  L +  +  +  +  +  E   ++KL G   I + F +            
Sbjct: 145 RDSGKKYAVKVLSKEYLIRQKKVKYVTVEKLALQKLNGTKGIFKLFFTFQDEA------- 197

Query: 126 EVLLLMELCPNKSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIE 185
            +  L+E  P+   L  + +  S  L E         +  ++  +H   + +IHRDIK E
Sbjct: 198 SLYFLLEYAPHGDFLGLIKKYGS--LNETCARYYASQIIDAVDSLHN--IGIIHRDIKPE 253

Query: 186 NVLVDAKNNFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHT-----TPQYRSPEMI-DL 239
           N+L+D     KL DFG T+   P   ++        ++Y  +     T +Y SPE++ D 
Sbjct: 254 NILLDKNMKVKLTDFG-TAKILPEEPSNTADGKPYFDLYAKSKSFVGTAEYVSPELLNDN 312

Query: 240 YRCLPINEKSDIWALGVFLYKLLFFTTPFEMTGQF----AILHSKYEFPVNKYSSKLINL 295
           Y     + + DIWA G  LY++L    PF+   ++     ++  +Y F    +   + +L
Sbjct: 313 Y----TDSRCDIWAFGCILYQMLAGKPPFKAANEYLTFQKVMKIQYAFTAG-FPQIVKDL 367

Query: 296 IIIMLAENPNLRPNIYQVLYHL 317
           +  +L  +PN R  I Q+  HL
Sbjct: 368 VKKLLVRDPNDRLTIKQIKAHL 389

>Scas_493.2
          Length = 1117

 Score = 71.2 bits (173), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 63/237 (26%), Positives = 111/237 (46%), Gaps = 39/237 (16%)

Query: 91  MRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMNQRLSTK 150
           +  E+ +MK L+ A N++  +D   +          + +++E      L + + ++    
Sbjct: 81  IEREIIIMKLLRHA-NVLSLYDVWET-------NSNLYMILEYAEKGELFNLLVEK--GP 130

Query: 151 LTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTSTCFPIV 210
           L E E V+    + + IS  H L   ++HRD+K EN+L+D K N K+ADFG         
Sbjct: 131 LPEKEAVRFFRQIIIGISYCHAL--GIVHRDLKPENLLLDHKFNIKIADFGMA------- 181

Query: 211 TTHQDIALLTQNIYVHT---TPQYRSPEMIDLYRCLPINE-KSDIWALGVFLYKLLFFTT 266
                 AL T++  + T   +P Y +PE++     +P +  +SD+W+ GV L+ LL    
Sbjct: 182 ------ALETEDKLLETSCGSPHYAAPEIVS---GIPYHGFESDVWSCGVILFALLTGRL 232

Query: 267 PF-EMTGQ-----FAILHSKYEFP-VNKYSSKLINLIIIMLAENPNLRPNIYQVLYH 316
           PF E  G        +   ++E P  ++ S    +LI  +L  +P  R    ++L H
Sbjct: 233 PFDEEDGNIRNLLLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKH 289

>Kwal_47.18233
          Length = 598

 Score = 70.9 bits (172), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 78/291 (26%), Positives = 137/291 (47%), Gaps = 53/291 (18%)

Query: 34  KVEVVNYLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGDVACLKRVLVQ-DENGLNEMR 92
           K +++  L EG F ++ +   +           V LKI +    K+VL + D  G   + 
Sbjct: 30  KYQIIKTLGEGSFGKVKLAYHVT------TGQKVALKIIN----KKVLAKSDMQG--RIE 77

Query: 93  NEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMNQRLSTKLT 152
            E+  ++ L+  P+I++ +D   S+        E+++++E   N+ L DY+ QR   K++
Sbjct: 78  REISYLRLLR-HPHIIKLYDVVKSKD-------EIVMVIEYAGNE-LFDYIVQR--DKMS 126

Query: 153 EAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTSTCFPIVTT 212
           E E  +    +  ++   H   +  +HRD+K EN+L+D   N K+ADFG ++        
Sbjct: 127 ENEARRFFQQIISAVEYCHRHKI--VHRDLKPENLLLDEHLNVKIADFGLSN-------- 176

Query: 213 HQDIALLTQNIYVHT---TPQYRSPEMID--LYRCLPINEKSDIWALGVFLYKLLFFTTP 267
                ++T   ++ T   +P Y +PE+I   LY       + D+W+ GV LY +L    P
Sbjct: 177 -----IMTDGNFLRTSCGSPNYAAPEVISGKLYA----GPEVDVWSSGVILYVMLCRRLP 227

Query: 268 FE---MTGQFA-ILHSKYEFPVNKYSSKLINLIIIMLAENPNLRPNIYQVL 314
           F+   +   F  I +  Y  P    S    NLI  ML  NP  R  I++++
Sbjct: 228 FDDESIPVLFKNISNGIYTLP-KFLSPGAANLIKRMLIVNPLNRITIHEIM 277

>CAGL0K08514g complement(853314..857783) similar to sp|P34244
           Saccharomyces cerevisiae YKL101w
           serine/threonine-protein kinase, hypothetical start
          Length = 1489

 Score = 70.9 bits (172), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 63/230 (27%), Positives = 102/230 (44%), Gaps = 39/230 (16%)

Query: 97  VMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMNQRLSTKLTEAEI 156
           V+ KL   PN++   +   ++        E+ L++E      L DY+  +   KL+E E 
Sbjct: 178 VIMKLISHPNVMGLLEVWENKS-------ELYLVLEYVDGGELFDYLVSK--GKLSEPEA 228

Query: 157 VKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNN-FKLADFGSTSTCFPIVTTHQD 215
           V     +   +S  H    ++ HRD+K EN+L+D KN   K+ADFG  +   P       
Sbjct: 229 VHYFTQIIQGVSYCHSF--NICHRDLKPENLLLDKKNKVIKIADFGMAALELP------- 279

Query: 216 IALLTQNIYVHT---TPQYRSPEMI--DLYRCLPINEKSDIWALGVFLYKLLFFTTPFEM 270
                 N  + T   +P Y SPE++    Y   P    SD+W+ G+ L+ LL    PF  
Sbjct: 280 ------NKLLETSCGSPHYASPEIVMGKPYHGGP----SDVWSCGIILFALLTGHLPFND 329

Query: 271 TGQFAIL----HSKYEFPVNKYSSKLINLIIIMLAENPNLRPNIYQVLYH 316
                +L      +++ P    ++   +LI  +L  NP  R  I ++L H
Sbjct: 330 DNIKKLLLKVQAGRFQLPP-YLTNDAKDLITRILVTNPEKRLTINEILNH 378

>CAGL0G04609g complement(437162..440059) similar to sp|Q12236
           Saccharomyces cerevisiae YOL100w PKH2, hypothetical
           start
          Length = 965

 Score = 70.9 bits (172), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 72/310 (23%), Positives = 140/310 (45%), Gaps = 46/310 (14%)

Query: 27  IVCVGTHKVEVVNYLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGDVACLKRVLVQDEN 86
           I+  G    +  + L +G ++Q+++       ++ D++ +  +K+ +    K  L++ + 
Sbjct: 110 IIRKGIKDFKFGDMLGDGSYSQVFLAT-----SKTDSSKTYAVKVLN----KEYLIKQKK 160

Query: 87  G--LNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMN 144
              +N  +  ++ +K + G  N+   F   A+          +  L+E  PN   L  + 
Sbjct: 161 VKYVNIEKTALQNLKSVTGVINLSFTFQDEAN----------LYFLLEYAPNGDFLSLI- 209

Query: 145 QRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTS 204
           ++  T L E   +     +  +I  MH     +IHRDIK EN+L+D     KL DFG+  
Sbjct: 210 KKFGT-LNEECTIYYSAQIIDAIGSMHSH--GIIHRDIKPENILLDGNMKIKLTDFGTAK 266

Query: 205 TCFPIVTTHQD------IALLTQNIYVHTTPQYRSPEMI-DLYRCLPINEKSDIWALGVF 257
               ++    D        LLT++     T +Y SPE++ D Y     + K DIWA G  
Sbjct: 267 ----LLQKKSDKNGKPHYNLLTRSSSFVGTAEYVSPELLSDNY----TDYKCDIWAFGCL 318

Query: 258 LYKLLFFTTPFEMTGQF----AILHSKYEFPVNKYSSKLINLIIIMLAENPNLRPNIYQV 313
           +Y+++    PF+ T ++     ++  ++ F    + + + +L+  +L + P  R  I Q+
Sbjct: 319 VYQMIAGKPPFKATNEYLTFQKVMKVQFAFTAG-FPTIIRDLVKNILVKQPEKRLTIPQI 377

Query: 314 LYHLCEILNV 323
             H C   N+
Sbjct: 378 KEH-CLFENI 386

>CAGL0E05720g 569028..570104 similar to sp|P38991 Saccharomyces
           cerevisiae YPL209c IPL1 ser/thr protein kinase, start by
           similarity
          Length = 358

 Score = 68.9 bits (167), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 74/273 (27%), Positives = 119/273 (43%), Gaps = 50/273 (18%)

Query: 36  EVVNYLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGDVACLKRVLVQDE----NGLNEM 91
           EV   L +G F ++Y V+                K     C  + + ++E    N L ++
Sbjct: 101 EVGRKLGKGKFGKVYCVRH---------------KKSGFICALKAIEKNEILQFNLLKQL 145

Query: 92  RNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMNQRLSTKL 151
           + EV++   +   PNI++ +      +R       V LLME   N  L  Y + + +   
Sbjct: 146 KREVDIQLGM-DHPNIIKLYAHFHDEKR-------VYLLMEHSINGEL--YKSLKNNGPF 195

Query: 152 TEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTSTCFPIVT 211
            +      +Y +A ++  MH     +IHRD+K ENVL+   N  KLADFG  S   P  +
Sbjct: 196 NDVLASHYIYQIADALHYMH--KKRIIHRDVKPENVLIGFDNVVKLADFG-WSILNPEGS 252

Query: 212 THQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGVFLYKLLFFTTPFEMT 271
             + +           T  Y SPEMI        +E+ D+WALGV  Y+L+    PFE  
Sbjct: 253 KRKTLC---------GTIDYLSPEMITPRE---YDEQVDVWALGVLAYELVVGVPPFEEN 300

Query: 272 GQFA----ILHSKYEFP--VNKYSSKLINLIII 298
            +      IL     FP  ++K +  LI+ +++
Sbjct: 301 SKELTYKRILKCDLNFPESISKDAKDLISKLLV 333

>AGR058W [4368] [Homologous to ScYLR096W (KIN2) - SH; ScYDR122W
           (KIN1) - SH] complement(823632..826847) [3216 bp, 1071
           aa]
          Length = 1071

 Score = 70.9 bits (172), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 53/193 (27%), Positives = 92/193 (47%), Gaps = 23/193 (11%)

Query: 129 LLMELCPNKSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVL 188
           +L E      LLDY+ Q  S  L E    K    +A ++  +H    +++HRD+KIEN++
Sbjct: 157 MLFEYVSGGQLLDYIIQHGS--LRERHARKFARGIASALQYLHL--NNIVHRDLKIENIM 212

Query: 189 VDAKNNFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEK 248
           + +    ++ DFG ++   P    H        ++Y      + +PE++  +       +
Sbjct: 213 ISSSGEIRIIDFGLSNMYDPKKQLHT----FCGSLY------FAAPELLKAHPY--TGPE 260

Query: 249 SDIWALGVFLYKLLFFTTPFEMTGQFAILH-----SKYEFPVNKYSSKLINLIIIMLAEN 303
            DIW+ GV LY L+    PF+     ++LH      K E+P    S  +I+L+  ML  +
Sbjct: 261 VDIWSFGVVLYVLVCGKVPFD-DENASVLHEKIKQGKVEYP-QHLSIDVISLLSKMLVVD 318

Query: 304 PNLRPNIYQVLYH 316
           P  R  + QV++H
Sbjct: 319 PYKRATLKQVVHH 331

>Kwal_56.23717
          Length = 858

 Score = 70.5 bits (171), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 54/193 (27%), Positives = 92/193 (47%), Gaps = 23/193 (11%)

Query: 129 LLMELCPNKSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVL 188
           +L E      LLDY+ Q  S  L E    K    +A ++  +H    +++HRD+KIEN++
Sbjct: 10  MLFEYVSGGQLLDYIIQHGS--LRERSARKFARGIASALQYLHM--NNIVHRDLKIENIM 65

Query: 189 VDAKNNFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEK 248
           +      K+ DFG ++   P    H        ++Y      + +PE+  L  C     +
Sbjct: 66  ISTSGEIKIIDFGLSNMYNPKKQLHT----FCGSLY------FAAPEL--LKACPYTGPE 113

Query: 249 SDIWALGVFLYKLLFFTTPFEMTGQFAILH-----SKYEFPVNKYSSKLINLIIIMLAEN 303
            D+W+ GV L+ L+    PF+     ++LH      K E+P    S ++I+L+  ML  +
Sbjct: 114 VDVWSFGVVLFVLVCGKVPFDDENS-SVLHEKIKQGKVEYP-QHLSIEVISLLSKMLVVD 171

Query: 304 PNLRPNIYQVLYH 316
           P  R ++ QV+ H
Sbjct: 172 PTKRASLKQVVNH 184

>YNR047W (YNR047W) [4630] chr14 (708522..711203) Serine/threonine
           protein kinase of unknown function [2682 bp, 893 aa]
          Length = 893

 Score = 70.5 bits (171), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 83/347 (23%), Positives = 142/347 (40%), Gaps = 64/347 (18%)

Query: 28  VCVGTHKVEVVNYLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGDVACLKRVLVQDE-- 85
           + VG    E +  L +G   ++++V+                K   V  LK VL +DE  
Sbjct: 489 IMVGPQSFEKIRLLGQGDVGKVFLVR--------------EKKTNRVYALK-VLSKDEMI 533

Query: 86  --NGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYM 143
             N +  +  E E++      P IV  + S  S          + L ME C        +
Sbjct: 534 KRNKIKRVLTEQEILA-TSNHPFIVTLYHSFQSEDY-------LYLCMEYCMGGEFFRAL 585

Query: 144 NQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFG-- 201
             R +  + E +      +V  ++  +H L    I+RD+K EN+L+    +  L+DF   
Sbjct: 586 QTRKTKCICEDDARFYASEVTAALEYLHLL--GFIYRDLKPENILLHQSGHIMLSDFDLS 643

Query: 202 --STSTCFPIV-----TTHQDIALLTQNIYVHT---TPQYRSPEMIDLYRCLPINEKSDI 251
             +  +  P+V     +T  D  + +     ++   T +Y +PE+I   R        D 
Sbjct: 644 IQAKDSKVPVVKGSAQSTLVDTKICSDGFRTNSFVGTEEYIAPEVI---RGNGHTAAVDW 700

Query: 252 WALGVFLYKLLFFTTPFE---MTGQFA-ILHSKYEFPVNKYSSKLI-NLIIIMLAENPNL 306
           W LG+ +Y++LF  TPF+       F  IL ++  FP N   S+   +LI  +L +N + 
Sbjct: 701 WTLGILIYEMLFGFTPFKGDNTNETFTNILKNEVSFPNNNEISRTCKDLIKKLLTKNESK 760

Query: 307 R-------------PNIYQVLYHLCEILNVEVPIEDKYAEGAYNFSK 340
           R             P   +V + L  + N E P+    +E  Y+F+K
Sbjct: 761 RLGCKMGAADVKKHPFFKKVQWSL--LRNQEPPLIPVLSEDGYDFAK 805

>Scas_598.6
          Length = 790

 Score = 70.1 bits (170), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 59/239 (24%), Positives = 106/239 (44%), Gaps = 31/239 (12%)

Query: 36  EVVNYLAEGGFAQIYVVKFLEYL-NEFDNTASVPLKIGDVACLKRVLVQDENGLNEMRNE 94
           +++    +G    +Y+ + +     EFD T  V    GD   +K++++  +     + NE
Sbjct: 503 QMIEKAGQGASGSVYLAERIAIPPGEFDETPEV----GDKVAIKQMILSKQPRKELIVNE 558

Query: 95  VEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMNQRLST----- 149
           + VMK  +   NIV + ++      D      + ++ME     SL D +    +T     
Sbjct: 559 ILVMKDSRHK-NIVNFLEAYLKTEDD------LWVVMEFMEGGSLTDIIENSPATGSSSS 611

Query: 150 KLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTSTCFPI 209
            LTE +I  I+ +    +  +H     +IHRDIK +NVL+D     K+ DFG    C  +
Sbjct: 612 PLTEPQIAYIVRETCQGLKFLHD--KHIIHRDIKSDNVLLDNNARVKITDFG---FCAKL 666

Query: 210 VTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGVFLYKLLFFTTPF 268
                  A +        TP + +PE++        +EK D+W+LG+   ++L    P+
Sbjct: 667 TDQRSKRATMV------GTPYWMAPEVVKQRE---YDEKVDVWSLGIMTIEMLESEPPY 716

>YDR477W (SNF1) [1293] chr4 (1412361..1414262) Serine/threonine
           protein kinase essential for derepression of
           glucose-repressed genes, acts in concert with Snf4p,
           involved in aging [1902 bp, 633 aa]
          Length = 633

 Score = 69.3 bits (168), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 78/291 (26%), Positives = 137/291 (47%), Gaps = 57/291 (19%)

Query: 36  EVVNYLAEGGFAQIYVVKFLEYLNEFDNTAS--VPLKIGDVACLKRVLVQ-DENGLNEMR 92
           ++V  L EG F ++ +         +  T    V LKI +    K+VL + D  G   + 
Sbjct: 56  QIVKTLGEGSFGKVKLA--------YHTTTGQKVALKIIN----KKVLAKSDMQG--RIE 101

Query: 93  NEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMNQRLSTKLT 152
            E+  ++ L+  P+I++ +D   S+        E+++++E   N+ L DY+ QR   K++
Sbjct: 102 REISYLRLLR-HPHIIKLYDVIKSKD-------EIIMVIEYAGNE-LFDYIVQR--DKMS 150

Query: 153 EAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTSTCFPIVTT 212
           E E  +    +  ++   H   +  +HRD+K EN+L+D   N K+ADFG ++        
Sbjct: 151 EQEARRFFQQIISAVEYCHRHKI--VHRDLKPENLLLDEHLNVKIADFGLSN-------- 200

Query: 213 HQDIALLTQNIYVHT---TPQYRSPEMID--LYRCLPINEKSDIWALGVFLYKLLFFTTP 267
                ++T   ++ T   +P Y +PE+I   LY       + D+W+ GV LY +L    P
Sbjct: 201 -----IMTDGNFLKTSCGSPNYAAPEVISGKLYA----GPEVDVWSCGVILYVMLCRRLP 251

Query: 268 FE---MTGQFA-ILHSKYEFPVNKYSSKLINLIIIMLAENPNLRPNIYQVL 314
           F+   +   F  I +  Y  P    S     LI  ML  NP  R +I++++
Sbjct: 252 FDDESIPVLFKNISNGVYTLP-KFLSPGAAGLIKRMLIVNPLNRISIHEIM 301

>KLLA0C12485g 1060167..1062944 weakly similar to sp|Q12236
           Saccharomyces cerevisiae YOL100w PKH2, start by
           similarity
          Length = 925

 Score = 69.7 bits (169), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 63/238 (26%), Positives = 111/238 (46%), Gaps = 32/238 (13%)

Query: 88  LNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMNQRL 147
           +N  +N ++ +K  KG  ++   F   +S          +  L+E  PN  LL  M +  
Sbjct: 200 VNIEKNTLQRLKNTKGIISLYFTFQDESS----------LYFLLEYAPNGDLLSLMRKHG 249

Query: 148 ST--KLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTST 205
           S   K T+    +I+  +      MH     +IHRD+K EN+L+D     KL DFG+   
Sbjct: 250 SVNEKCTQYYAAQIIDALGF----MH--DKGVIHRDLKPENILLDVDMKVKLTDFGTARL 303

Query: 206 CFPIVTTHQDIA--LLTQNIYVHTTPQYRSPEMI-DLYRCLPINEKSDIWALGVFLYKLL 262
                T+  D+   LLT++     T +Y SPE++ D Y    ++ + DIWA G  L++++
Sbjct: 304 L--DSTSEDDLKYDLLTRSNSFVGTAEYVSPELLNDNY----VDFRCDIWAFGCILFQMI 357

Query: 263 FFTTPFEMTGQF----AILHSKYEFPVNKYSSKLINLIIIMLAENPNLRPNIYQVLYH 316
               PF+   ++     ++  ++ F    +   + +L+  +L +NP  R  I Q+  H
Sbjct: 358 AGKPPFKANNEYLTFQKVMKVQFAFTAG-FPMTVRDLVKNILIKNPERRLLINQIKAH 414

>CAGL0I07513g 721775..725005 similar to sp|Q12236 Saccharomyces
           cerevisiae YOL100w PKH2, start by similarity
          Length = 1076

 Score = 69.7 bits (169), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 56/200 (28%), Positives = 92/200 (46%), Gaps = 22/200 (11%)

Query: 127 VLLLMELCPNKSLLDYMNQ--RLSTKLTEAEIVKIMYDVALSISQMHYL-PVSLIHRDIK 183
           +  L+E  PN   L  M +   LS   T        Y  A  I  + YL    +IHRDIK
Sbjct: 256 LYFLLEYAPNGDFLSVMKKYGSLSEDCTR-------YYSAQIIDGIKYLHSKGIIHRDIK 308

Query: 184 IENVLVDAKNNFKLADFGSTSTCFPIVTTHQ--DIALLTQNIYVHTTPQYRSPEMI-DLY 240
            EN+L+D     K+ DFG+     P        +  LLT++     T +Y SPE++ D Y
Sbjct: 309 PENILLDKDMKVKITDFGTAKILEPKNEDEDNPEFNLLTRSKSFVGTAEYVSPELLNDSY 368

Query: 241 RCLPINEKSDIWALGVFLYKLLFFTTPFEMTGQF----AILHSKYEFPVNKYSSKLINLI 296
               ++ + DIWA G  +++++    PF+ T ++     ++  +Y F    +   + +L+
Sbjct: 369 ----VDARCDIWAFGCMVFQMIAGKPPFKATNEYLTFQKVMKVQYAFTAG-FPVVVRDLV 423

Query: 297 IIMLAENPNLRPNIYQVLYH 316
             +L + P  R  I Q+  H
Sbjct: 424 KRILLKVPEQRLTIPQIEKH 443

>Kwal_47.17263
          Length = 1127

 Score = 69.7 bits (169), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 77/308 (25%), Positives = 129/308 (41%), Gaps = 59/308 (19%)

Query: 83  QDENGLNEMRNEVEVMKKL--KGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLL 140
           ++ NG ++++ E+ +MKK   +    +V+  D + SR+        + L++E C    + 
Sbjct: 150 KNTNGSDKIKREIAIMKKCHHEHVVKLVEVLDDSTSRK--------IYLVLEYCSKGEVK 201

Query: 141 DYMNQRLSTK------LTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNN 194
                +L T+      LT     +I   V L +  +HY    +IHRDIK  N+L+     
Sbjct: 202 WCPGDQLETEARGPPLLTFQRAREIFRGVVLGLEYLHYQ--GIIHRDIKPANLLISESGT 259

Query: 195 FKLADFGSTSTCFPIVTTHQDIALLTQNIYVHT--TPQYRSPEMIDLY----RCLP---- 244
            K++DFG     F    +      L +     T  TP + +PE+   +    R  P    
Sbjct: 260 VKISDFG---VSFAASKSGAGYGSLDELELAKTAGTPAFFAPEICLGHEASERFAPDRPS 316

Query: 245 ------INEKSDIWALGVFLYKLLFFTTPF----------EMTGQFAILHSKYEFPVNKY 288
                 I+   DIWA+GV L+ LLF   PF          ++  Q  +L +  E   N  
Sbjct: 317 SDHGSIISYNIDIWAIGVTLHCLLFGMLPFFSEFELELFDKIINQELVLKTYEEMASNGI 376

Query: 289 SSKLIN---------LIIIMLAENPNLRPNIYQVLYH--LCEILNVEVPIEDKYAEGAYN 337
            SK+ N         L+  +L +NP  R  I ++  H  +C     +V  ++     A N
Sbjct: 377 -SKISNQEEYEAAKDLLGRLLTKNPFKRIKIAEIKKHPFVCWDFEHDVTSDNNSGCSAGN 435

Query: 338 FSKYTQFQ 345
            S+  +FQ
Sbjct: 436 SSEKLKFQ 443

>CAGL0C03509g complement(350846..353533) similar to sp|P53739
           Saccharomyces cerevisiae YNR047w or sp|P25341
           Saccharomyces cerevisiae YCR091w KIN82, hypothetical
           start
          Length = 895

 Score = 69.3 bits (168), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 86/355 (24%), Positives = 144/355 (40%), Gaps = 66/355 (18%)

Query: 28  VCVGTHKVEVVNYLAEGGFAQIYVVK-----FLEYLNEFDNTASVPLKIGDVACLKRVLV 82
           + VG    E +  L +G   ++Y+VK      L  L  F  +  +  K      +KR+L 
Sbjct: 490 ITVGPQSFEKIRLLGQGDVGKVYLVKEKRTNRLYALKIFSKSEMIKRK-----KIKRILA 544

Query: 83  QDENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDY 142
           + E            +      P +V  + S  S          + L ME C        
Sbjct: 545 EQE------------ILATSNHPFVVTLYHSFQSEDY-------LYLCMEYCMGGEFFRA 585

Query: 143 MNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFG- 201
           +  R S  ++E +      +V  ++  +H L    I+RD+K EN+L+    +  L+DF  
Sbjct: 586 LQTRKSKCISEEDAKFYASEVTAALEYLHLL--GFIYRDLKPENILLHQSGHIMLSDFDL 643

Query: 202 ---STSTCFPIV-----TTHQDIALLTQNIYVHT---TPQYRSPEMIDLYRCLPINEKSD 250
              +     P+V     +T  D  + +     ++   T +Y +PE+I   R        D
Sbjct: 644 SIQAKDAKVPVVKGNAQSTVVDTKICSDGFRTNSFVGTEEYIAPEVI---RGNGHTAAVD 700

Query: 251 IWALGVFLYKLLFFTTPF--EMTGQ-FA-ILHSKYEFP-VNKYSSKLINLIIIMLAENPN 305
            W LG+ +Y++LF  TPF  E T + F+ IL     FP  N+ S    +LI  +L +N +
Sbjct: 701 WWTLGILIYEMLFGFTPFKGENTNETFSNILKKDVTFPNNNEVSRNCKDLIKKLLIKNES 760

Query: 306 LR-------------PNIYQVLYHLCEILNVEVPIEDKYAEGAYNFSKYTQFQNK 347
            R             P   +V + L  + N E P+     E  Y+F+K +  +NK
Sbjct: 761 KRLGSKMGAADIKKHPFFKKVNWTL--LRNQEPPLIPVLTENGYDFTKLSSNKNK 813

>CAGL0M08910g complement(887703..889541) highly similar to sp|Q00372
           Saccharomyces cerevisiae YDR477w carbon catabolite
           derepressing ser/thr protein kinase, hypothetical start
          Length = 612

 Score = 68.9 bits (167), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 77/289 (26%), Positives = 137/289 (47%), Gaps = 53/289 (18%)

Query: 36  EVVNYLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGDVACLKRVLVQ-DENGLNEMRNE 94
           ++V  L EG F ++ +   +           V LKI +    K+VL + D  G   +  E
Sbjct: 40  QIVKTLGEGSFGKVKLAYHVT------TGQKVALKIIN----KKVLAKSDMQG--RIERE 87

Query: 95  VEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMNQRLSTKLTEA 154
           +  ++ L+  P+I++ +D   S+        E+++++E   N+ L DY+ QR   K++E 
Sbjct: 88  ISYLRLLR-HPHIIKLYDVIKSKD-------EIIMVIEYAGNE-LFDYIVQR--NKMSEQ 136

Query: 155 EIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTSTCFPIVTTHQ 214
           E  +    +  ++   H   +  +HRD+K EN+L+D   N K+ADFG ++          
Sbjct: 137 EARRFFQQIISAVEYCHRHKI--VHRDLKPENLLLDEHLNVKIADFGLSN---------- 184

Query: 215 DIALLTQNIYVHT---TPQYRSPEMID--LYRCLPINEKSDIWALGVFLYKLLFFTTPFE 269
              ++T   ++ T   +P Y +PE+I   LY       + D+W+ GV LY +L    PF+
Sbjct: 185 ---IMTDGNFLKTSCGSPNYAAPEVISGKLYA----GPEVDVWSCGVILYVMLCRRLPFD 237

Query: 270 ---MTGQFA-ILHSKYEFPVNKYSSKLINLIIIMLAENPNLRPNIYQVL 314
              +   F  I +  Y  P    S    +LI  ML  NP  R +I++++
Sbjct: 238 DESIPVLFKNISNGVYTLP-KFLSPGASDLIKRMLIVNPLNRISIHEIM 285

>YDL028C (MPS1) [834] chr4 complement(400994..403288)
           Multi-functional serine/threonine/tyrosine protein
           kinase involved in mitotic checkpoint, spindle pole body
           duplication in meiosis and mitosis, and proper
           chromosome segregation in meiosis [2295 bp, 764 aa]
          Length = 764

 Score = 68.9 bits (167), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 78/318 (24%), Positives = 134/318 (42%), Gaps = 66/318 (20%)

Query: 26  HIVCVGTHKVEVVNYLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGD-VACLKRVLVQ- 83
           +I+ V   + E +  L  GG +++Y VK                  G+ V  LKRV    
Sbjct: 431 NIITVNDSQYEKIELLGRGGSSRVYKVK----------------GSGNRVYALKRVSFDA 474

Query: 84  -DENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDY 142
            D++ ++  + E+E+++KLK    ++Q  D       DG+    + L+ME C +  L   
Sbjct: 475 FDDSSIDGFKGEIELLEKLKDQKRVIQLLDYEMG---DGL----LYLIME-CGDHDLSQI 526

Query: 143 MNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGS 202
           +NQR    L    +     ++ L I  +H     ++H D+K  N ++  K   K+ DFG 
Sbjct: 527 LNQRSGMPLDFNFVRFYTKEMLLCIKVVH--DAGIVHSDLKPANFVL-VKGILKIIDFGI 583

Query: 203 TSTCFPIVTTHQDIALLTQNIYVHT---TPQYRSPEMIDLYRC------------LPINE 247
            +     V  H      T NIY  T   TP Y +PE +                   +  
Sbjct: 584 ANA----VPEH------TVNIYRETQIGTPNYMAPEALVAMNYTQNSENQHEGNKWKVGR 633

Query: 248 KSDIWALGVFLYKLLFFTTPF-EMTGQ---FAILHSKYEFPVNKYSS-------KLINLI 296
            SD+W+ G  +Y++++   P+    GQ    AI++   + P  +++S         I L+
Sbjct: 634 PSDMWSCGCIIYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEHTSNNEKIPKSAIELM 693

Query: 297 IIMLAENPNLRPNIYQVL 314
              L  NP+ R  + +VL
Sbjct: 694 KACLYRNPDKRWTVDKVL 711

>CAGL0M11396g 1120559..1124137 similar to sp|P13186 Saccharomyces
           cerevisiae YLR096w KIN2 ser/thr protein kinase,
           hypothetical start
          Length = 1192

 Score = 68.9 bits (167), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 52/193 (26%), Positives = 95/193 (49%), Gaps = 23/193 (11%)

Query: 129 LLMELCPNKSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVL 188
           +L E      LLDY+ Q  S  L E    K    VA ++  +H    +++HRD+KIEN++
Sbjct: 209 MLFEYVAGGQLLDYIIQHGS--LREHHARKFARGVASALQYLHA--NNIVHRDLKIENIM 264

Query: 189 VDAKNNFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEK 248
           +      K+ DFG ++    +  T + +     ++Y      + +PE++  +       +
Sbjct: 265 ISNSGEIKIIDFGLSN----VYDTRKQLHTFCGSLY------FAAPELLKAHPY--TGPE 312

Query: 249 SDIWALGVFLYKLLFFTTPFEMTGQFAILH-----SKYEFPVNKYSSKLINLIIIMLAEN 303
            D+W+ GV LY L+    PF+     ++LH      K E+P    S ++++L+  ML  +
Sbjct: 313 VDVWSFGVVLYVLVCGKVPFDDENS-SVLHEKIKRGKVEYP-QHLSIEVMSLLSKMLVVD 370

Query: 304 PNLRPNIYQVLYH 316
           P+ R ++ QV+ H
Sbjct: 371 PSRRASLKQVVEH 383

>AFR377C [3569] [Homologous to ScYDR466W - SH] (1116595..1118775)
           [2181 bp, 726 aa]
          Length = 726

 Score = 68.2 bits (165), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 56/197 (28%), Positives = 91/197 (46%), Gaps = 21/197 (10%)

Query: 127 VLLLMELCPNKSLLDYMN-QRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIE 185
           +  +M+L P   LL  +  QR+    +EA     M  +  ++  +H + V  IHRD+K E
Sbjct: 86  LYFVMDLAPGGELLQLLRRQRV---FSEAWARHYMCQLVDTVEYIHSMGV--IHRDLKPE 140

Query: 186 NVLVDAKNNFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPI 245
           NVL+D +    +ADFG+  T              T  +    T +Y SPE++   +    
Sbjct: 141 NVLLDKEGRLMIADFGAAYTVGQSDAGSDGDKPATSFV---GTAEYVSPELLLENKSY-- 195

Query: 246 NEKSDIWALGVFLYKLLFFTTPF------EMTGQFAILHSKYEFPVNKYSSKLINLIIIM 299
              SD+WALG  LY+ L  T PF      E   Q   L   +  P N  ++ L++ I+++
Sbjct: 196 -YSSDVWALGCMLYQFLQGTPPFRGQNEMETFEQIVNLDYTWRIPANPLAAGLVSKILVL 254

Query: 300 LAENPNLRPNIYQVLYH 316
              +P+ R  + Q+  H
Sbjct: 255 ---DPSQRYTLEQIKKH 268

>Scas_502.2
          Length = 1116

 Score = 68.6 bits (166), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 56/197 (28%), Positives = 94/197 (47%), Gaps = 19/197 (9%)

Query: 127 VLLLMELCPNKSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIEN 186
           +  L+E  PN  LL  M +  S  L E         +  +I  MH     +IHRDIK EN
Sbjct: 248 LYFLLEYAPNGDLLSLMKKFGS--LNEECCCYYGAQIIDAIKFMHS--KGIIHRDIKPEN 303

Query: 187 VLVDAKNNFKLADFGSTSTC--FPIVTTHQDIALLTQNIYVHTTPQYRSPEMI-DLYRCL 243
           +L+D     K+ DFG+       P  T++    LLT++     T +Y SPE++ D Y   
Sbjct: 304 ILLDKDMKVKITDFGTAKILDNKPPGTSYD---LLTRSKSFVGTAEYVSPELLNDNY--- 357

Query: 244 PINEKSDIWALGVFLYKLLFFTTPFEMTGQF----AILHSKYEFPVNKYSSKLINLIIIM 299
             + +SDIWA G  +++++    PF+ T ++     ++  +Y F    + + + +L+  +
Sbjct: 358 -TDARSDIWAFGCIVFQMIAGKPPFKATNEYLTFQKVMKVQYAFTAG-FPTVVRDLVKRI 415

Query: 300 LAENPNLRPNIYQVLYH 316
           L + P  R  I  +  H
Sbjct: 416 LIKAPEQRLTIEAIEKH 432

>Scas_627.7
          Length = 349

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 70/237 (29%), Positives = 107/237 (45%), Gaps = 30/237 (12%)

Query: 90  EMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMNQRLST 149
           + R EVE+   L   PN+ + +      +R       V LLME      L  Y   R   
Sbjct: 135 QFRREVEIQTSL-NHPNLTKLYGHFHDEKR-------VYLLMEYLVYGEL--YKLLRSHG 184

Query: 150 KLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTSTCFPI 209
              +    + ++ +A +++ +H     +IHRD+K EN+L+   N  KL DFG  S   P 
Sbjct: 185 PFNDVIASRFVFQIADALNYLH--DKQIIHRDLKPENILIGFNNVIKLTDFG-WSIINPR 241

Query: 210 VTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGVFLYKLLFFTTPFE 269
               + +           T  Y SPEMI   R    ++K D+WALGV  Y+L+  + PFE
Sbjct: 242 GVKRKTLC---------GTIDYLSPEMI---RSREYDDKVDVWALGVLTYELIVGSPPFE 289

Query: 270 M-TGQFA---ILHSKYEFPVNKYSSKLINLIIIMLAENPNLRPNIYQVLYHLCEILN 322
             T +     IL +  +FP    S  + +LI  +L  NP+ R ++  V+ H   I N
Sbjct: 290 EDTKELTYKRILKNDIKFP-ETVSHDVKDLISKLLKYNPSERISMRDVMKHPWIIRN 345

>CAGL0K02167g complement(191468..194956) similar to sp|P38990
           Saccharomyces cerevisiae YER129w
           Serine/threonine-protein kinase, start by similarity
          Length = 1162

 Score = 68.6 bits (166), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 72/276 (26%), Positives = 118/276 (42%), Gaps = 64/276 (23%)

Query: 89  NEMRNEVEVMKKL--KGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMNQR 146
           ++++ E+ +MKK   K    +++  D   SR+        + L++E C    +       
Sbjct: 194 DKIKREIAIMKKCHHKHVVKLIEVLDDLKSRK--------IYLVLEYCSRGEVKWCPPDC 245

Query: 147 LSTK------LTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADF 200
           L T+      L+     +I+  V L +  +HY    +IHRDIK  N+L+      K++DF
Sbjct: 246 LETEAKGPSPLSFQFTREILRGVVLGLEYLHY--QGIIHRDIKPANLLLSETGIVKISDF 303

Query: 201 G-----STSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMI--------------DLYR 241
           G     S+S       T  ++ L         TP + +PE+               +L++
Sbjct: 304 GVSLAASSSNVDGSDETIDELELAK----TAGTPAFFAPEICLGEDAFEKYQLDREELFK 359

Query: 242 CLPINEKSDIWALGVFLYKLLF----FTTPFEMTGQFAILHSKYEFPVNKYSSKLIN--- 294
              I+ K DIWALGV LY L+F    F + FE+     I++   +FP  KYS  L N   
Sbjct: 360 GSCISFKIDIWALGVTLYCLVFGMLPFVSSFELELFEKIVNDPVKFP--KYSDMLKNNQV 417

Query: 295 --------------LIIIMLAENPNLRPNIYQVLYH 316
                         L+  +L +NP  R NI ++  H
Sbjct: 418 LQMTEEAEYEAAKDLLTRLLEKNPIKRINIEEIKRH 453

>YCL024W (KCC4) [520] chr3 (79161..82274) Serine/threonine protein
           kinase involved in septin organization and cell cycle
           control [3114 bp, 1037 aa]
          Length = 1037

 Score = 68.2 bits (165), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 61/231 (26%), Positives = 102/231 (44%), Gaps = 38/231 (16%)

Query: 97  VMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMNQRLSTKLTEAEI 156
           V+ KL   PN++  +D   +          + L++E      L + +       L E E 
Sbjct: 79  VIMKLLSHPNVLSLYDVWETNNN-------LYLILEYAEKGELFNLLVDH--GPLPEREA 129

Query: 157 VKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTSTCFPIVTTHQDI 216
           +     + + IS  H L   ++HRD+K EN+L+D+  N K+ADFG       +     D 
Sbjct: 130 INCFRQIIIGISYCHAL--GIVHRDLKPENLLLDSFYNIKIADFG-------MAALQTDA 180

Query: 217 ALLTQNIYVHTTPQYRSPEMIDLYRCLPINE-KSDIWALGVFLYKLLFFTTPF-EMTGQ- 273
            LL  +     +P Y +PE++     LP     SD+W+ GV L+ LL    PF E  G  
Sbjct: 181 DLLETSC---GSPHYAAPEIVS---GLPYEGFASDVWSCGVILFALLTGRLPFDEENGNV 234

Query: 274 ----FAILHSKYEFP----VNKYSSKLINLIIIMLAENPNLRPNIYQVLYH 316
                 +   ++E P    +++ +  LI  I+++   +P  R  I  +L H
Sbjct: 235 RDLLLKVQKGQFEMPNDTEISRDAQDLIGKILVV---DPRQRIKIRDILSH 282

>YOR233W (KIN4) [5024] chr15 (775846..778248) Serine/threonine
           protein kinase related to Kin1p and Kin2p, catalytic
           domain is highly related to Snf1p [2403 bp, 800 aa]
          Length = 800

 Score = 67.8 bits (164), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 64/290 (22%), Positives = 128/290 (44%), Gaps = 41/290 (14%)

Query: 41  LAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGDVACLKRVLVQDENGLNEMRNEVEVMKK 100
           L EG F ++ +        +  ++  VP ++      +  + +D +   ++  E+  +K 
Sbjct: 52  LGEGEFGKVKLG-----WTKASSSNEVPKQVAIKLIRRDTIKKDADKEIKIYREINALKH 106

Query: 101 LKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMNQRLSTKLTEAEIVKIM 160
           L   PNI+   +   + +  G+       ++E         Y+ ++   +L E+   ++ 
Sbjct: 107 LT-HPNIIYLEEVLQNSKYIGI-------VLEFVSGGEFYKYIQRK--RRLKESSACRLF 156

Query: 161 YDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTSTCFPIVTTHQDIALLT 220
             +   ++ MHY    L+HRD+K+EN+L+D   N  + DFG  +  F      +D  L+ 
Sbjct: 157 AQLISGVNYMHY--KGLVHRDLKLENLLLDKHENLVITDFGFVNEFF------EDNELMK 208

Query: 221 QNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGVFLYKLLFFTTPFE-----MTGQFA 275
            +     +P Y +PE++   +      K+D+W+ GV LY +L    P++      TG   
Sbjct: 209 TSC---GSPCYAAPELVVSTKAYEA-RKADVWSCGVILYAMLAGYLPWDDDHENPTGDDI 264

Query: 276 ILHSKY------EFPVNKYSSKLI-NLIIIMLAENPNLRPNIYQVLYHLC 318
               KY      +FP  +Y + +  +L+  +L  NP  R N+  +  H+ 
Sbjct: 265 ARLYKYITQTPLKFP--EYITPIPRDLLRRILVPNPRRRINLQTIKRHVW 312

>AER264C [2766] [Homologous to ScYCR073C (SSK22) - SH; ScYNR031C
            (SSK2) - SH] (1120017..1124468) [4452 bp, 1483 aa]
          Length = 1483

 Score = 68.2 bits (165), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 72/288 (25%), Positives = 126/288 (43%), Gaps = 40/288 (13%)

Query: 39   NYLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGDVACLKRVLVQDENGLNE----MRNE 94
            +++  G F  +Y              ++V L  GD+  +K +   D   + +    +R+E
Sbjct: 1195 SFIGGGSFGSVY--------------SAVNLDTGDILAVKEIKFNDRKTIKQVFPSIRDE 1240

Query: 95   VEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMNQRLSTKLTEA 154
            + V++ L   PN+VQY+     R R       V + ME C   SL       L+    E 
Sbjct: 1241 MTVLEMLN-HPNVVQYYGVEVHRDR-------VNIFMEYCEGGSLASL----LAHGRIED 1288

Query: 155  EIVKIMYDVALSISQMHYLPVSLI-HRDIKIENVLVDAKNNFKLADFGSTSTCFPIVTTH 213
            E+V  +Y + + +  + YL  S + HRDIK EN+L+D     K  DFG+        +  
Sbjct: 1289 EMVTQVYSLQM-LEGLAYLHESGVDHRDIKPENILLDFNGIIKYVDFGAAKVLASNGSKK 1347

Query: 214  QDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGVFLYKLLFFTTPFE-MTG 272
             ++    +   +  TP Y SPE I            DIW+LG  + +++    P+  +  
Sbjct: 1348 LNLEQHMEGEKMIGTPMYMSPEAISGTGYGKFG-SDDIWSLGCVILEMVTGRRPWANLDN 1406

Query: 273  QFAILH--SKYEFPV----NKYSSKLINLIIIMLAENPNLRPNIYQVL 314
            Q+AI++  +  + P+    N+ S   I  +   L ++PN R    ++L
Sbjct: 1407 QWAIIYQVAAGQIPMFPSKNEMSQAGIKFLSRCLIQDPNQRSTAVELL 1454

>Scas_616.10
          Length = 1461

 Score = 68.2 bits (165), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 63/230 (27%), Positives = 104/230 (45%), Gaps = 39/230 (16%)

Query: 97  VMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMNQRLSTKLTEAEI 156
           V+ KL   PN++  ++   ++        E+ L++E      L DY+  +   KL+E E 
Sbjct: 188 VIMKLISHPNVMALYEVWENKS-------ELYLVLEYVDGGELFDYLVSK--GKLSEKEA 238

Query: 157 VKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKN-NFKLADFGSTSTCFPIVTTHQD 215
           V     +   +S  H    ++ HRD+K EN+L+D KN + K+ADFG  +   P       
Sbjct: 239 VHYFKQIIQGVSYCHSF--NICHRDLKPENLLLDKKNKSIKIADFGMAALELP------- 289

Query: 216 IALLTQNIYVHT---TPQYRSPEMI--DLYRCLPINEKSDIWALGVFLYKLLFFTTPFEM 270
                 N  + T   +P Y SPE++    Y   P    SD+W+ G+ L+ LL    PF  
Sbjct: 290 ------NKLLQTSCGSPHYASPEIVMGKSYHGGP----SDVWSCGIILFALLTGHLPFND 339

Query: 271 TGQFAIL----HSKYEFPVNKYSSKLINLIIIMLAENPNLRPNIYQVLYH 316
                +L      K+  P +  S +  +LI  +L  +P+ R    ++L H
Sbjct: 340 DNIKKLLLKVQAGKFRMP-STLSPEAQDLISRILVIDPSKRITTDRILNH 388

>Scas_564.7
          Length = 1210

 Score = 67.8 bits (164), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 51/193 (26%), Positives = 94/193 (48%), Gaps = 23/193 (11%)

Query: 129 LLMELCPNKSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVL 188
           +L E      LLDY+ Q  S  L E    K    +A ++  +H    +++HRD+KIEN++
Sbjct: 263 MLFEYVSGGQLLDYIIQHGS--LREHHARKFARGIASALEYIHA--NNIVHRDLKIENIM 318

Query: 189 VDAKNNFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEK 248
           +      K+ DFG ++    +    + +     ++Y      + +PE++  +       +
Sbjct: 319 ISTSGEIKIIDFGLSN----VFDRKKQLHTFCGSLY------FAAPELLKAHPY--TGPE 366

Query: 249 SDIWALGVFLYKLLFFTTPFEMTGQFAILH-----SKYEFPVNKYSSKLINLIIIMLAEN 303
            D+W+ GV LY L+    PF+     ++LH      K ++P N  S ++I+L+  ML  +
Sbjct: 367 VDVWSFGVVLYVLVCGKVPFDDENS-SVLHEKIKQGKVDYP-NHLSIEVISLLSKMLVVD 424

Query: 304 PNLRPNIYQVLYH 316
           P  R ++ QV+ H
Sbjct: 425 PLRRASLKQVVEH 437

>Scas_693.17
          Length = 1049

 Score = 67.8 bits (164), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 55/203 (27%), Positives = 93/203 (45%), Gaps = 23/203 (11%)

Query: 129 LLMELCPNKSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVL 188
           +L E      LLDY+ Q  S K + A         AL     H    +++HRD+KIEN++
Sbjct: 177 MLFEYVSGGQLLDYIIQHGSLKESRARTFTRQICSALKYLHSH----NIVHRDLKIENIM 232

Query: 189 VDAKNNFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLP-INE 247
           +    N KL DFG ++    +      +     ++Y      + +PE++   +  P I  
Sbjct: 233 ISKDGNIKLIDFGLSN----LYDKCNKLKTYCGSLY------FAAPELL---KATPYIGP 279

Query: 248 KSDIWALGVFLYKLLFFTTPFEMTGQFAILHSKYE----FPVNKYSSKLINLIIIMLAEN 303
           + D+W+ GV LY L+    PF+      +LH K +    F     S ++I+L+  ML  +
Sbjct: 280 EIDVWSFGVVLYVLVCGKVPFDDENS-NVLHEKIKQGKVFYPQFLSIEVISLLSKMLVVD 338

Query: 304 PNLRPNIYQVLYHLCEILNVEVP 326
           P  R  + QV+ H   + + + P
Sbjct: 339 PFKRATLDQVMNHHWMVRDCDGP 361

>Sklu_2437.16 YOL100W, Contig c2437 35714-38929 reverse complement
          Length = 1071

 Score = 67.8 bits (164), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 56/194 (28%), Positives = 89/194 (45%), Gaps = 14/194 (7%)

Query: 127 VLLLMELCPNKSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIEN 186
           +  L+E  PN   L  M +  S  L E         +  +I  +H   V  +HRDIK EN
Sbjct: 256 LYFLLEYAPNGDFLSVMKKFGS--LNEECCRYYGAQMLDAIDFIHKNGV--VHRDIKPEN 311

Query: 187 VLVDAKNNFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPIN 246
           +L+D     KL DFG+               LL ++     T +Y SPE+++   C  +N
Sbjct: 312 ILLDEHMKVKLTDFGTAKLL--DRDEKSGYNLLKKSRSFVGTAEYVSPELLN-DNC--VN 366

Query: 247 EKSDIWALGVFLYKLLFFTTPFEMTGQF----AILHSKYEFPVNKYSSKLINLIIIMLAE 302
            K DIWA G  LY+++    PF+ T ++     ++  +Y F    +   + +L+  +L +
Sbjct: 367 YKCDIWAFGCILYQMIAGKPPFKATNEYLTFQKVMKVQYAFTAG-FPLVIRDLVKQLLVK 425

Query: 303 NPNLRPNIYQVLYH 316
           +P  R N  QV  H
Sbjct: 426 SPEARLNASQVKSH 439

>YER129W (PAK1) [1559] chr5 (417277..420705) Protein kinase capable
           of suppressing DNA polymerase alpha mutations [3429 bp,
           1142 aa]
          Length = 1142

 Score = 67.4 bits (163), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 59/226 (26%), Positives = 101/226 (44%), Gaps = 37/226 (16%)

Query: 89  NEMRNEVEVMKKL--KGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLL----DY 142
           ++++ E+ +MKK   K    +++  D   SR+        + L++E C    +     D 
Sbjct: 187 DKIKREIAIMKKCHHKHVVQLIEVLDDLKSRK--------IYLVLEYCSRGEVKWCPPDC 238

Query: 143 M--NQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADF 200
           M  + +  + L+  E  +I+  V L +  +HY    +IHRDIK  N+L+      K++DF
Sbjct: 239 MESDAKGPSLLSFQETREILRGVVLGLEYLHYQ--GIIHRDIKPANLLISGDGTVKISDF 296

Query: 201 G-STSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMI--------------DLYRCLPI 245
           G S +      +   +     +      TP + +PEM               +L+R   I
Sbjct: 297 GVSLAASSTNSSDSSESLDELELAKTVGTPAFFAPEMCLGEDAFTRYNLTKENLFRGSCI 356

Query: 246 NEKSDIWALGVFLYKLLF----FTTPFEMTGQFAILHSKYEFPVNK 287
           +   DIWA+GV LY LLF    F + FE+     I++   +FP  K
Sbjct: 357 SFMIDIWAVGVTLYCLLFGMLPFFSDFELKLFEKIVNDPLKFPTFK 402

>YDR523C (SPS1) [1335] chr4 complement(1485554..1487026)
           Serine/threonine protein kinase involved in middle/late
           stage of meiosis [1473 bp, 490 aa]
          Length = 490

 Score = 66.6 bits (161), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 54/203 (26%), Positives = 95/203 (46%), Gaps = 29/203 (14%)

Query: 122 VQGFEVLLLMELCPNKSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRD 181
           ++   + ++ME C   S  D + +     L E ++  I+++V L +  +H      IHRD
Sbjct: 84  LEDVSMWIVMEYCGGGSCSDLLKRSYVNGLPEEKVSFIIHEVTLGLKYLH--EQRKIHRD 141

Query: 182 IKIENVLVDAKNNFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYR 241
           IK  N+L++ +   KL DFG        V+ H   + L ++ +V  TP + +PE++    
Sbjct: 142 IKAANILLNEEGMVKLGDFG--------VSGHIR-STLKRDTFV-GTPYWMAPEVV---- 187

Query: 242 CLPI---NEKSDIWALGVFLYKLLFFTTPFEMTGQFAILHSKYEFPVNK-------YSSK 291
           C  +   NEK+DIW+LG+  Y+LL    P        ++ +    P  K       +S  
Sbjct: 188 CCEVDGYNEKADIWSLGITTYELLKGLPPLSKYDPMKVMTN---LPKRKPPKLQGPFSDA 244

Query: 292 LINLIIIMLAENPNLRPNIYQVL 314
             + +   L + P  RP+ Y +L
Sbjct: 245 AKDFVAGCLVKTPADRPSAYNLL 267

>Sklu_2366.5 YBR274W, Contig c2366 12866-14266 reverse complement
          Length = 466

 Score = 66.6 bits (161), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 63/242 (26%), Positives = 104/242 (42%), Gaps = 38/242 (15%)

Query: 89  NEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMNQRLS 148
           N++  EV +  +     NI++  D N S+         + + ME+     L D +   + 
Sbjct: 4   NDVSKEVIIHSRCSKHSNILKVIDCNISKDY-------LWIAMEMADGGDLFDKIEPDIG 56

Query: 149 TKLTEAEIVKIMYDVAL-SISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTSTCF 207
               +AE+ +  +   L +I  +H +   + HRDIK EN+L+D   N KLADFG  S   
Sbjct: 57  V---DAEVAQFYFQQLLRAIHHLHEV-CGIAHRDIKPENILLDKNGNLKLADFGLASQ-- 110

Query: 208 PIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGVFLYKLLFFTTP 267
                      L ++     +P Y +PE+I  Y      + +DIW+ G+ ++ LL   TP
Sbjct: 111 --FRRKDGTKRLARD--QRGSPPYMAPEII--YSSEYYADTTDIWSCGILVFVLLTGETP 164

Query: 268 FEMTGQFAILHSKYEF-------------PVNKYSSKLINLIIIMLAENPNLRPNIYQVL 314
           +E+  +       Y F             P  K     +NL+  +L  NP+ R  I Q+ 
Sbjct: 165 WELPSE-----DDYNFREFLEDNGNLSFGPWAKIDFTQLNLLRKILQPNPSKRATILQLT 219

Query: 315 YH 316
            H
Sbjct: 220 SH 221

>YNL298W (CLA4) [4314] chr14 (68913..71441) Serine/threonine protein
           kinase required for cytokinesis [2529 bp, 842 aa]
          Length = 842

 Score = 66.6 bits (161), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 54/203 (26%), Positives = 95/203 (46%), Gaps = 26/203 (12%)

Query: 71  IGDVACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLL 130
           +GD   +K++++  +     + NE+ VMK  +   NIV + +  A  R D     ++ ++
Sbjct: 587 VGDKVAIKQMVLSKQPRKELIVNEILVMKDSRHK-NIVNFLE--AYLRTDD----DLWVV 639

Query: 131 MELCPNKSLLDYM-----NQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIE 185
           ME     SL D +     N    + LTE +I  I+ +    +  +H     +IHRDIK +
Sbjct: 640 MEFMEGGSLTDIIENSPTNDNSHSPLTEPQIAYIVRETCQGLKFLH--DKHIIHRDIKSD 697

Query: 186 NVLVDAKNNFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPI 245
           NVL+D +   K+ DFG    C  +       A +        TP + +PE++        
Sbjct: 698 NVLLDTRARVKITDFG---FCARLTDKRSKRATMV------GTPYWMAPEVVKQRE---Y 745

Query: 246 NEKSDIWALGVFLYKLLFFTTPF 268
           +EK D+W+LG+   ++L    P+
Sbjct: 746 DEKIDVWSLGIMTIEMLEGEPPY 768

>YDR122W (KIN1) [969] chr4 (694694..697888) Serine/threonine protein
           kinase, related to Kin2p and S. pombe KIN1 [3195 bp,
           1064 aa]
          Length = 1064

 Score = 67.0 bits (162), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 51/194 (26%), Positives = 96/194 (49%), Gaps = 25/194 (12%)

Query: 129 LLMELCPNKSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVL 188
           +L E      LLDY+ Q  S +  E +  K    +A ++  +H    +++HRD+KIEN++
Sbjct: 221 MLFEYVSGGQLLDYIIQHGSIR--EHQARKFARGIASALIYLHA--NNIVHRDLKIENIM 276

Query: 189 VDAKNNFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLP-INE 247
           +   +  K+ DFG ++    I  + + +     ++Y      + +PE++   +  P    
Sbjct: 277 ISDSSEIKIIDFGLSN----IYDSRKQLHTFCGSLY------FAAPELL---KANPYTGP 323

Query: 248 KSDIWALGVFLYKLLFFTTPFEMTGQFAILH-----SKYEFPVNKYSSKLINLIIIMLAE 302
           + D+W+ GV L+ L+    PF+     ++LH      K E+P    S ++I+L+  ML  
Sbjct: 324 EVDVWSFGVVLFVLVCGKVPFDDENS-SVLHEKIKQGKVEYP-QHLSIEVISLLSKMLVV 381

Query: 303 NPNLRPNIYQVLYH 316
           +P  R  + QV+ H
Sbjct: 382 DPKRRATLKQVVEH 395

>KLLA0A07403g 661261..663900 similar to sp|P48562 Saccharomyces
           cerevisiae YNL298w CLA4 ser/thr protein kinase, start by
           similarity
          Length = 879

 Score = 66.6 bits (161), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 56/237 (23%), Positives = 106/237 (44%), Gaps = 26/237 (10%)

Query: 37  VVNYLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGDVACLKRVLVQDENGLNEMRNEVE 96
           +V    +G    +Y+ + L+     D   +   ++G+   +K++++  +     + NE+ 
Sbjct: 590 MVEKAGQGASGSVYLAERLQLPPYKDELEAEKNQLGNKVAIKQMILSKQPRKELIVNEIL 649

Query: 97  VMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMNQRLS-----TKL 151
           VMK  K   NIV + ++      D      + ++ME     SL D +    +     + L
Sbjct: 650 VMKDSKHN-NIVNFLEAYLKTEDD------LWVVMEYMEGGSLTDIIENSPTGSSGQSPL 702

Query: 152 TEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTSTCFPIVT 211
           TE +I  I+ +    +  +H     +IHRDIK +NVL+D +   K+ DFG    C  +  
Sbjct: 703 TEPQIAYIVRETCQGLKFLH--DKHIIHRDIKSDNVLLDTRGRVKITDFG---FCAKLTD 757

Query: 212 THQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGVFLYKLLFFTTPF 268
                A +        TP + +PE++        +EK D+W+LG+   ++L    P+
Sbjct: 758 KRSKRATMV------GTPYWMAPEVVKQRE---YDEKVDVWSLGIMTIEMLESEPPY 805

>Sklu_2086.4 , Contig c2086 6437-7168 reverse complement
          Length = 243

 Score = 63.9 bits (154), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 45/124 (36%), Positives = 62/124 (50%), Gaps = 19/124 (15%)

Query: 147 LSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTSTC 206
           L T +TE E   I   VA  I  +H     ++HRDIK EN++VD K   KL DFGS +  
Sbjct: 85  LKTNMTEHEAKLIFKQVASGIKHLH--DNGIVHRDIKDENIIVDNKGFVKLIDFGSAAY- 141

Query: 207 FPIVTTHQDIALLTQNIYVHTTPQYRSPEMI--DLYRCLPINEKSDIWALGVFLYKLLFF 264
                    +     +++V T   Y +PE++  D Y   P     DIWA+GV LY ++F 
Sbjct: 142 ---------VKSGPFDVFVGTI-DYAAPEVLGGDPYEGKP----QDIWAIGVLLYTIIFK 187

Query: 265 TTPF 268
             PF
Sbjct: 188 ENPF 191

>Kwal_26.7355
          Length = 1446

 Score = 66.6 bits (161), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 73/284 (25%), Positives = 121/284 (42%), Gaps = 61/284 (21%)

Query: 69   LKIGDVACLKRVLV-----QDENGLN---EMRNEVEVMKKLKGAPNIVQYFDSNASRRRD 120
            +  G++  +K+V V     QDE  L+    +R+EV  +K L    NIVQY          
Sbjct: 1166 VTTGEMIAVKQVEVPRYGSQDETTLSVLEALRSEVATLKDLDHT-NIVQYL--------- 1215

Query: 121  GVQGFE-----VLLLMELCPNKSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPV 175
               GFE       L +E     S+   +  RL  K  E  I  +   V   +S +H    
Sbjct: 1216 ---GFENKNYVYSLFLEYVAGGSVGSLI--RLYGKFDENLIRFLAVQVLRGLSYLHS--K 1268

Query: 176  SLIHRDIKIENVLVDAKNNFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHT------TP 229
             ++HRD+K +N+L+D     K++DFG              I+  + NIY ++      T 
Sbjct: 1269 KILHRDMKADNLLLDVDGICKISDFG--------------ISKKSNNIYSNSDMTMRGTV 1314

Query: 230  QYRSPEMIDLYRCLPINEKSDIWALGVFLYKLLFFTTPFE----MTGQFAILHSKYEFPV 285
             + +PEM+D  +    + K DIW+LG  + ++     P+     +   F I   K   P+
Sbjct: 1315 FWMAPEMVDTKQGY--SAKVDIWSLGCVVLEMFAGKRPWSNLEVVAAMFKIGKFKSAPPI 1372

Query: 286  NKYSSKLIN-----LIIIMLAENPNLRPNIYQVLYHLCEILNVE 324
             + + K+I+      +      NP  RP   ++L H   I++ E
Sbjct: 1373 PEDTQKIISAEGKEFLDACFEINPEKRPTADELLSHPFCIVDKE 1416

>AEL205W [2301] [Homologous to ScYNL298W (CLA4) - SH; ScYOL113W
           (SKM1) - SH] complement(246871..249252) [2382 bp, 793
           aa]
          Length = 793

 Score = 66.2 bits (160), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 56/243 (23%), Positives = 108/243 (44%), Gaps = 32/243 (13%)

Query: 36  EVVNYLAEGGFAQIYVVKFLEYLNEFDNTASVPL-----KIGDVACLKRVLVQDENGLNE 90
           +++    +G    +Y+ + L+ +  +D  + V        IGD   +K++++  +     
Sbjct: 499 QMIEKAGQGASGSVYLAQRLK-IPPYDENSGVSQHELNDNIGDKVAIKQMILSKQPRKEL 557

Query: 91  MRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMNQRLST- 149
           + NE+ VMK  +   NIV + ++      D      + ++ME     SL D +   + + 
Sbjct: 558 IVNEILVMKDSQHK-NIVNFLEAYLKTEDD------LWVVMEYMEGGSLTDVIENSIGSD 610

Query: 150 ----KLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTST 205
                +TE +I  I+ +    +  +H     +IHRDIK +NVL+D     K+ DFG    
Sbjct: 611 ASESPMTEPQIAYIVRETCQGLKFLHD--KHIIHRDIKSDNVLLDTHGRVKITDFG---F 665

Query: 206 CFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGVFLYKLLFFT 265
           C  +       A +        TP + +PE++        +EK D+W+LG+   ++L   
Sbjct: 666 CAKLTDKRSKRATMV------GTPYWMAPEVVKQRE---YDEKVDVWSLGIMTIEMLEGE 716

Query: 266 TPF 268
            P+
Sbjct: 717 PPY 719

>YAR019C (CDC15) [74] chr1 complement(172211..175135) MAP kinase
           kinase kinase essential for late nuclear division [2925
           bp, 974 aa]
          Length = 974

 Score = 66.6 bits (161), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 75/266 (28%), Positives = 130/266 (48%), Gaps = 33/266 (12%)

Query: 74  VACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMEL 133
           V  +K V+ +++  LN++  E+ ++K L    NIV+Y   +   R+     +E+ +L+E 
Sbjct: 50  VVAIKEVVYENDEELNDIMAEISLLKNLNHN-NIVKY---HGFIRK----SYELYILLEY 101

Query: 134 CPNKSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKN 193
           C N SL   ++ R ST L+E E    +    L +  +H     +IHRDIK  N+L+ A N
Sbjct: 102 CANGSLRRLIS-RSSTGLSENESKTYVTQTLLGLKYLH--GEGVIHRDIKAANILLSADN 158

Query: 194 NFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253
             KLADFG        V+T  + + LT    +  T  + +PE++        +  SDIW+
Sbjct: 159 TVKLADFG--------VSTIVNSSALT----LAGTLNWMAPEILGNRGA---STLSDIWS 203

Query: 254 LGVFLYKLLFFTTPF----EMTGQFAILHSKYEFPVNKYSSKLINLIIIMLAENPNLRPN 309
           LG  + ++L    P+    +    +A+ +  Y +P + +S  L + +     +N   RP 
Sbjct: 204 LGATVVEMLTKNPPYHNLTDANIYYAVENDTY-YPPSSFSEPLKDFLSKCFVKNMYKRPT 262

Query: 310 IYQVLYHLC--EILNVEVPIEDKYAE 333
             Q+L H+      NV+V   +K+ E
Sbjct: 263 ADQLLKHVWINSTENVKVDKLNKFKE 288

>YCR073C (SSK22) [598] chr3 complement(242584..246579) Map kinase
            kinase kinase (MAPKKK) with strong similarity to Ssk2p,
            participates in the high-osmolarity signal transduction
            pathway [3996 bp, 1331 aa]
          Length = 1331

 Score = 66.6 bits (161), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 71/250 (28%), Positives = 111/250 (44%), Gaps = 36/250 (14%)

Query: 40   YLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGDVACLKRV--LVQDENGLNEMRNEVEV 97
            ++  G F Q+Y    LE     +  A   +KI D   +K++  L+++E  + EM N    
Sbjct: 1039 FIGGGTFGQVYSAINLE---NGEILAVKEIKIHDTTTMKKIFPLIKEEMTVLEMLNH--- 1092

Query: 98   MKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMNQRLSTKLTEAEIV 157
                   PNIVQY+       RD V  F     ME C   SL   ++        E E+V
Sbjct: 1093 -------PNIVQYY--GVEVHRDKVNIF-----MEYCEGGSLASLLDH----GRIEDEMV 1134

Query: 158  KIMYDVALSISQMHYLPVS-LIHRDIKIENVLVDAKNNFKLADFGSTSTCFPIVT----- 211
              +Y   L +  + YL  S ++HRDIK EN+L+D     K  DFG+  T     T     
Sbjct: 1135 TQVYTFEL-LEGLAYLHQSGVVHRDIKPENILLDFNGIIKYVDFGTARTVVGSRTRTVRN 1193

Query: 212  -THQDIALLTQNI-YVHTTPQYRSPEMIDLYRCLPINEKSDIWALGVFLYKLLFFTTPFE 269
               QD  + T+++  +  TP Y +PE I            D+WALG  + ++     P+ 
Sbjct: 1194 AAVQDFGVETKSLNEMMGTPMYMAPETISGSAVKGKLGADDVWALGCVVLEMATGRRPWS 1253

Query: 270  -MTGQFAILH 278
             +  ++AI++
Sbjct: 1254 NLDNEWAIMY 1263

>CAGL0G09020g 860266..861351 highly similar to sp|P06245
           Saccharomyces cerevisiae YPL203w TPK2 cAMP-dependent
           protein kinase 2, catalytic chain, hypothetical start
          Length = 361

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 53/201 (26%), Positives = 92/201 (45%), Gaps = 36/201 (17%)

Query: 162 DVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTSTCFPIVTTHQDIALLTQ 221
           +V L++  +H+   ++I+RD+K EN+L+D   + K+ DFG       +  T         
Sbjct: 157 EVTLALEYLHFH--NIIYRDLKPENILLDRNGHIKITDFGFAKEVETVTWT--------- 205

Query: 222 NIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGVFLYKLLFFTTPFE----MTGQFAIL 277
              +  TP Y +PE+I      P N+  D W+LGV +Y++L   TPF     M     IL
Sbjct: 206 ---LCGTPDYIAPEVI---ATKPYNKSVDWWSLGVLIYEMLAGYTPFYDTTPMKTYEKIL 259

Query: 278 HSKYEFPVNKYSSKLINLIIIML--------------AENPNLRPNIYQVLYHLCEILNV 323
           H K  +P   ++S +I+L+  +L              A++    P   +V++      ++
Sbjct: 260 HGKVVYP-QFFNSDVIDLLSKLLTADLTRRIGNLQKGAQDIKSHPWFAEVVWEKLLAKDI 318

Query: 324 EVPIEDKYAEGAYNFSKYTQF 344
           E P E     G  + S + Q+
Sbjct: 319 ETPYEPPITAGVGDTSLFDQY 339

>KLLA0F19536g 1808263..1811577 similar to sp|P13186 Saccharomyces
           cerevisiae YLR096w KIN2 ser/thr protein kinase, start by
           similarity
          Length = 1104

 Score = 66.2 bits (160), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 53/194 (27%), Positives = 94/194 (48%), Gaps = 25/194 (12%)

Query: 129 LLMELCPNKSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVL 188
           +L E      LLDY+ Q  S  L E    K +  +A ++  +H    +++HRD+KIEN++
Sbjct: 199 MLFEYVSGGQLLDYIIQHGS--LRERHARKFVRGIASALQYLHL--NNIVHRDLKIENIM 254

Query: 189 VDAKNNFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLP-INE 247
           +      K+ DFG ++    +    + +     ++Y      + +PE++   +  P I  
Sbjct: 255 ISTSGEIKIIDFGLSN----LYDNKKQLHTFCGSLY------FAAPELL---KANPYIGP 301

Query: 248 KSDIWALGVFLYKLLFFTTPFEMTGQFAILH-----SKYEFPVNKYSSKLINLIIIMLAE 302
           + DIW+ GV +Y L+    PF+     ++LH      K E+P    S + I+L+  ML  
Sbjct: 302 EVDIWSFGVVIYVLVCGKVPFD-DENASVLHEKIKKGKVEYP-QHLSIECISLLSKMLVV 359

Query: 303 NPNLRPNIYQVLYH 316
           +P  R ++ QV  H
Sbjct: 360 DPLKRASLKQVCNH 373

>YBR274W (CHK1) [453] chr2 (749551..751134) Checkpoint kinase,
           required for metaphase DNA-damage checkpoint [1584 bp,
           527 aa]
          Length = 527

 Score = 65.5 bits (158), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 50/214 (23%), Positives = 101/214 (47%), Gaps = 27/214 (12%)

Query: 60  EFDNTASVPLKIGDVACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRR 119
           + D +  + +K   V   K++ + D+    ++  EV +  K    PN+++  D N S+  
Sbjct: 35  QMDPSIILAVKFIHVPTCKKMGLSDK----DITKEVVLQSKCSKHPNVLRLIDCNVSKEY 90

Query: 120 DGVQGFEVLLLMELCPNKSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIH 179
                  + +++E+     L D +   +     ++++ +  +   +S     ++   + H
Sbjct: 91  -------MWIILEMADGGDLFDKIEPDVGV---DSDVAQFYFQQLVSAINYLHVECGVAH 140

Query: 180 RDIKIENVLVDAKNNFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMI-- 237
           RDIK EN+L+D   N KLADFG  S         +    L  ++    +P Y +PE++  
Sbjct: 141 RDIKPENILLDKNGNLKLADFGLAS------QFRRKDGTLRVSMDQRGSPPYMAPEVLYS 194

Query: 238 -DLYRCLPINEKSDIWALGVFLYKLLFFTTPFEM 270
            + Y      +++DIW++G+ L+ LL   TP+E+
Sbjct: 195 EEGYYA----DRTDIWSIGILLFVLLTGQTPWEL 224

>KLLA0E17127g complement(1515721..1518279) similar to sp|P38691
           Saccharomyces cerevisiae YHR082c KSP1 ser/thr protein
           kinase, start by similarity
          Length = 852

 Score = 65.9 bits (159), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 46/190 (24%), Positives = 83/190 (43%), Gaps = 40/190 (21%)

Query: 94  EVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMNQRLSTKLTE 153
           EV++  K+    NI + +D            F+  ++ME C    L + +   +  + T+
Sbjct: 116 EVDIQTKIGKHKNITELYDF-----------FDSYIIMEYCSGGDLYEAIKDDMVPRKTK 164

Query: 154 AEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTSTCFPIVTTH 213
             +  I+  +  ++  +H     + HRDIK EN+L+    N KL D+G  +T        
Sbjct: 165 -NVTNIINQILDAVEYVHSR--GIYHRDIKPENILIAGNWNIKLTDWGLATT-------- 213

Query: 214 QDIALLTQNIYVHTTPQYRSPEMI----------DLYRCLPINEKSDIWALGVFLYKLLF 263
            D   + +N+    + +Y +PE+           D Y C     K DIWA+G+ +  ++F
Sbjct: 214 -DKTSMERNV---GSERYMAPELFESNLDREERTDAYDC----AKVDIWAIGIVMLNIVF 265

Query: 264 FTTPFEMTGQ 273
              PF +  Q
Sbjct: 266 HKNPFTVANQ 275

>Kwal_23.5668
          Length = 1689

 Score = 66.2 bits (160), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 56/212 (26%), Positives = 101/212 (47%), Gaps = 25/212 (11%)

Query: 118  RRDGVQGFEVLLLMELCPNKSLLDYMN-QRLSTKLTEAEIVKIMYDVALSISQMHYLPVS 176
            +R+ +    + + ME C N++L D ++ + L  +  + E  ++  ++  ++S +H     
Sbjct: 803  KRNRIVKSTLFIQMEYCENRTLFDLIHTENLCAQ--KEEYWRLFREILDALSYIH--SQG 858

Query: 177  LIHRDIKIENVLVDAKNNFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHT--TPQYRSP 234
            +IHRD+K  N+ +D   N K+ DFG           H+ + LL  + ++ T  T    S 
Sbjct: 859  IIHRDLKPMNIFIDESRNIKIGDFGLAKNV------HKSVDLLRMDSHISTASTEDLTSA 912

Query: 235  EMIDLYRCLPI-------NEKSDIWALGVFLYKLLF-FTTPFEMTGQF-AILHSKYEFPV 285
                LY    +       NEK D+++LG+  +++++ F T  E       I  S  +FP 
Sbjct: 913  IGTALYVATEVLTGSGNYNEKIDMYSLGIIFFEMVYSFNTGMERVNDIKKIRTSAIDFPS 972

Query: 286  NKYSSKLI---NLIIIMLAENPNLRPNIYQVL 314
            +  SSKL     +I  +L  +PN RPN   +L
Sbjct: 973  DFDSSKLAVEKKIITQLLDHDPNRRPNAKTLL 1004

>Kwal_23.5290
          Length = 819

 Score = 65.9 bits (159), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 53/204 (25%), Positives = 94/204 (46%), Gaps = 26/204 (12%)

Query: 70  KIGDVACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLL 129
           +IGD   +K++++  +     + NE+ VMK  +   NIV + ++      D      + +
Sbjct: 563 EIGDKVAIKQMILSKQPRKELIVNEILVMKDSQHK-NIVNFLEAYLKTEDD------LWV 615

Query: 130 LMELCPNKSLLDYM-----NQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKI 184
           +ME     SL D +     N    + LTE +I  I+ +    +  +H     +IHRDIK 
Sbjct: 616 VMEYMEGGSLTDLIENSPANGSSHSPLTEPQIAYIVRETCQGLKFLHD--KHIIHRDIKS 673

Query: 185 ENVLVDAKNNFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLP 244
           +NVL+D +   K+ DFG    C  +       A +        TP + +PE++       
Sbjct: 674 DNVLLDNRARVKITDFG---FCAKLTDKRSKRATMV------GTPYWMAPEVVKQRE--- 721

Query: 245 INEKSDIWALGVFLYKLLFFTTPF 268
            +EK D+W+LG+   ++L    P+
Sbjct: 722 YDEKVDVWSLGIMTIEMLEGEPPY 745

>YPL141C (YPL141C) [5305] chr16 complement(283463..286060)
           Serine/threonine protein kinase with similarity to Kin4p
           [2598 bp, 865 aa]
          Length = 865

 Score = 65.5 bits (158), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 57/241 (23%), Positives = 109/241 (45%), Gaps = 46/241 (19%)

Query: 41  LAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGDVACLKRVLVQDENGLNEMRNEVEVMKK 100
           L EG F ++     L +   F N+++          +K  L++ ++  N+ R EV++ ++
Sbjct: 47  LGEGEFGKVK----LGWPKNFSNSSNSTFDFPKQVAIK--LIKRDSISNDYRKEVKIYRE 100

Query: 101 LKGA-----PNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMNQRLSTKLTEAE 155
           +        PNIV+  +   + R  G+       ++E         Y+ ++   +L E  
Sbjct: 101 INALKHLSHPNIVKLEEVLQNSRYIGI-------VLEYACGGEFYKYIQKK--RRLKEMN 151

Query: 156 IVKIMYDVALSISQMHYL-PVSLIHRDIKIENVLVDAKNNFKLADFGSTSTCFPIVTTHQ 214
             ++   +   IS +HY+    L+HRD+K+EN+L+D   N  + DFG  +          
Sbjct: 152 ACRLFSQL---ISGVHYIHSKGLVHRDLKLENLLLDKNENLVITDFGFVN---------- 198

Query: 215 DIALLTQNIYVHT---TPQYRSPEMI---DLYRCLPINEKSDIWALGVFLYKLLFFTTPF 268
                ++N  + T   +P Y +PE++   + Y       K+DIW+ GV LY +L    P+
Sbjct: 199 --EFCSRNELMKTSCGSPCYAAPELVISAEPYEA----RKADIWSCGVILYAILAGYLPW 252

Query: 269 E 269
           +
Sbjct: 253 D 253

>Sklu_2073.3 YER129W, Contig c2073 2194-5742
          Length = 1182

 Score = 65.9 bits (159), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 58/224 (25%), Positives = 96/224 (42%), Gaps = 41/224 (18%)

Query: 89  NEMRNEVEVMKKL--KGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMNQR 146
           ++++ E+ +MKK   +    +++  D   SR+        + L++E C    +      +
Sbjct: 168 DKIKREIAIMKKCHHEHVVKLIEVLDDFKSRK--------IYLVLEYCSKGEIKWCPGDQ 219

Query: 147 LSTK------LTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADF 200
           L TK      LT     +++  V L +  +HY    +IHRDIK  N+LV      K++DF
Sbjct: 220 LETKARGPPLLTFQRAREVLRGVVLGLEYLHY--QGIIHRDIKPANLLVSETGTVKISDF 277

Query: 201 GSTSTCFPIVTTHQDIALLTQNIYVHT--TPQYRSPEMI--------------DLYRCLP 244
           G +       TT      + +     T  TP + +PE+                  + L 
Sbjct: 278 GVS---LAASTTEDGNGFIDELELAKTAGTPAFFAPEICLGHDALEKFNPDKKATKKGLC 334

Query: 245 INEKSDIWALGVFLYKLLF----FTTPFEMTGQFAILHSKYEFP 284
           I+   DIWALGV L+ LLF    F + FE+     I++    FP
Sbjct: 335 ISFMIDIWALGVTLHCLLFGQLPFISEFELELFHKIVNDSLTFP 378

>Kwal_26.7861
          Length = 955

 Score = 65.5 bits (158), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 54/176 (30%), Positives = 83/176 (47%), Gaps = 25/176 (14%)

Query: 93  NEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMNQRLSTKLT 152
           NE+ VMK  K A NIV + DS   R        ++ ++ME     SL D +   +   LT
Sbjct: 711 NEILVMKASKHA-NIVNFIDSYLLRG-------DLWVVMEYMEGGSLTDVVTHCI---LT 759

Query: 153 EAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTSTCFPIVTT 212
           E +I  +  +    +  +H   V  IHRDIK +NVL+      KL DFG    C  I   
Sbjct: 760 EGQIGAVSRETLKGLQFLHSKGV--IHRDIKSDNVLLSMSGEIKLTDFG---FCAQI--- 811

Query: 213 HQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGVFLYKLLFFTTPF 268
             +I L  +   +  TP + +PE++      P   K DIW+LG+ + +++    P+
Sbjct: 812 -NEINL--KRTTMVGTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY 861

>CAGL0K02673g complement(240509..243256) similar to sp|Q03497
           Saccharomyces cerevisiae YHL007c STE20
           Serine/threonine-protein kinase, hypothetical start
          Length = 915

 Score = 65.5 bits (158), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 53/196 (27%), Positives = 95/196 (48%), Gaps = 25/196 (12%)

Query: 73  DVACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLME 132
           D   +K++ ++ +     + NE+ VM++ K + NIV + DS  ++        ++ ++ME
Sbjct: 644 DSVAIKQMNLEKQPKKELILNEILVMRESKHS-NIVNFIDSYLAK-------GDLWIVME 695

Query: 133 LCPNKSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAK 192
                SL D +   L   L+E +I  +  +    +  +H   V  +HRDIK +N+L+  K
Sbjct: 696 YMEGGSLTDVVTHCL---LSEGQIGAVCRETLKGLQFLHSKGV--LHRDIKSDNILLSLK 750

Query: 193 NNFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIW 252
            N KL DFG    C  I   +     L +   V  TP + +PE++      P   K DIW
Sbjct: 751 GNIKLTDFG---FCAQINENN-----LKRTTMVG-TPYWMAPEVVSRKEYGP---KVDIW 798

Query: 253 ALGVFLYKLLFFTTPF 268
           +LG+ + +++    P+
Sbjct: 799 SLGIMIIEMIEGEPPY 814

>ACR196C [1243] [Homologous to ScYDL159W (STE7) - SH]
           (692321..693913) [1593 bp, 530 aa]
          Length = 530

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 53/201 (26%), Positives = 94/201 (46%), Gaps = 40/201 (19%)

Query: 89  NEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMEL--CPNKSLLDYMNQR 146
           N++  E+ +MK +K   NIV ++ +  +     ++  E+++LME   C +   +    +R
Sbjct: 236 NQLMRELTIMKNVKEQKNIVGFYGAYYT----AIKNHEIIILMEYMDCGSLDKISSTYRR 291

Query: 147 LSTK-----------LTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNF 195
             ++            TE  + KI Y V   +S + Y    +IHRDIK  N+L+++K   
Sbjct: 292 YCSRNKVPMNASTSWFTELSLSKISYAVLNGLSYL-YQDYKIIHRDIKPSNILINSKGFV 350

Query: 196 KLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALG 255
           K+ DFG +      +           + +V T+  Y SPE I    C   N K D+W+LG
Sbjct: 351 KICDFGVSKKMIDSIA----------DTFVGTS-TYMSPERIQ-GSCY--NTKGDVWSLG 396

Query: 256 VFLYKLLFFTTPFEMTGQFAI 276
           + + +L+        TG+F +
Sbjct: 397 LMIIELV--------TGEFPL 409

>KLLA0C00979g 73295..74746 similar to sp|P08458 Saccharomyces
           cerevisiae YDR523c SPS1 ser/thr protein kinase,
           hypothetical start
          Length = 483

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 79/310 (25%), Positives = 129/310 (41%), Gaps = 43/310 (13%)

Query: 30  VGTHKVEVVNYLAEGGFAQIYVVKFLEYLNEFDNTA---SVPLKIGDVACLKRVLVQDEN 86
           +   + +++  + +G F  +Y+  +L    E  +     +VPL I    C+   L     
Sbjct: 2   LSLQQFQLLECVGKGNFGDVYLAHYLGSNQEPTDPKIPKNVPLAI---KCIN--LEHSNE 56

Query: 87  GLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMNQR 146
            ++ +  E+  +  L   P I  Y+ +             + ++ME C N SLL+ +  R
Sbjct: 57  PIDLLLKEIYFLSTLH-CPYITHYYGTFTG-------DCNLYIVMEYCSNGSLLNLL--R 106

Query: 147 LSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTSTC 206
             ++LTE     I+  V  ++  +H     LIHRD+K  N+L++     +LAD G T   
Sbjct: 107 YYSRLTEQTTCFIILQVCHALEYLH--EKRLIHRDLKAANILLNDDGEVRLADLGVTGQL 164

Query: 207 FPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGVFLYKLLFFTT 266
               T H    L   N +V  TP + +PE+I   +    + K DIW+LG+   +LL    
Sbjct: 165 KFNSTRHGGKNL---NTFV-GTPFWMAPEII---KNQSYDGKCDIWSLGITTLELLNGKP 217

Query: 267 PFEMTGQFAILHSKYEFPVNKYSSKLINL---------IIIMLAENPNLRPNIYQVLYH- 316
           P         L      P     S L N+         I   L ++PN RP   Q+L H 
Sbjct: 218 PMSHLDSMKAL---MRIPKLNADSILRNMDISPLGKDFIRSCLQQDPNQRPTCKQLLQHK 274

Query: 317 ---LCEILNV 323
               C I N+
Sbjct: 275 WLKKCSITNI 284

>AFR724C [3917] [Homologous to ScYDR523C (SPS1) - SH]
           (1769897..1771219) [1323 bp, 440 aa]
          Length = 440

 Score = 64.3 bits (155), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 67/286 (23%), Positives = 128/286 (44%), Gaps = 40/286 (13%)

Query: 36  EVVNYLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGDVACLKRVLVQD-ENGLNEMRNE 94
           E++  +  G F  +Y  +        D T++      ++  +K V ++D +  ++ +  E
Sbjct: 21  EILQCIGRGNFGDVYKAR--------DLTSN------EIVAIKVVNLEDTDEPIDLLAQE 66

Query: 95  VEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMNQRLSTKLTEA 154
           +  + +L+ +P I  Y       +   +    + ++ME C   S  + +      K+TE 
Sbjct: 67  IFFLSELR-SPYITNY-------KTAFLVDVSMWIVMEYCGGGSCAELLKYTPEHKVTEE 118

Query: 155 EIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTSTCFPIVTTHQ 214
           +   I+ +V + +  +H      IHRDIK  N+L+    + KL DFG +     +VT  +
Sbjct: 119 QCAFIVSEVLIGLDYLH--SQRKIHRDIKSANILLTDNGHVKLGDFGVSGQM--MVTRKR 174

Query: 215 DIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGVFLYKLLFFTTPFE----M 270
           D  +         TP + +PE+ID  +    NE +DIW+LG+ + +LL    P +    M
Sbjct: 175 DTFV--------GTPFWMAPEVIDRNK-QGYNEMADIWSLGITVIELLMGHPPLDKYDAM 225

Query: 271 TGQFAILHSKYEFPVNKYSSKLINLIIIMLAENPNLRPNIYQVLYH 316
               AI          ++SS   + +   L ++P+ RP   ++L H
Sbjct: 226 KALMAIPKRDPPKLDKRFSSHARDFVAQCLIKDPSQRPTAAELLKH 271

>Kwal_23.6458
          Length = 868

 Score = 65.1 bits (157), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 83/356 (23%), Positives = 139/356 (39%), Gaps = 68/356 (19%)

Query: 28  VCVGTHKVEVVNYLAEGGFAQIYVVK-----FLEYLNEFDNTASVPLKIGDVACLKRVLV 82
           V VG    E +  L +G   ++Y+VK      L  L  F     +  K      +KR+L 
Sbjct: 457 VIVGPQSFEKIKLLGQGDVGKVYLVKEKKTNRLYALKIFSKEEMIKRK-----KIKRILA 511

Query: 83  QDENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDY 142
           + E            +      P IV  + S  S          + L ME C        
Sbjct: 512 EQE------------ILATSNHPFIVTLYHSFQSEDY-------LYLCMEYCMGGEFFRA 552

Query: 143 MNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFG- 201
           +  R +  + E +      +V  +I  +H +    I+RD+K EN+L+    +  L+DF  
Sbjct: 553 LQTRKTKCIDEDDARFYSSEVVAAIEYLHLM--GFIYRDLKPENILLHKSGHIMLSDFDL 610

Query: 202 ---STSTCFPIVTTHQDIALLTQNI---------YVHTTPQYRSPEMIDLYRCLPINEKS 249
              +  T  P+V      +LL   I         +V T  +Y +PE+I   R        
Sbjct: 611 SVQAKDTKNPVVKGSAQSSLLDTKICSDGFRTNSFVGTE-EYIAPEVI---RGNGHTAAV 666

Query: 250 DIWALGVFLYKLLFFTTPFE---MTGQFA-ILHSKYEFP----VNKYSSKLINLIII--- 298
           D W LG+ +Y++LF  TP++       F+ +L ++  FP    V++    LI  ++I   
Sbjct: 667 DWWTLGILIYEMLFGFTPYKGDNTNKTFSNVLKNEVSFPNNNEVSRNCKDLIRKLLIKSE 726

Query: 299 -------MLAENPNLRPNIYQVLYHLCEILNVEVPIEDKYAEGAYNFSKYTQFQNK 347
                    A +    P   +V + L  + N E P+     E  Y+F++ +   NK
Sbjct: 727 TRRLGSKFGASDIKKHPFFKKVQWSL--LRNQEPPLIPVLTENGYDFTRLSNNVNK 780

>ABR014W [605] [Homologous to ScYHL007C (STE20) - SH]
           complement(417710..420625) [2916 bp, 971 aa]
          Length = 971

 Score = 65.1 bits (157), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 53/177 (29%), Positives = 88/177 (49%), Gaps = 27/177 (15%)

Query: 93  NEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMNQRLSTKLT 152
           NE+ VMK  +   NIV + DS        ++G ++ ++ME     SL D +   +   LT
Sbjct: 727 NEILVMKGSRHN-NIVNFIDSYL------LKG-DLWVIMEYMEGGSLTDVVTHCI---LT 775

Query: 153 EAEIVKIMYDVALSISQMHYL-PVSLIHRDIKIENVLVDAKNNFKLADFGSTSTCFPIVT 211
           E +I  +  +   ++  +H+L    +IHRDIK +N+L+    N KL DFG    C  I  
Sbjct: 776 EGQIAAVSRE---TLRGLHFLHSKGVIHRDIKSDNILLSMDGNIKLTDFG---FCAQINE 829

Query: 212 THQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGVFLYKLLFFTTPF 268
           T+     L +   V  TP + +PE++      P   K DIW+LG+ + +++    P+
Sbjct: 830 TN-----LKRTTMV-GTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY 877

>KLLA0C08525g 744554..749209 similar to sp|P53599 Saccharomyces
            cerevisiae YNR031c SSK2 MAP kinase kinase kinase of the
            high osmolarity signal transduction pathway, start by
            similarity
          Length = 1551

 Score = 65.1 bits (157), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 66/252 (26%), Positives = 110/252 (43%), Gaps = 45/252 (17%)

Query: 40   YLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGDVACLKRVLVQDENGLNE----MRNEV 95
            ++  G F  +Y              ++V L  GD+  +K + +QD   + +    ++ E+
Sbjct: 1264 FIGSGSFGTVY--------------SAVNLDTGDILAVKEIKIQDAKSMKQIFPSLKEEM 1309

Query: 96   EVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMNQ-RLSTKLTEA 154
             VM+ L   PNIVQY+       RD V  F     ME C   SL   +   R+     E 
Sbjct: 1310 RVMEIL-NHPNIVQYY--GVEVHRDKVNIF-----MEFCEGSSLASLLEHGRI-----ED 1356

Query: 155  EIVKIMYDVAL--SISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTSTCFPIVTT 212
            E+V  +Y + L   ++ +H   V  +HRDIK EN+L+D     K  DFG+          
Sbjct: 1357 EMVTQVYTLQLLEGLACLHQSGV--VHRDIKPENILLDRNGVIKYVDFGAAKLIAK--NG 1412

Query: 213  HQDIALLTQNIY-----VHTTPQYRSPEMIDLYRCLPINEKSDIWALGVFLYKLLFFTTP 267
             + I+L   N       +  TP Y +PE +            DIW+LG  + +++    P
Sbjct: 1413 SKRISLDANNKSTGGKDMIGTPMYMAPETVTGQGHGKFGS-DDIWSLGCVVLEMVTGRRP 1471

Query: 268  FE-MTGQFAILH 278
            +  +  ++AI++
Sbjct: 1472 WANLDNEWAIMY 1483

>ACL053C [996] [Homologous to ScYER129W (PAK1) - SH; ScYGL179C
           (TOS3) - SH] (273163..276708) [3546 bp, 1181 aa]
          Length = 1181

 Score = 64.7 bits (156), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 76/280 (27%), Positives = 116/280 (41%), Gaps = 61/280 (21%)

Query: 90  EMRNEVEVMKKL--KGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMNQRL 147
           ++R E+ +MKK   +    +++  D   SR+   V  +     ++ CP   L      R 
Sbjct: 161 KIRREIAIMKKCDHEHVVKLIEVLDDMKSRKIYLVLEYCSKGEVKWCPGDQL--EAAARG 218

Query: 148 STKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFG----ST 203
              LT     +I+  V L +  +HY    +IHRDIK  N+L+   +  K++DFG    S+
Sbjct: 219 PPLLTFQRTREILRGVVLGLEYLHYQ--GIIHRDIKPANLLLSEHDIVKISDFGVSLASS 276

Query: 204 STCFPIVTTHQ--------------DIALLTQNIYVHTTPQYRSPEMI---DLYRCLPIN 246
           ++  P   +                D+ L         TP + +PE+    D Y  L I+
Sbjct: 277 NSGTPSSRSSSSSSVKGVLGAEGPDDLELAK----TAGTPAFFAPEICLGSDAYEKLNID 332

Query: 247 EKS------------DIWALGVFLYKLLFFTTPF----EMTGQFAILHSKYEFP------ 284
            +S            DIWALGV LY LLF   PF    EM     I++   EFP      
Sbjct: 333 RQSNPCSGSLISYMIDIWALGVTLYCLLFGKLPFIAEYEMELFEKIVNDPLEFPRLEFMQ 392

Query: 285 ---VNKYSSK-----LINLIIIMLAENPNLRPNIYQVLYH 316
              V+  S K       +L+  +L +NP  R NI  +  H
Sbjct: 393 SNGVSMISCKEEYLSAQDLLNKLLEKNPMQRINIVDIKAH 432

>CAGL0B01925g 176316..179150 similar to sp|P13185 Saccharomyces
           cerevisiae YDR122w KIN1 or sp|P13186 Saccharomyces
           cerevisiae YLR096w KIN2, hypothetical start
          Length = 944

 Score = 64.3 bits (155), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 54/203 (26%), Positives = 93/203 (45%), Gaps = 23/203 (11%)

Query: 129 LLMELCPNKSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVS-LIHRDIKIENV 187
           +  E      LLDY+ Q  S K   A   K+   +   +S + YL  + ++HRD+KIEN+
Sbjct: 168 MFFEFISGGQLLDYIIQHGSLKENHAR--KVSRGI---LSALQYLHANNIVHRDLKIENI 222

Query: 188 LVDAKNNFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINE 247
           ++      KL DFG ++   P     + +     ++Y      + +PE++  +  L    
Sbjct: 223 MLSKTGEIKLIDFGLSNMYDP----RKSLQTFCGSLY------FAAPELLKAHPYL--GP 270

Query: 248 KSDIWALGVFLYKLLFFTTPFEMTGQFAILHSKYEFPVNKY----SSKLINLIIIMLAEN 303
           + D+W+ GV LY L+    PF+     A LH K +     Y    S  +I+L+  +L  +
Sbjct: 271 EVDVWSFGVVLYVLVCGKVPFDDENSSA-LHEKIKKGKVTYPQFLSIDVISLLSKILVVD 329

Query: 304 PNLRPNIYQVLYHLCEILNVEVP 326
           P  R  + QV+ H   +   + P
Sbjct: 330 PQKRATLQQVVNHQWMLKGYDFP 352

>CAGL0M10153g complement(1010688..1013291) some similarities with
           sp|Q03497 Saccharomyces cerevisiae YHL007c ser/thr
           protein kinase of the pheromone pathway, hypothetical
           start
          Length = 867

 Score = 64.3 bits (155), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 51/176 (28%), Positives = 82/176 (46%), Gaps = 25/176 (14%)

Query: 93  NEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMNQRLSTKLT 152
           NE+ VM   K   NIV Y DS  S       G ++ ++ME      L D +   +   LT
Sbjct: 611 NEIMVMSSSKHQ-NIVNYIDSYLS-------GLDLWVVMEYMEGGCLTDVVTYCV---LT 659

Query: 153 EAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTSTCFPIVTT 212
           E +I  +  +V   +  +H   V  +HRDIK +NVL+    + KL DFG    C  +  T
Sbjct: 660 EGQIGAVCREVLQGLEFLHSKGV--LHRDIKSDNVLLSMNGDIKLTDFG---FCAQVNDT 714

Query: 213 HQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGVFLYKLLFFTTPF 268
                 + +   +  TP + +PE++      P   K DIW+LG+ + +++    P+
Sbjct: 715 ------VIKRTTMVGTPYWMAPEIVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY 761

>Scas_668.22
          Length = 893

 Score = 64.3 bits (155), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 52/176 (29%), Positives = 85/176 (48%), Gaps = 25/176 (14%)

Query: 93  NEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMNQRLSTKLT 152
           NE+ VMK  +  PNIV + DS      DG    ++ ++ME     SL D +   +   LT
Sbjct: 655 NEILVMKGSR-HPNIVNFIDSYL---LDG----DLWVIMEYMEGGSLTDVVTHCI---LT 703

Query: 153 EAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTSTCFPIVTT 212
           E +I  +  +    +  +H   V  +HRDIK +N+L+    + KL DFG    C  I   
Sbjct: 704 EGQIGAVCRETLSGLQFLHSKGV--LHRDIKSDNILLSISGDIKLTDFG---FCAQI--- 755

Query: 213 HQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGVFLYKLLFFTTPF 268
             +I L  +   +  TP + +PE++      P   K DIW+LG+ + +++    P+
Sbjct: 756 -NEINL--KRTTMVGTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY 805

>YLR096W (KIN2) [3511] chr12 (332591..336034) Serine/threonine
           protein kinase, related to Kin1p and S. pombe KIN1 [3444
           bp, 1147 aa]
          Length = 1147

 Score = 64.3 bits (155), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 52/193 (26%), Positives = 91/193 (47%), Gaps = 23/193 (11%)

Query: 129 LLMELCPNKSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVL 188
           +L E      LLDY+ Q  S  L E    K    +A ++  +H    +++HRD+KIEN++
Sbjct: 200 MLFEYVSGGQLLDYIIQHGS--LKEHHARKFARGIASALQYLHA--NNIVHRDLKIENIM 255

Query: 189 VDAKNNFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLP-INE 247
           + +    K+ DFG ++    I    + +     ++Y      + +PE++   +  P    
Sbjct: 256 ISSSGEIKIIDFGLSN----IFDYRKQLHTFCGSLY------FAAPELL---KAQPYTGP 302

Query: 248 KSDIWALGVFLYKLLFFTTPFEMTGQFAILHSKYEFPVNKYSSKL----INLIIIMLAEN 303
           + DIW+ G+ LY L+    PF+     +ILH K +     Y S L    I+L+  M+  +
Sbjct: 303 EVDIWSFGIVLYVLVCGKVPFDDENS-SILHEKIKKGKVDYPSHLSIEVISLLTRMIVVD 361

Query: 304 PNLRPNIYQVLYH 316
           P  R  +  V+ H
Sbjct: 362 PLRRATLKNVVEH 374

>Kwal_26.7154
          Length = 1213

 Score = 64.3 bits (155), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 74/292 (25%), Positives = 128/292 (43%), Gaps = 48/292 (16%)

Query: 36   EVVNYLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGDVACLKRVLVQDENGLNEMRNEV 95
            EV+  + EG + ++ +      +++ D    V   I     L    V+D   L  + +E+
Sbjct: 954  EVLQKMGEGAYGKVDLC-----MHKKDRYIVVIKLIFKERILVDTWVRDRK-LGTIPSEI 1007

Query: 96   EVMKKLKGAPN-----IVQYF-DSNASRRRDGVQGFEVLLLMELCPNKSLLDYMNQRLST 149
            ++M  L   P+     ++ +F D +       V G           +  L D +  +  T
Sbjct: 1008 QIMATLNAKPHENILMLLDFFEDDDYYYIETAVHG--------TSGSIDLFDLIEMK--T 1057

Query: 150  KLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTSTCFPI 209
             +TE E + I   +A  I  +H     ++HRDIK ENV+VD     K+ DFGS +     
Sbjct: 1058 DMTEHEAMLIFKQIASGIKNLH--DNGIVHRDIKDENVIVDCNGFVKIVDFGSAAY---- 1111

Query: 210  VTTHQDIALLTQNIYVHTTPQYRSPEMI--DLYRCLPINEKSDIWALGVFLYKLLFFTTP 267
                  +     +++V T   Y +PE++  + Y   P     DIWA+GV LY +++   P
Sbjct: 1112 ------VKSGPFDVFVGTI-DYAAPEVLGGEPYEGKP----QDIWAIGVLLYTIIYKENP 1160

Query: 268  FEMTGQFAILHSKYEFPVN---KYSSKLINLIIIMLAENPNLRPNIYQVLYH 316
            F    +  IL +  +  VN   + S   I LI  +L  + + RP+I ++  H
Sbjct: 1161 FYNIDE--ILDA--DLRVNSSERISDDCIALIRKILNRSVSKRPSIDEICNH 1208

>KLLA0C03828g 349187..351568 similar to sp|P54199 Saccharomyces
           cerevisiae YDL028c MPS1 serine/threonine/tyrosine
           protein kinase, hypothetical start
          Length = 793

 Score = 63.9 bits (154), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 76/312 (24%), Positives = 127/312 (40%), Gaps = 61/312 (19%)

Query: 28  VCVGTHKVEVVNYLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGDVACLKRVLVQ--DE 85
           + V     E V  L +GG  ++Y VK  ++                V  LKRV     DE
Sbjct: 465 ITVNGTAYEKVELLGKGGSGKVYKVKSSDH---------------KVYALKRVSFDEFDE 509

Query: 86  NGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMNQ 145
           + ++  + E+E++KKL+    +V+  D +         G  VL L+  C    L   + Q
Sbjct: 510 SSIDGFKGEIELLKKLENKQRVVKLIDYHM--------GQGVLFLLMECGEHDLSQVLTQ 561

Query: 146 RLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTST 205
           R      + E V+  +   +   ++ +    ++H D+K  N  V  K   K+ DFG  + 
Sbjct: 562 RSKIPF-DTEFVRYHFQEMIKCVKVVH-DADIVHSDLKPAN-FVFVKGMLKIIDFGIANA 618

Query: 206 CFPIVTTHQDIALLTQNIYVHT---TPQYRSPEMI---DLYR------CLPINEKSDIWA 253
               V  H      T NIY      TP Y +PE +   +  R         + + SD+W+
Sbjct: 619 ----VPDH------TVNIYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWS 668

Query: 254 LGVFLYKLLFFTTPF-EMTGQ---FAILHSKYEFPVNKYSS-------KLINLIIIMLAE 302
            G  LY++++   P+    G    +AI++   + P  +  S        +I+ I   L  
Sbjct: 669 CGCILYQMVYGKPPYGTFQGNNRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLER 728

Query: 303 NPNLRPNIYQVL 314
           NP  R  I Q+L
Sbjct: 729 NPISRVTIDQLL 740

>Scas_602.11
          Length = 1186

 Score = 63.9 bits (154), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 70/301 (23%), Positives = 123/301 (40%), Gaps = 81/301 (26%)

Query: 89  NEMRNEVEVMKKL--KGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMNQR 146
           + ++ E+ +MKKL  K    +++  D   SR+        + L++E C    +       
Sbjct: 226 DRIKREIAIMKKLHHKHVVKLIEVLDDLKSRK--------IYLVLEYCAQGEIKWCPKDC 277

Query: 147 LSTK------LTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADF 200
           L T+      L+     +I+  V L +  +HY    +IHRDIK  N+LVD +   K++DF
Sbjct: 278 LETEAKGPPLLSFQSAREIIRGVILGLEYLHY--QGIIHRDIKPANLLVDEEGTVKISDF 335

Query: 201 G----------STSTCFPIV-----------------TTHQDIALLTQNIYVHT--TPQY 231
           G          ST+    ++                 T + D   + +     T  TP +
Sbjct: 336 GVSLASRSSGNSTANSSSVLGGTPRNLSRSSTESMNTTNNNDDESIDEVELAKTAGTPAF 395

Query: 232 RSPEMI--------------DLYRCLPINEKSDIWALGVFLYKLLFFTTPF--------- 268
            +PE+               ++++   I+   DIWALG+  Y LLF   PF         
Sbjct: 396 FAPEICLGEEAFDKFSLRKNEMFKGSCISFMIDIWALGITFYCLLFGMLPFISDFELELF 455

Query: 269 -EMTGQFAILHSKYEFPVNKYSS--------KLINLIIIMLAENPNLRPNIYQVLYH--L 317
            ++ G+     S  E   N+ S+           N++  +L +NP+ R +I ++ YH  +
Sbjct: 456 EKIVGEPLTFPSYEELQANRVSNVCSIEEYEAAKNVLQRLLEKNPSKRCSILELKYHPFI 515

Query: 318 C 318
           C
Sbjct: 516 C 516

>YGL179C (TOS3) [1812] chr7 complement(163413..165095)
           Serine/threonine protein kinase with similarity to Elm1p
           and Kin82p [1683 bp, 560 aa]
          Length = 560

 Score = 63.2 bits (152), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 52/204 (25%), Positives = 95/204 (46%), Gaps = 24/204 (11%)

Query: 94  EVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMNQRLSTKLTE 153
           E+EVMK+     N+V+ ++       +  +  +V L++E C    +      ++  K   
Sbjct: 104 EIEVMKRCHHE-NVVELYEI-----LNDPESTKVYLVLEYCSRGPVKWCPENKMEIKAVG 157

Query: 154 AEIV------KIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFG---STS 204
             I+      K++ DV   +  +H   ++  HRDIK  N+L+ +    K++DFG   ST+
Sbjct: 158 PSILTFQQSRKVVLDVVSGLEYLHSQGIT--HRDIKPSNLLISSNGTVKISDFGVAMSTA 215

Query: 205 TCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGVFLYKLLFF 264
           T    + +  +  L ++ +    TP + +PE+    +    +   DIW+LGV +Y LLF 
Sbjct: 216 TGSTNIQSSHEQLLKSRAL---GTPAFFAPELCSTEKEYSCSSAIDIWSLGVTIYCLLFG 272

Query: 265 TTPFEMTGQF----AILHSKYEFP 284
             PF          +I++   EFP
Sbjct: 273 KLPFNANSGLELFDSIINKPLEFP 296

>Scas_720.94
          Length = 1683

 Score = 63.9 bits (154), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 67/262 (25%), Positives = 112/262 (42%), Gaps = 49/262 (18%)

Query: 39   NYLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGDVACLKRVLVQDENGLNEM----RNE 94
            N++  G F  +Y              ++V L  G++  +K + +QD   + ++    + E
Sbjct: 1365 NFIGGGTFGTVY--------------SAVNLDNGEILAVKEIKIQDSKTMKKIFPLVKEE 1410

Query: 95   VEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMNQRLSTKLTEA 154
            + V++ L   PNIVQY+       RD V  F     ME C   S    M   L     E 
Sbjct: 1411 MTVLEML-NHPNIVQYY--GVEVHRDKVNIF-----MEYCEGGS----MASLLEHGRIED 1458

Query: 155  EIVKIMYDVALSISQMHYL-PVSLIHRDIKIENVLVDAKNNFKLADFGSTSTCFPIVTTH 213
            E+V  +Y + L +  + YL    ++HRDIK EN+L+D     K  DFG+        T  
Sbjct: 1459 EMVTQVYTLEL-LEGLAYLHQAGVVHRDIKPENILLDFNGIIKYVDFGAARKIAKNGTKV 1517

Query: 214  QDIALLTQNIY-------------VHT---TPQYRSPEMIDLYRCLPINEKSDIWALGVF 257
             +I   +++               VH    TP Y +PE I  Y+        DIW+ G  
Sbjct: 1518 TNINSKSKDDDEPDEKDTEGGANSVHDMLGTPMYMAPESITGYKNKTKFGSDDIWSFGCV 1577

Query: 258  LYKLLFFTTPF-EMTGQFAILH 278
            + +++    P+  +  ++AI++
Sbjct: 1578 VLEMITGRRPWANLDNEWAIIY 1599

>YHL007C (STE20) [2279] chr8 complement(95113..97932)
           Serine/threonine protein kinase of the pheromone
           response pathway, also participates in the filamentous
           growth and STE vegetative growth pathways [2820 bp, 939
           aa]
          Length = 939

 Score = 63.5 bits (153), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 50/176 (28%), Positives = 83/176 (47%), Gaps = 25/176 (14%)

Query: 93  NEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMNQRLSTKLT 152
           NE+ VMK  K  PNIV + DS        V   ++ ++ME     SL D +   +   LT
Sbjct: 664 NEILVMKGSKH-PNIVNFIDSY-------VLKGDLWVIMEYMEGGSLTDVVTHCI---LT 712

Query: 153 EAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTSTCFPIVTT 212
           E +I  +  +    +  +H   V  +HRDIK +N+L+  + + KL DFG  +        
Sbjct: 713 EGQIGAVCRETLSGLEFLHSKGV--LHRDIKSDNILLSMEGDIKLTDFGFCA-------- 762

Query: 213 HQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGVFLYKLLFFTTPF 268
            Q   L  +   +  TP + +PE++      P   K DIW+LG+ + +++    P+
Sbjct: 763 -QINELNLKRTTMVGTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY 814

>Scas_675.2
          Length = 527

 Score = 62.8 bits (151), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 51/189 (26%), Positives = 91/189 (48%), Gaps = 22/189 (11%)

Query: 85  ENGLNE--MRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDY 142
           +NGL E  +  EV +  +    PN+++  D N ++         + ++ME+     L D 
Sbjct: 54  KNGLTEKDISREVLLHSRCSKNPNVLRLIDCNIAKDY-------MWMIMEMADGGDLFDK 106

Query: 143 MNQRLSTKLTEAEIVKIMYD-VALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFG 201
           +   +     ++E+ +  +  +  +IS +H     + HRDIK EN+L+D   N KLADFG
Sbjct: 107 IEPDVGV---DSEVAQFYFQQLVRAISYLHE-ECGVAHRDIKPENILLDKNGNLKLADFG 162

Query: 202 STSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGVFLYKL 261
            +S         +    L  +     +P Y +PE+  L+        +DIW++G+ L+ L
Sbjct: 163 LSS------QYRRKDGTLRISTDQRGSPPYMAPEI--LHSRGYYAHSTDIWSIGILLFVL 214

Query: 262 LFFTTPFEM 270
           L   TP+E+
Sbjct: 215 LTGETPWEL 223

>CAGL0M03729g complement(420316..422901) similar to sp|P48562
           Saccharomyces cerevisiae YNL298w CLA4, start by
           similarity
          Length = 861

 Score = 63.2 bits (152), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 51/203 (25%), Positives = 92/203 (45%), Gaps = 26/203 (12%)

Query: 71  IGDVACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLL 130
           IGD   +K++++  +     + NE+ VM   +   NIV + ++      D      + ++
Sbjct: 606 IGDKVAIKQMVLSKQPRKELIVNEIMVMNDSRHE-NIVNFLEAYLKTEDD------LWVV 658

Query: 131 MELCPNKSLLDYM-----NQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIE 185
           ME     SL D +     N    + L+E +I  I+ +    +  +H    ++IHRDIK +
Sbjct: 659 MEYMEGGSLTDIIENSPTNGSAYSPLSEPQIAYIVRETCKGLKFLH--DKNIIHRDIKSD 716

Query: 186 NVLVDAKNNFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPI 245
           NVL+D K   K+ DFG    C  +       A +        TP + +PE++        
Sbjct: 717 NVLLDTKARVKITDFG---FCAKLTDQRSKRATMV------GTPYWMAPEVVKQKE---Y 764

Query: 246 NEKSDIWALGVFLYKLLFFTTPF 268
           + K D+W+LG+   ++L    P+
Sbjct: 765 DAKVDVWSLGIMAIEMLEGEPPY 787

>CAGL0J03872g 365869..367854 similar to sp|Q01919 Saccharomyces
           cerevisiae YOR233w KIN4 ser/thr protein kinase or
           tr|Q03002 Saccharomyces cerevisiae YPL141c, start by
           similarity
          Length = 661

 Score = 63.2 bits (152), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 41/193 (21%), Positives = 91/193 (47%), Gaps = 24/193 (12%)

Query: 81  LVQDENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVL-LLMELCPNKSL 139
           L++ +  +     E+++ +++    ++      N  R  + +Q  + + +++E       
Sbjct: 84  LIRRDTIVKNSEKEIKIYREINALKHLTH---PNVVRLEEVLQNSKYIGIVLEYASGGEF 140

Query: 140 LDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLAD 199
             Y+ ++   +L E+   ++   +   ++ MH    +L+HRD+K+EN+L+D   N  + D
Sbjct: 141 YKYIQRK--RRLKESTACRLFAQLISGVTYMH--SKNLVHRDLKLENLLLDKNENLVITD 196

Query: 200 FGSTSTCFPIVTTHQDIALLTQNIYVHT---TPQYRSPEMIDLYRCLPINEKSDIWALGV 256
           FG  +   P             N Y+ T   +P Y +PE++   R   +  K+D+W+ G+
Sbjct: 197 FGFVNEFLP------------DNEYMKTSCGSPCYAAPELVISTRPY-VARKADVWSCGI 243

Query: 257 FLYKLLFFTTPFE 269
            LY +L    P++
Sbjct: 244 ILYAMLAGYLPWD 256

>Kwal_26.8709
          Length = 829

 Score = 62.8 bits (151), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 52/236 (22%), Positives = 103/236 (43%), Gaps = 32/236 (13%)

Query: 37  VVNYLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGDVACLKRVLVQDENGLNEMRNEVE 96
           V + L EG F ++     L +    +++  VP ++      +  + ++     ++  E+ 
Sbjct: 42  VGSTLGEGEFGKVK----LGWSKTSNSSMDVPKQVAIKLIRRDTIPKNSEKEIKIYREIN 97

Query: 97  VMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMNQRLSTKLTEAEI 156
            +K L   PNIV+  +   + +  G+       ++E         Y+ ++   +L E   
Sbjct: 98  ALKHL-NHPNIVRLEEVLQNSKYIGI-------VLEYASGGEFYKYIQKK--RRLKEGPA 147

Query: 157 VKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTSTCFPIVTTHQDI 216
            ++   +   +  MH     L+HRD+K+EN+L+D   N  + DFG  +   P        
Sbjct: 148 CRLFAQLISGVYYMHSK--GLVHRDLKLENLLLDKNENLLITDFGFVNEFLP-------- 197

Query: 217 ALLTQNIYVHT---TPQYRSPEMIDLYRCLPINEKSDIWALGVFLYKLLFFTTPFE 269
               +N  + T   +P Y +PE++   R      K+D+W+ GV LY +L    P++
Sbjct: 198 ----ENELMKTSCGSPCYAAPELVVTARPYEA-RKADVWSCGVILYAMLAGYLPWD 248

>Scas_651.18
          Length = 371

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 59/249 (23%), Positives = 107/249 (42%), Gaps = 43/249 (17%)

Query: 117 RRRDGVQGFE-VLLLMELCPNKSLLDYM--NQRLSTKLTEAEIVKIMYDVALSISQMHYL 173
           R     Q FE V ++M+      L   +  +QR    + +        +V L++  +H  
Sbjct: 121 RMWGTFQDFEQVFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAA----EVCLALEYLH-- 174

Query: 174 PVSLIHRDIKIENVLVDAKNNFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRS 233
            + +I+RD+K EN+L+D   + K+ DFG       I  T            +  TP Y +
Sbjct: 175 SMDIIYRDLKPENILLDKNGHIKITDFGFAKYVPDITYT------------LCGTPDYIA 222

Query: 234 PEMIDLYRCLPINEKSDIWALGVFLYKLLFFTTPF----EMTGQFAILHSKYEFPVNKYS 289
           PE++      P N+  D W+ G+ +Y++L   TPF     M     IL+ K +FP N + 
Sbjct: 223 PEVVS---TKPYNKSVDWWSFGILIYEMLAGYTPFYDSNTMKTYENILNCKLKFP-NFFH 278

Query: 290 SKLINLIIIMLAENPNLR--------------PNIYQVLYHLCEILNVEVPIEDKYAEGA 335
             + +L+  ++ +N   R              P   +V++      N+E P E    +G 
Sbjct: 279 DDVKDLLSKLITKNLTERLGNLQNGSEDVKRHPWFSEVIWEKLLSRNIETPYEPPIQQGQ 338

Query: 336 YNFSKYTQF 344
            + S++ ++
Sbjct: 339 GDTSQFDRY 347

>YPL209C (IPL1) [5240] chr16 complement(156489..157592)
           Serine/threonine protein kinase of the mitotic spindle,
           involved in chromosome segregation and activation of the
           spindle checkpoint by detection of kinetochore tension,
           required for proper spindle disassembly and orientation
           [1104 bp, 367 aa]
          Length = 367

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 59/198 (29%), Positives = 89/198 (44%), Gaps = 29/198 (14%)

Query: 76  CLKRVLVQDE----NGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLM 131
           C  +V+ ++E    N   + R EVE+   L   PN+ + +      +R       V LLM
Sbjct: 130 CALKVMEKEEIIKYNLQKQFRREVEIQTSL-NHPNLTKSYGYFHDEKR-------VYLLM 181

Query: 132 ELCPNKSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDA 191
           E   N  +  Y   RL     +      +Y +A ++  MH    ++IHRDIK EN+L+  
Sbjct: 182 EYLVNGEM--YKLLRLHGPFNDILASDYIYQIANALDYMH--KKNIIHRDIKPENILIGF 237

Query: 192 KNNFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDI 251
            N  KL DFG     + I+   ++     +   V  T  Y SPEM++       +   D 
Sbjct: 238 NNVIKLTDFG-----WSIINPPEN-----RRKTVCGTIDYLSPEMVE---SREYDHTIDA 284

Query: 252 WALGVFLYKLLFFTTPFE 269
           WALGV  ++LL    PFE
Sbjct: 285 WALGVLAFELLTGAPPFE 302

>Scas_685.24
          Length = 515

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 64/250 (25%), Positives = 112/250 (44%), Gaps = 34/250 (13%)

Query: 74  VACLKRVLVQDEN-GLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLME 132
           V  +K V +++ N  L  +  E+  + +LK +P I+ Y  +        ++   + ++ME
Sbjct: 47  VVAIKVVDLENTNERLEVLAQEIFFLAELK-SPYIINYITT-------LLEDASMWIVME 98

Query: 133 LCPNKSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAK 192
            C   S  D +    +  L E ++  I  ++   +  +H      IHRDIK  N+L+  +
Sbjct: 99  YCGGGSCSDLLKYYFNNGLPEKKVAYITREILKGLQYLH--EQKKIHRDIKAANILLTEE 156

Query: 193 NNFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEM----IDLYRCLPINEK 248
            + KL DFG          + Q  + L +   V  TP + +PE+    I+ Y     +EK
Sbjct: 157 GHVKLGDFG---------VSGQLKSTLRRGTIVG-TPYWMAPEVASQNIEGY-----DEK 201

Query: 249 SDIWALGVFLYKLLFFTTPFEMTGQFAILH--SKYEFP--VNKYSSKLINLIIIMLAENP 304
            DIW+LG+ +++LL    P        +L   S+   P     YS    + + + L +NP
Sbjct: 202 IDIWSLGITVFELLKGVPPLVKLDPIRVLANLSRKSAPRLQGAYSDAAKSFVALCLIKNP 261

Query: 305 NLRPNIYQVL 314
           N RP    +L
Sbjct: 262 NERPAAVDLL 271

>CAGL0M02519g complement(290723..292993) highly similar to tr|Q03002
           Saccharomyces cerevisiae YPL141c or sp|Q01919
           Saccharomyces cerevisiae YOR233w KIN4, hypothetical
           start
          Length = 756

 Score = 62.8 bits (151), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 69/305 (22%), Positives = 133/305 (43%), Gaps = 60/305 (19%)

Query: 41  LAEGGFAQIYVVKFLEYLNEFDNTAS----------VPLKIGDVACLKR-VLVQDENGLN 89
           L EG F ++ +        + DNT            VP ++  +  +KR  + +D +   
Sbjct: 54  LGEGEFGKVKLAWSKSAYQQCDNTEGNAGNKPMTFKVPKQVA-IKLIKRDFITKDPSKET 112

Query: 90  EMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMNQRLST 149
           ++  E+  +K L   PNIV+  +   + +  G+       ++E         ++ ++   
Sbjct: 113 KIYREINALKHL-SHPNIVKLEEVLQNSKYIGI-------VLEYAAGGEFYKFIQRK--R 162

Query: 150 KLTEAEIVKIMYDVALSISQMHYL-PVSLIHRDIKIENVLVDAKNNFKLADFGSTSTCFP 208
           +L E    ++   +   IS +HY+    L+HRD+K+EN+L+D + N  + DFG  +    
Sbjct: 163 RLKENHACRLFSQL---ISAVHYIHSKGLVHRDLKLENLLLDNEENLIITDFGFVN---- 215

Query: 209 IVTTHQDIALLTQNIYVHT---TPQYRSPEMIDLYRCLPIN-EKSDIWALGVFLYKLLFF 264
                     L QN  + T   +P Y +PE++   R  P +  K+D W+ G+ L+ +L  
Sbjct: 216 --------EFLRQNGMMKTSCGSPCYAAPELVVSNR--PYDARKADTWSCGIILFAMLAG 265

Query: 265 TTPFEMTGQFA-----------ILHSKYEFP--VNKYSSKLINLIIIMLAENPNLRPNIY 311
             P++   +             IL++  +FP  +N     L+  I+++   +P  R NI 
Sbjct: 266 YLPWDDDPKNPDGHDISRLYNYILNTPLKFPEYINPVPRDLLRKILVI---DPKKRINIR 322

Query: 312 QVLYH 316
            +  H
Sbjct: 323 SIEKH 327

>ADL315C [1426] [Homologous to ScYPR054W (SMK1) - SH]
           (146098..147402) [1305 bp, 434 aa]
          Length = 434

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 63/250 (25%), Positives = 107/250 (42%), Gaps = 38/250 (15%)

Query: 16  HPAVERYTPGHIVCVGTHKVEVVNYLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGDVA 75
           HP    YT  +    G +  EV+  L +G +    VV  ++ LN     A+ P++I    
Sbjct: 56  HPPRTIYTKANFSIPGHY--EVLQMLGKGSYGT--VVSAIDNLN-----ANYPIRIA--- 103

Query: 76  CLKRV--LVQDENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRR--DGVQGFEVLLLM 131
            +K++  + Q E  L     E++ M   KG  NIV   +      +  DG+  ++     
Sbjct: 104 -IKKITNIFQREVLLKRAIRELKFMHYFKGHKNIVSLINLEIVNEKPYDGLYCYQ----- 157

Query: 132 ELCPNKSLLDYMNQRL---STKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVL 188
                  L+DY   R+   + + +E  I    Y +   +  +H     +IHRD+K  N+L
Sbjct: 158 ------ELIDYDLARVIHSNVQFSEFHIKHFTYQILCGVKYIH--SADVIHRDLKPGNIL 209

Query: 189 VDAKNNFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEK 248
                  K+ DFG      P+ T  +    +T  +    T  YR+PE+I  ++    N+ 
Sbjct: 210 CSISGQLKICDFGLARGISPLFTNTKTSNHITNYV---ATRWYRAPELILSHK--RYNKS 264

Query: 249 SDIWALGVFL 258
            D+WA+G  L
Sbjct: 265 IDMWAIGCIL 274

>Scas_584.11
          Length = 1074

 Score = 62.8 bits (151), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 50/194 (25%), Positives = 86/194 (44%), Gaps = 47/194 (24%)

Query: 94  EVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMNQRLSTKLTE 153
           EV+++ K+    NIV   D            F+  ++ME C    L + +   L  K T+
Sbjct: 108 EVDILTKVGKHKNIVSLVDY-----------FDSYIIMEYCSGGDLYEAIKDDLVPKKTK 156

Query: 154 AEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKN-NFKLADFGSTSTCFPIVTT 212
             I  I   +  +I  +H    S+ HRDIK EN+L+   +   KL D+G       + TT
Sbjct: 157 T-ITHIFSQIMDAIEFVH--GKSIYHRDIKPENILITGIDWTIKLTDWG-------LATT 206

Query: 213 HQ---DIALLTQNIYVHTTPQYRSPEMID----------LYRCLPINEKSDIWALGVFLY 259
           H+   D ++ ++        +Y +PE+ +           Y+C    +K D+WA+G+   
Sbjct: 207 HETSFDRSVGSE--------RYMAPELFESNLDIEERKEAYKC----DKVDLWAMGIVFL 254

Query: 260 KLLFFTTPFEMTGQ 273
            ++F   PF +  Q
Sbjct: 255 NIVFQKNPFSVANQ 268

>Kwal_33.14167
          Length = 838

 Score = 62.8 bits (151), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 77/313 (24%), Positives = 131/313 (41%), Gaps = 61/313 (19%)

Query: 27  IVCVGTHKVEVVNYLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGDVACLKRVLVQ--D 84
           +V V   + E +  L  GG +++Y VK     N  +N          V  LKRV     D
Sbjct: 507 VVYVNGTEYEKLELLGRGGTSKVYKVK-----NANNNK---------VYALKRVSFDEFD 552

Query: 85  ENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMN 144
           ++ ++  + E+E++KKL+  P +V+  D        GV    + ++ME C +  L   + 
Sbjct: 553 DSSIDGFKGEIELLKKLETQPRVVKLIDHEMDH---GV----LYVVME-CGDHDLSQTLA 604

Query: 145 QRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTS 204
            R    L + E V+      L   ++ +    ++H D+K  N  V  K   K+ DFG  +
Sbjct: 605 HRSGMPL-DVEFVRYHAQEMLKCVKVVH-DAGIVHSDLKPAN-FVFVKGILKIIDFGIAN 661

Query: 205 TCFPIVTTHQDIALLTQNIYVHT---TPQYRSPEMIDLYRC----------LPINEKSDI 251
                V  H      T NIY  T   TP Y +PE +                 + + SDI
Sbjct: 662 A----VPEH------TVNIYRETQIGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDI 711

Query: 252 WALGVFLYKLLFFTTPF-EMTGQ---FAILHSKYEFPVNKYSSK-------LINLIIIML 300
           W+ G  +Y++++   P+    GQ    AI++ + +    + +S         I+ +   L
Sbjct: 712 WSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACL 771

Query: 301 AENPNLRPNIYQV 313
             NPN R  + +V
Sbjct: 772 ERNPNKRWTVEEV 784

>AEL284C [2221] [Homologous to ScYGR052W - SH] (106480..107919)
           [1440 bp, 479 aa]
          Length = 479

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 48/179 (26%), Positives = 76/179 (42%), Gaps = 23/179 (12%)

Query: 91  MRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMNQRLSTK 150
           + NE  ++++L    NI Q  D               + ++E C    L D++       
Sbjct: 55  VHNEYAILRRLGTHRNICQLLDFYEDAD-------TYVFVLEYCAYGDLYDFIKAIRERP 107

Query: 151 LTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTSTCFPIV 210
                    ++ +  +IS  H   VS  HRDIK ENVL+D +   KL DFG +     I 
Sbjct: 108 TMRINFHSFLFQLCSAISYCHSKDVS--HRDIKPENVLMDDRGQVKLTDFGLSQ----IG 161

Query: 211 TTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGVFLYKLLFFTTPFE 269
           +  +D        Y   T +Y +PE     R       +D W+LG+ ++ L+F + PFE
Sbjct: 162 SVSKD--------YCIGTEKYLAPET--FLREYHNTFATDYWSLGITIFCLMFGSCPFE 210

>Scas_633.29
          Length = 789

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 75/312 (24%), Positives = 130/312 (41%), Gaps = 61/312 (19%)

Query: 28  VCVGTHKVEVVNYLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGDVACLKRVLVQ--DE 85
           + V   + E +  L  GG +++Y VK  +                 V  LKRV     D+
Sbjct: 293 ITVNDTEYEKIELLGRGGSSRVYKVKNSQ---------------NKVFALKRVSFDEFDD 337

Query: 86  NGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMNQ 145
           + ++  + E+E+++KL     +V+ FD        GV    + L+ME C +  L   ++Q
Sbjct: 338 SSVDGFKGEIELLEKLSNESRVVKLFDYQMD---SGV----LFLIME-CGDHDLSQILSQ 389

Query: 146 RLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTST 205
           R    L    +     +V   I  +H     ++H D+K  N  V  K   K+ DFG  + 
Sbjct: 390 RSDMPLDMDFVRYHAREVVRCIKIVH--DAGIVHSDLKPAN-FVFVKGILKIIDFGIANA 446

Query: 206 CFPIVTTHQDIALLTQNIYVHT---TPQYRSPEMI---------DLYRCLPINEKSDIWA 253
               +  H      T NIY      TP Y +PE +         D      + + SDIW+
Sbjct: 447 ----IPDH------TVNIYRENQIGTPNYMAPEALVAMNYTNENDGGNKWKVGKPSDIWS 496

Query: 254 LGVFLYKLLFFTTPFE-MTGQ---FAILHSKYEFPVNKYSS-------KLINLIIIMLAE 302
            G  +Y++++   P+    GQ    AI++   +   ++ ++        LI+L+   L  
Sbjct: 497 CGCIIYQMIYGRPPYAGFQGQNRLLAIMNPDVKVIFSEKTANNESIPRSLIDLMKGCLTR 556

Query: 303 NPNLRPNIYQVL 314
           +P  R ++ QVL
Sbjct: 557 DPEKRWSVDQVL 568

>Scas_548.6
          Length = 1382

 Score = 62.4 bits (150), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 52/169 (30%), Positives = 80/169 (47%), Gaps = 22/169 (13%)

Query: 149  TKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTSTCFP 208
            T +TE E   I   +   I  +H     ++HRDIK ENV+VD+K   K+ DFGS +    
Sbjct: 1226 TNMTEFEAKLIFKQIVSGIKHLH--DQGIVHRDIKDENVIVDSKGCVKIIDFGSAAY--- 1280

Query: 209  IVTTHQDIALLTQNIYVHTTPQYRSPEMI--DLYRCLPINEKSDIWALGVFLYKLLFFTT 266
                   +     +++V T   Y +PE++  + Y   P     DIWA+G+ LY ++F   
Sbjct: 1281 -------VKSGPFDVFVGTI-DYAAPEVLSGEPYEGKP----QDIWAIGILLYTIVFKEN 1328

Query: 267  PFEMTGQFAILHSKYEF-PVNKYSSKLINLIIIMLAENPNLRPNIYQVL 314
            PF    +  IL  + +F   N  S   I LI  +L  +   RP I ++ 
Sbjct: 1329 PFYNIDE--ILEGELKFNNSNDISEDCIELIKKILIRSVPKRPLIEEIF 1375

>YJL095W (BCK1) [2820] chr10 (247171..251607) Serine/threonine protein
            kinase of the MEKK family involved in the cell wall
            integrity (low-osmolarity) and nutrient sensing pathways
            [4437 bp, 1478 aa]
          Length = 1478

 Score = 62.4 bits (150), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 72/298 (24%), Positives = 123/298 (41%), Gaps = 63/298 (21%)

Query: 41   LAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGDVACLKRVLVQDENGLNE--------MR 92
            + +G F  +Y+      LN         +  G++  +K+V V   +  NE        +R
Sbjct: 1181 IGKGSFGAVYLC-----LN---------VTTGEMMAVKQVEVPKYSSQNEAILSTVEALR 1226

Query: 93   NEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFE-----VLLLMELCPNKSLLDYMNQRL 147
            +EV  +K L    NIVQY             GFE       L +E     S+   +  R+
Sbjct: 1227 SEVSTLKDLDHL-NIVQYL------------GFENKNNIYSLFLEYVAGGSVGSLI--RM 1271

Query: 148  STKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTSTCF 207
              +  E  I  +   V   ++ +H     ++HRD+K +N+L+D     K++DFG      
Sbjct: 1272 YGRFDEPLIKHLTTQVLKGLAYLHS--KGILHRDMKADNLLLDQDGICKISDFG------ 1323

Query: 208  PIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGVFLYKLLFFTTP 267
             I    +DI     ++ +  T  + +PEM+D  +    + K DIW+LG  + ++     P
Sbjct: 1324 -ISRKSKDI-YSNSDMTMRGTVFWMAPEMVDTKQGY--SAKVDIWSLGCIVLEMFAGKRP 1379

Query: 268  FE----MTGQFAILHSKYEFPVNKYSSKLI-----NLIIIMLAENPNLRPNIYQVLYH 316
            +     +   F I  SK   P+ + +  LI     N +      NP  RP   ++L H
Sbjct: 1380 WSNLEVVAAMFKIGKSKSAPPIPEDTLPLISQIGRNFLDACFEINPEKRPTANELLSH 1437

>YJL187C (SWE1) [2737] chr10 complement(76802..79261)
           Serine/tyrosine dual-specificity protein kinase,
           phosphorylates Cdc28p on tyrosine and inhibits its
           activity, involved in G2 phase cell-cycle checkpoint
           control [2460 bp, 819 aa]
          Length = 819

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 57/227 (25%), Positives = 114/227 (50%), Gaps = 30/227 (13%)

Query: 38  VNYLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGDVACLKRVLVQDENGLNEMRNEVEV 97
           V+ + +G F+ +Y V F +   ++   A  P K      LKR+L++ +  LNE+ N++ +
Sbjct: 447 VHSIGKGQFSTVYQVTFAQTNKKYAIKAIKPNKYN---SLKRILLEIK-ILNEVTNQITM 502

Query: 98  MKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMNQRLSTK---LTEA 154
            ++  G   I+ Y  S   +           ++ ELC N +L  ++ +++  K   L + 
Sbjct: 503 DQE--GKEYIIDYISSWKFQN-------SYYIMTELCENGNLDGFLQEQVIAKKKRLEDW 553

Query: 155 EIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTSTCFPIVTTHQ 214
            I KI+ +++L++  +H     ++H D+K  NV++  + N KL DFG        + TH 
Sbjct: 554 RIWKIIVELSLALRFIHD-SCHIVHLDLKPANVMITFEGNLKLGDFG--------MATH- 603

Query: 215 DIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGVFLYKL 261
            + L  ++       +Y +PE+I    C   + K+DI++LG+ + ++
Sbjct: 604 -LPLEDKSFENEGDREYIAPEIIS--DCT-YDYKADIFSLGLMIVEI 646

>Scas_713.21
          Length = 641

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 80/337 (23%), Positives = 144/337 (42%), Gaps = 67/337 (19%)

Query: 30  VGTHKVEVVNYLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGDVACLKRVLVQ--DENG 87
           +   ++ +V  L +GG +++Y V+        D T       G    LK++L++  DEN 
Sbjct: 316 ITDEELSIVELLGKGGSSKVYKVQ--------DRT-------GKYYALKQILLEELDENL 360

Query: 88  LNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMNQRL 147
             ++  E+E++K+L     +V+  +     R        V +LME C N  L   +++R+
Sbjct: 361 KTDLEREIELLKRLAREERVVKLIEYKIDDRM-------VQVLME-CGNFDLSHVLHERV 412

Query: 148 STKLTEAEIVKIM-YDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTSTC 206
           +    +   V++M  ++   I  +H     ++H D+K  N +   K   KL DFG  +  
Sbjct: 413 NRPF-DINFVRLMSKEMIECIKAVH--DSDIVHSDLKPANFIF-VKGTLKLIDFGIAN-- 466

Query: 207 FPIVTTHQDIALLTQNIYVHT---TPQYRSPEMI--------DLYRCLPINEKSDIWALG 255
                    IA  T N+Y +T   TP Y +PE +        +      I + SDIW+ G
Sbjct: 467 --------KIADNTLNVYRNTQMGTPNYMAPETLISQNYSNNNNNLLWKIGKPSDIWSYG 518

Query: 256 VFLYKLLFFTTPF-EMTGQ---FAILHS--KYEFP-----VNKYSSKLINLIIIMLAENP 304
             LY++ +   P+    G     AI++   + ++P       K    L+ LI   L  +P
Sbjct: 519 CILYQMTYGHPPYSSFLGHDRLLAIMNPNIQIDYPNESPCGKKVPQSLVALIKTCLNRDP 578

Query: 305 NLRPNIYQVLYHLCEILN---VEVPIEDKYAEGAYNF 338
            LR    ++ +  C   N   +  P  +   + A N+
Sbjct: 579 QLRATTDEIQH--CSFFNPMIISKPFLESLIDNAINY 613

>Scas_700.34
          Length = 864

 Score = 61.6 bits (148), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 53/230 (23%), Positives = 105/230 (45%), Gaps = 24/230 (10%)

Query: 41  LAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGDVACLKRVLVQDENGLNEMRNEVEVMKK 100
           L EG F ++ +      L    +   VP ++      +  + +D +   ++  E+  +K 
Sbjct: 54  LGEGEFGKVKLGWPKNSLPSSSSGIDVPKQVAIKLIRRDTISKDSSKEIKIYREINALKH 113

Query: 101 LKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMNQRLSTKLTEAEIVKIM 160
           L   PNIV+  +   + +  G+       ++E         Y+ ++   +L E    ++ 
Sbjct: 114 L-THPNIVKLEEVLQNSKYIGI-------VLEYASGGEFYKYIQRK--KRLKEGPACRLF 163

Query: 161 YDVALSISQMHYL-PVSLIHRDIKIENVLVDAKNNFKLADFGSTSTCFPIVTTHQDIALL 219
              A  I+ +HY+    L+HRD+K+EN+L+D   N  + DFG  S  +    +H ++   
Sbjct: 164 ---AQLINGVHYIHSKGLVHRDLKLENLLLDKHENLIITDFGFVSEFY----SHGELMKT 216

Query: 220 TQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGVFLYKLLFFTTPFE 269
           +       +P Y +PE++   +     +K+DIW+ GV LY +L    P++
Sbjct: 217 SCG-----SPCYAAPELVVSTKPYEA-KKADIWSCGVILYAMLAGYLPWD 260

>CAGL0H00979g complement(94328..95527) similar to tr|Q12003
           Saccharomyces cerevisiae YPL236c, hypothetical start
          Length = 399

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 45/160 (28%), Positives = 79/160 (49%), Gaps = 9/160 (5%)

Query: 166 SISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTSTCFPIVTTHQDIALLTQNIYV 225
           SIS    +PVS  H+ +   N++  +     +++ GS S     + T + +  L + +  
Sbjct: 236 SISTTSVVPVSYSHKMLSPSNIIFSSNGLPIISELGSCSKADVEIKTAKQLNRLREWVDD 295

Query: 226 HTTPQYRSPEMIDLYRCLPINEKSDIWALGVFLYKLLFFTTPFEMTGQ-------FAILH 278
           +    Y +PE +DL     ++ K D+W+ G   Y LLF   PFE   Q       +AI  
Sbjct: 296 NFN-SYMAPEFLDLKTNSKLSTKVDVWSFGCICYALLFGMNPFEREEQLYGASIKYAIST 354

Query: 279 SKYEFPV-NKYSSKLINLIIIMLAENPNLRPNIYQVLYHL 317
            K+ FP  ++YS  ++++I   L  +P+ RP++  VL +L
Sbjct: 355 GKFSFPSQSRYSDSILDIIRSCLQVDPSERPSVSIVLNNL 394

>CAGL0F03311g complement(327599..330736) similar to sp|P38691
           Saccharomyces cerevisiae YHR082c KSP1 ser/thr protein
           kinase, start by similarity
          Length = 1045

 Score = 61.6 bits (148), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 51/196 (26%), Positives = 88/196 (44%), Gaps = 42/196 (21%)

Query: 90  EMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMNQRLST 149
           E   EV++  K+    NIVQ +D            F+  ++ME C    L + +   L  
Sbjct: 122 EAMYEVDIQTKIGFHENIVQLYDF-----------FDSYIIMEYCSGGDLYEAIKDDLVP 170

Query: 150 KLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFK--LADFGSTSTCF 207
           K T+ EI  I+  +  +I  +H     + HRDIK EN+L+ +  ++K  L D+G  +T  
Sbjct: 171 KKTK-EITHILTQILDAIEFVHN--KQIYHRDIKPENILITSLIDWKIKLTDWGLATT-- 225

Query: 208 PIVTTHQDIALLTQNIYVHTTPQYRSPEM----IDL------YRCLPINEKSDIWALGVF 257
                  D     +N+    + +Y  PE+    +D+      Y C     K D+W++G+ 
Sbjct: 226 -------DEKSYDRNV---GSERYMPPELFESNLDIDERKEPYDC----SKVDLWSIGIV 271

Query: 258 LYKLLFFTTPFEMTGQ 273
              ++F+  PF +  Q
Sbjct: 272 FLNVVFYKNPFRIADQ 287

>AAR009W [195] [Homologous to ScYOL016C (CMK2) - SH; ScYFR014C
           (CMK1) - SH] complement(358947..360308) [1362 bp, 453
           aa]
          Length = 453

 Score = 60.5 bits (145), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 73/266 (27%), Positives = 117/266 (43%), Gaps = 54/266 (20%)

Query: 67  VPLKIGDVACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFE 126
           V +KI     LKR L  +E  L  + +E+ +++KL   PNIV++ D   SR +       
Sbjct: 82  VAIKI----LLKRALKGNE--LQMLYDELSILQKLD-HPNIVKFKDWFESREK------- 127

Query: 127 VLLLMELCPNKSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIEN 186
             ++ +L     L D + ++   K TE + VKI+  +  ++  MH    +++HRD+K EN
Sbjct: 128 FYIVTQLATGGELFDRILKK--GKFTETDAVKIVVQMLTAVEYMH--SQNVVHRDLKPEN 183

Query: 187 VL-VDAKNNFKL--ADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQ---YRSPEMIDLY 240
           VL +D  +  +L  +DFG                L +++  +H       Y +PE++   
Sbjct: 184 VLYLDPSDESQLVISDFGIAKQ------------LSSESQLIHRAAGSMGYVAPEVLTTS 231

Query: 241 RCLPINEKSDIWALGVFLYKLLFFTTPF--EMTGQF----------AILHSKYEFPVNKY 288
                 +  DIW+LGV  Y LL   +PF  E T  F             HS Y    N  
Sbjct: 232 GH---GKPCDIWSLGVITYTLLCGYSPFIAESTEGFLEEVFSGSDPVTFHSPY---WNNI 285

Query: 289 SSKLINLIIIMLAENPNLRPNIYQVL 314
           S +    I+  L   P  RP   ++L
Sbjct: 286 SKEAKQFILRALTLTPARRPTAAELL 311

>YDL159W (STE7) [712] chr4 (172482..174029)
           Serine/threonine/tyrosine protein kinase of MAP kinase
           kinase (MAPKK or MEK) family, component of pheromone
           response, filamentous growth, and STE vegetative growth
           pathways [1548 bp, 515 aa]
          Length = 515

 Score = 60.5 bits (145), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 56/199 (28%), Positives = 97/199 (48%), Gaps = 36/199 (18%)

Query: 88  LNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMN--- 144
           +N++  E+ ++K +K   NI+ ++ +  ++  +     E+++LME     SL   ++   
Sbjct: 232 INQLVRELSIVKNVKPHENIITFYGAYYNQHINN----EIIILMEYSDCGSLDKILSVYK 287

Query: 145 ---QR--LSTKLT---EAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFK 196
              QR  +S+K T   E  I KI Y V   +  + Y    +IHRDIK  NVL+++K   K
Sbjct: 288 RFVQRGTVSSKKTWFNELTISKIAYGVLNGLDHL-YRQYKIIHRDIKPSNVLINSKGQIK 346

Query: 197 LADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMI--DLYRCLPINEKSDIWAL 254
           L DFG +      +           + +V T+  Y SPE I  ++Y       K D+W+L
Sbjct: 347 LCDFGVSKKLINSIA----------DTFVGTS-TYMSPERIQGNVYSI-----KGDVWSL 390

Query: 255 GVFLYKLLFFTTPFEMTGQ 273
           G+ + +L+  T  F + G 
Sbjct: 391 GLMIIELV--TGEFPLGGH 407

>ACR281C [1328] [Homologous to ScYOL045W - SH; ScYAL017W (FUN31) - SH]
            (864528..868307) [3780 bp, 1259 aa]
          Length = 1259

 Score = 61.2 bits (147), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 50/167 (29%), Positives = 78/167 (46%), Gaps = 22/167 (13%)

Query: 147  LSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTSTC 206
            L T +TE E   +   VA  +  +H     ++HRDIK ENV+VD +   K+ DFGS +  
Sbjct: 1101 LKTNMTEHEAKLLFKQVASGLRHLH--ENGIVHRDIKDENVIVDNRGRVKIIDFGSAAY- 1157

Query: 207  FPIVTTHQDIALLTQNIYVHTTPQYRSPEMI--DLYRCLPINEKSDIWALGVFLYKLLFF 264
                     +     +++V T   Y +PE++  D Y   P     D+WA+GV LY +++ 
Sbjct: 1158 ---------VKRGPFDVFVGTI-DYAAPEVLGGDPYEGKP----QDVWAVGVLLYTIIYK 1203

Query: 265  TTPFEMTGQFAILHSKYEF-PVNKYSSKLINLIIIMLAENPNLRPNI 310
              PF    +  IL       P    S + + LI  +L  + N RP +
Sbjct: 1204 ENPFYNIDE--ILDGDLRISPAVVVSEECVALITRILNRSVNRRPTV 1248

>KLLA0B13112g complement(1146006..1148198) similar to sp|P23561
           Saccharomyces cerevisiae YLR362w STE11 ser/thr protein
           kinase of the MEKK family, start by similarity
          Length = 730

 Score = 60.8 bits (146), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 46/193 (23%), Positives = 91/193 (47%), Gaps = 25/193 (12%)

Query: 88  LNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMNQRL 147
           ++ +++E+ ++K+L    NIV Y+ S+        +G  + + +E  P  S+   +N   
Sbjct: 512 IDALQHEMNILKELH-HENIVTYYGSSQ-------EGGNLNIFLEYVPGGSVSSMLNNY- 562

Query: 148 STKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTSTCF 207
                E  +      + + ++ +H    ++IHRDIK  N+L+D K   K+ DFG +    
Sbjct: 563 -GPFDEPLVKNFTRQILIGLAYLH--KRNIIHRDIKGANILIDIKGGVKITDFGISKKLS 619

Query: 208 PIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGVFLYKLLFFTTP 267
           P+       A L  ++Y      + +PE++   + +   EK+DIW++G  + ++     P
Sbjct: 620 PLNKQQNKRASLQGSVY------WMAPEVV---KQVVTTEKADIWSVGCVIVEMFTGKHP 670

Query: 268 F----EMTGQFAI 276
           F    +M   F I
Sbjct: 671 FPDFSQMQAIFKI 683

>CAGL0C05005g complement(467626..470856) similar to sp|P27636
           Saccharomyces cerevisiae YAR019c CDC15, hypothetical
           start
          Length = 1076

 Score = 60.8 bits (146), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 70/252 (27%), Positives = 120/252 (47%), Gaps = 44/252 (17%)

Query: 75  ACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGF-----EVLL 129
             +K V  QD++ L ++ +E++++K L    NIV+Y             GF      + +
Sbjct: 48  VAIKEVNYQDDDELVDIMSEIDLLKNLNHI-NIVKY------------HGFIQKQHNLYI 94

Query: 130 LMELCPNKSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYL-PVSLIHRDIKIENVL 188
           ++E C   SL + +++       EA+       V  +++ ++YL    +IHRDIK  N+L
Sbjct: 95  ILEYCAKGSLKNLISRNRPMSEHEAKPY-----VRQTLNGLNYLHEQGVIHRDIKAANIL 149

Query: 189 VDAKNNFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEK 248
           +D++N  KLADFG        V+T  +   +T    +  +  + +PE+I       +   
Sbjct: 150 LDSENVVKLADFG--------VSTKVNNTAMT----LAGSLNWMAPEIIGNRGASTL--- 194

Query: 249 SDIWALGVFLYKLLFFTTPF----EMTGQFAILHSKYEFPVNKYSSKLINLIIIMLAENP 304
           SDIW+LG  + +LL    PF    +M   +AI +  Y FP +  SS   + +    A+N 
Sbjct: 195 SDIWSLGATVVELLTGNPPFHNLIDMNIYYAIENDSY-FPPSSLSSGAKDFLQQCFAKNM 253

Query: 305 NLRPNIYQVLYH 316
             RP   Q+L H
Sbjct: 254 YKRPTAVQLLQH 265

>KLLA0B13607g 1191592..1194561 weakly similar to sp|Q03497
           Saccharomyces cerevisiae YHL007c STE20 ser/thr protein
           kinase of the pheromone pathway, hypothetical start
          Length = 989

 Score = 60.8 bits (146), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 51/176 (28%), Positives = 83/176 (47%), Gaps = 25/176 (14%)

Query: 93  NEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMNQRLSTKLT 152
           NE+ VMK  K   NIV + DS   R        ++ ++ME     SL D +   +   LT
Sbjct: 742 NEILVMKGSKHN-NIVNFIDSYLFRG-------DLWVVMEYMEGGSLTDVVTHCI---LT 790

Query: 153 EAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTSTCFPIVTT 212
           E +I  +  +    +  +H   V  IHRDIK +N+L+    + KL DFG    C  I   
Sbjct: 791 EGQIGAVSRETLKGLQFLHSKGV--IHRDIKSDNILLSMNGDIKLTDFG---FCAQI--- 842

Query: 213 HQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGVFLYKLLFFTTPF 268
             ++ L  +   +  TP + +PE++      P   K DIW+LG+ + +++    P+
Sbjct: 843 -NEVNL--KRTTMVGTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY 892

>AEL149C [2357] [Homologous to ScYJL187C (SWE1) - SH]
           (348350..350533) [2184 bp, 727 aa]
          Length = 727

 Score = 60.5 bits (145), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 56/227 (24%), Positives = 103/227 (45%), Gaps = 31/227 (13%)

Query: 38  VNYLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGDVACLKRVLVQDENGLNEMRNEVEV 97
           V  L  G F+ +Y V F E   ++   +  P K       +  ++Q+   L+E+  E   
Sbjct: 395 VTLLGRGQFSTVYQVTFPETSAKYAVKSMAPKKHYS----RSRIIQEIQLLSEISQET-- 448

Query: 98  MKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMNQRL---STKLTEA 154
               +G   +VQ+  S         QG     + ELC N +L  ++ ++L   S +L + 
Sbjct: 449 -SDAEGREYVVQFISSWE------YQG-TYYAMTELCENGNLDQFLQEQLVARSKRLEDW 500

Query: 155 EIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTSTCFPIVTTHQ 214
            I KI+ +V L +  +H    S++H D+K  N+++  + N KL DFG  +T  P+     
Sbjct: 501 RIWKIIVEVCLGLRFLHET-CSIVHLDLKPANIMITFEGNLKLGDFG-MATKLPLT---- 554

Query: 215 DIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGVFLYKL 261
           D A   +    +  P+  S  + D         ++DI++LG+ + ++
Sbjct: 555 DKAFENEGDREYIAPEIISDGIYDF--------RADIFSLGLMIVEI 593

>YPL203W (TPK2) [5245] chr16 (166255..167397) Catalytic subunit of
           cAMP-dependent protein kinase 2, protein kinase A or PKA
           [1143 bp, 380 aa]
          Length = 380

 Score = 59.7 bits (143), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 64/261 (24%), Positives = 109/261 (41%), Gaps = 52/261 (19%)

Query: 33  HKVEVVNYLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGDVACLKRVLVQDENGLNEMR 92
           H  +++  L  G F ++++V+ +     +   A   LK   V  +K+V         E  
Sbjct: 68  HDFQIMRTLGTGSFGRVHLVRSVHNGRYY---AIKVLKKQQVVKMKQV---------EHT 115

Query: 93  NEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYM--NQRLS-- 148
           N+   M KL   P +++ + +    R        + ++M+      L   +  +QR    
Sbjct: 116 NDERRMLKLVEHPFLIRMWGTFQDAR-------NIFMVMDYIEGGELFSLLRKSQRFPNP 168

Query: 149 -TKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTSTCF 207
             K   AE++     +AL     H    ++I+RD+K EN+L+D   + K+ DFG      
Sbjct: 169 VAKFYAAEVI-----LALEYLHAH----NIIYRDLKPENILLDRNGHIKITDFGFAKEVQ 219

Query: 208 PIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGVFLYKLLFFTTP 267
            +  T            +  TP Y +PE+I      P N+  D W+LGV +Y++L   TP
Sbjct: 220 TVTWT------------LCGTPDYIAPEVIT---TKPYNKSVDWWSLGVLIYEMLAGYTP 264

Query: 268 F----EMTGQFAILHSKYEFP 284
           F     M     IL  K  +P
Sbjct: 265 FYDTTPMKTYEKILQGKVVYP 285

>YAL017W (PSK1) [51] chr1 (120228..124298) Serine/threonine protein
            kinase involved in the regulation of carbohydrate
            storage, has similarity to human PIM-1 oncogene [4071 bp,
            1356 aa]
          Length = 1356

 Score = 60.8 bits (146), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 41/124 (33%), Positives = 61/124 (49%), Gaps = 19/124 (15%)

Query: 147  LSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTSTC 206
              T +TE E   I   V   I  +H     ++HRDIK ENV+VD+K   K+ DFGS +  
Sbjct: 1198 FKTNMTEFEAKLIFKQVVAGIKHLH--DQGIVHRDIKDENVIVDSKGFVKIIDFGSAAY- 1254

Query: 207  FPIVTTHQDIALLTQNIYVHTTPQYRSPEMI--DLYRCLPINEKSDIWALGVFLYKLLFF 264
                     +     +++V T   Y +PE++  + Y   P     DIWA+G+ LY ++F 
Sbjct: 1255 ---------VKSGPFDVFVGTI-DYAAPEVLGGNPYEGQP----QDIWAIGILLYTVVFK 1300

Query: 265  TTPF 268
              PF
Sbjct: 1301 ENPF 1304

>KLLA0F07623g 720246..723935 similar to sp|P31374 Saccharomyces
            cerevisiae YAL017w FUN31, start by similarity
          Length = 1229

 Score = 60.5 bits (145), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 43/124 (34%), Positives = 62/124 (50%), Gaps = 19/124 (15%)

Query: 147  LSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTSTC 206
            L T +TE E   +   VA  I  +H     ++HRDIK ENV+VD K   KL DFGS +  
Sbjct: 1071 LKTNMTEFEAKLLFKQVASGIKHLH--DNGIVHRDIKDENVIVDNKGFVKLIDFGSAAY- 1127

Query: 207  FPIVTTHQDIALLTQNIYVHTTPQYRSPEMI--DLYRCLPINEKSDIWALGVFLYKLLFF 264
                     +     +++V T   Y +PE++  + Y   P     DIWA+GV LY +++ 
Sbjct: 1128 ---------VKSGPFDVFVGTI-DYAAPEVLGGEPYEGKP----QDIWAIGVLLYTIIYK 1173

Query: 265  TTPF 268
              PF
Sbjct: 1174 ENPF 1177

>CAGL0M08404g complement(836791..838179) some similarities with
           sp|P05986 Saccharomyces cerevisiae YKL166c TPK3 or
           sp|P06244 Saccharomyces cerevisiae YJL164c SRA3 or
           sp|P06245 Saccharomyces cerevisiae YPL203w TPK2,
           hypothetical start
          Length = 462

 Score = 59.7 bits (143), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 42/142 (29%), Positives = 67/142 (47%), Gaps = 27/142 (19%)

Query: 162 DVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTSTCFPIVTTHQDIALLTQ 221
           +V L++  +H     +I+RD+K EN+L+D   + K+ DFG       +  T         
Sbjct: 258 EVCLALEYLH--SKEIIYRDLKPENILLDKNGHIKITDFGFAKYVPDVTYT--------- 306

Query: 222 NIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGVFLYKLLFFTTPF----EMTGQFAIL 277
              +  TP Y +PE++      P N+  D W+ G+ +Y++L   TPF     M     IL
Sbjct: 307 ---LCGTPDYIAPEVVS---TKPYNKSVDWWSFGILIYEMLAGYTPFYDANTMKTYEHIL 360

Query: 278 HSKYEFP------VNKYSSKLI 293
           +S+ +FP      V    SKLI
Sbjct: 361 NSELKFPSFFHPDVQDLLSKLI 382

>AEL115C [2391] [Homologous to ScYKL166C (TPK3) - SH; ScYJL164C
           (TPK1) - SH] (405062..406222) [1161 bp, 386 aa]
          Length = 386

 Score = 59.3 bits (142), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 49/201 (24%), Positives = 93/201 (46%), Gaps = 36/201 (17%)

Query: 162 DVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTSTCFPIVTTHQDIALLTQ 221
           +V L++  +H     +I+RD+K EN+L+D   + KL DFG       +  T         
Sbjct: 182 EVCLALEYLH--SKDIIYRDLKPENILLDKNGHIKLTDFGFAKYVPDVTYT--------- 230

Query: 222 NIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGVFLYKLLFFTTPF---EMTGQFA-IL 277
              +  TP Y +PE++      P N+  D W+ G+ +Y++L   TPF      G +  IL
Sbjct: 231 ---LCGTPDYIAPEVVS---TKPYNKSVDWWSFGILIYEMLAGYTPFYDQNTMGTYENIL 284

Query: 278 HSKYEFPVNKYSSKLINLIIIMLAENPNLR--------------PNIYQVLYHLCEILNV 323
           +++ +FP   +++K+ +L+  ++  + + R              P   +V++      N+
Sbjct: 285 NAEVKFP-PFFNAKVRDLLSQLITRDLSKRLGNLQNGSQDVKAHPWFSEVIWDKLLCRNI 343

Query: 324 EVPIEDKYAEGAYNFSKYTQF 344
           E P E     G  + S+Y ++
Sbjct: 344 ETPYEPPIHAGQGDTSQYDRY 364

>Sklu_1603.2 YPR054W, Contig c1603 1858-3324 reverse complement
          Length = 488

 Score = 59.7 bits (143), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 46/183 (25%), Positives = 81/183 (44%), Gaps = 23/183 (12%)

Query: 81  LVQDENGLNEMRNEVEVMKKLKGAPNIVQYFDSN--ASRRRDGVQGFEVLLLMELCPNKS 138
           +   E  L     E++ M   KG  NI+   D +  + +  DG+  ++            
Sbjct: 158 IFHREVLLKRAIRELKFMNYFKGHKNIINLLDLDIVSEKPYDGLYCYQ-----------E 206

Query: 139 LLDYMNQRL---STKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNF 195
           L+DY   R+   S +L+E  I   +Y +   +  +H     +IHRD+K  N+L     N 
Sbjct: 207 LIDYDLARVIHSSVQLSEFHIKSFLYQILCGLKYIH--SADVIHRDLKPGNILCTIHGNL 264

Query: 196 KLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALG 255
           K+ DFG      P     + ++ +T  +    T  YR+PE+I  ++    ++  D+WA+G
Sbjct: 265 KICDFGLARGVSPQFFQGRTVSHITNYV---ATRWYRAPELILSHK--NYSKAIDMWAVG 319

Query: 256 VFL 258
             L
Sbjct: 320 CIL 322

>CAGL0L03520g complement(401103..405446) similar to sp|Q01389
            Saccharomyces cerevisiae YJL095w BCK1, start by
            similarity
          Length = 1447

 Score = 60.1 bits (144), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 69/299 (23%), Positives = 123/299 (41%), Gaps = 65/299 (21%)

Query: 41   LAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGDVACLKRVLVQDENGLNEM--------R 92
            + +G F  +Y+              S+ +  G++  +K+V V      NE+        +
Sbjct: 1157 IGKGSFGAVYL--------------SLNITTGEMMAVKQVEVPKYGTQNELVKDMVEALK 1202

Query: 93   NEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMNQRLSTKLT 152
            +EV  +K L    NIVQY  S        ++G    L +E     S+   +  RL  +  
Sbjct: 1203 SEVATLKDLDHL-NIVQYLGSE-------IRGNIYSLFLEYVAGGSVGSLI--RLYGRFD 1252

Query: 153  EAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTSTCFPIVTT 212
            E  I  +   V   +  +H     ++HRD+K +N+L+D     K++DFG           
Sbjct: 1253 EKLIRHLNTQVLSGLKYLH--SKGILHRDMKADNLLLDEDGICKISDFG----------- 1299

Query: 213  HQDIALLTQNIYVHT------TPQYRSPEMIDLYRCLPINEKSDIWALGVFLYKLLFFTT 266
               I+  ++NIY ++      T  + +PEM+D  +    + K DIW+LG  + ++     
Sbjct: 1300 ---ISKKSKNIYSNSDMTMRGTVFWMAPEMVDTKQGY--SAKVDIWSLGCVVLEMFAGKR 1354

Query: 267  PFE----MTGQFAILHSKYEFPVNKYSSKLI-----NLIIIMLAENPNLRPNIYQVLYH 316
            P+     +   F I  SK   P+   + +LI     + +      +P  RP    +L H
Sbjct: 1355 PWSNLEVVAAMFQIGKSKSAPPIPDDTIQLISSKGKDFLSKCFEIDPEKRPTADDLLEH 1413

>CAGL0I09504g 909319..910905 similar to sp|P38147 Saccharomyces
           cerevisiae YBR274w CHK1 regulats inhibitory Cdk
           phosphorylation of PDS1, start by similarity
          Length = 528

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 70/299 (23%), Positives = 129/299 (43%), Gaps = 54/299 (18%)

Query: 35  VEVVNYLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGDVACLKRVLVQDENGLNE--MR 92
           VE+   + EG F  +   +      +FD++  V +K   +          E+GL++  + 
Sbjct: 14  VELGGTIGEGSFGCVRSARL-----KFDSSVVVAVKFVHLPTCA------ESGLSQKDVS 62

Query: 93  NEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMNQRLSTKLT 152
            EV +  K     N+++  D N       V G  + +++E+     L D +   +     
Sbjct: 63  REVVLHSKCSKHANVLRVIDCN-------VGGEYLWIMLEMADGGDLFDKIEPDVGV--- 112

Query: 153 EAEIVKIMYDVALSISQMHYL-PVSLIHRDIKIENVLVDAKNNFKLADFGSTSTCFPIVT 211
           + ++ +  +     I  ++YL  V + HRDIK EN+L+D K N KLADFG  S       
Sbjct: 113 DPDVAQFYFQQL--IRALNYLHDVGVAHRDIKPENILLDKKGNLKLADFGLAS------Q 164

Query: 212 THQDIALLTQNIYVHTTPQYRSPEMID---LYRCLPINEKSDIWALGVFLYKLLFFTTPF 268
             +    L  +     +P Y +PE++     Y  +     +DIW+ GV L+ LL    P+
Sbjct: 165 FRRKDGTLRVSTDQRGSPPYMAPEILSSQGYYANI-----TDIWSAGVLLFVLLTGEIPW 219

Query: 269 EMTGQFAILHSKYEFPVN-----------KYSSKLINLIIIMLAENPNLRPNIYQVLYH 316
            +  +       YE+ VN           +   + +NL+  +L  +P  R ++ ++ +H
Sbjct: 220 SIPAK---EDDNYEWFVNNEGKVSLGPWERVELRQMNLLRKILQPDPRKRVSLEKLRHH 275

>YNR031C (SSK2) [4613] chr14 complement(680693..685432) MAP kinase
            kinase kinase (MAPKKK) involved in the high-osmolarity
            signal transduction pathway [4740 bp, 1579 aa]
          Length = 1579

 Score = 60.1 bits (144), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 72/311 (23%), Positives = 132/311 (42%), Gaps = 62/311 (19%)

Query: 39   NYLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGDVACLKRVLVQDENGLNEM----RNE 94
            N++  G F ++Y              ++V L  G++  +K + +QD   + ++    + E
Sbjct: 1270 NFIGGGTFGRVY--------------SAVDLDNGEILAVKEINIQDSKSMQKIFPLIKEE 1315

Query: 95   VEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMNQRLSTKLTEA 154
            + V++ L   PNIV Y+     R +       V + ME C   SL       L     E 
Sbjct: 1316 MSVLEIL-NHPNIVSYYGVEVHRDK-------VNIFMEYCEGGSLA----ALLEHGRIED 1363

Query: 155  EIVKIMYDVALSISQMHYLPVS-LIHRDIKIENVLVDAKNNFKLADFGSTSTCFPIVT-- 211
            E+V  +Y + L +  + YL  S ++HRD+K EN+L+D     K  DFG+        T  
Sbjct: 1364 EMVTQVYTLQL-LEGLAYLHESGIVHRDVKPENILLDFNGVIKYVDFGAAKKIANNGTRL 1422

Query: 212  -----------THQDIALLTQNIYVHT----------TPQYRSPEMIDLYRCLPINEKSD 250
                        H+D+  ++ +  V            TP Y +PE I            D
Sbjct: 1423 ASMNKIENADGEHEDVTHVSDSKAVKNNENALLDMMGTPMYMAPESITGSTTKGKLGADD 1482

Query: 251  IWALGVFLYKLLFFTTPFE-MTGQFAILHSKY-----EFPV-NKYSSKLINLIIIMLAEN 303
            +W+LG  + +++    P+  +  ++AI++        +FP  ++ SS  +  +   L +N
Sbjct: 1483 VWSLGCVVLEMITGRRPWANLDNEWAIMYHVAAGHTPQFPTKDEVSSAGMKFLERCLIQN 1542

Query: 304  PNLRPNIYQVL 314
            P+ R +  ++L
Sbjct: 1543 PSKRASAVELL 1553

>Kwal_55.20326
          Length = 750

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 47/193 (24%), Positives = 91/193 (47%), Gaps = 25/193 (12%)

Query: 88  LNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMNQRL 147
           ++ +++E+ ++K+L+   NIV Y+ S+        +G  + + +E  P  S+   +N   
Sbjct: 531 VDALQHEMGLLKELQ-HENIVTYYGSSQ-------EGGNLNIFLEYVPGGSVSSMLNSY- 581

Query: 148 STKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTSTCF 207
                E  I      + + +S +H     +IHRDIK  N+L+D K   K+ DFG +    
Sbjct: 582 -GPFEEPLIRNFTRQILIGLSYLHR--KDIIHRDIKGANILIDIKGCVKITDFGISKKLS 638

Query: 208 PIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGVFLYKLLFFTTP 267
           P+       A L  ++Y      + +PE++   + +   +K+DIW++G  + ++     P
Sbjct: 639 PLNQQQNKRASLQGSVY------WMAPEVV---KQVVTTKKADIWSVGCVIIEMFTGKHP 689

Query: 268 F----EMTGQFAI 276
           F    +M   F I
Sbjct: 690 FPDFSQMQAIFKI 702

>Scas_640.14*
          Length = 728

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 46/193 (23%), Positives = 86/193 (44%), Gaps = 31/193 (16%)

Query: 129 LLMELCPNKSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVL 188
           +++E         Y+ ++   +L EA   ++   +   +S MH     ++HRD+K+EN+L
Sbjct: 123 IVLEYASGGEFYKYVQRK--RRLKEATACRLFAQLISGVSYMH--SKGIVHRDLKLENLL 178

Query: 189 VDAKNNFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMI---DLYRCLPI 245
           +D   N  + DFG  +  +       D  L+  +     +P Y +PE++   + Y+    
Sbjct: 179 LDKHENLIITDFGFVNEFY------ADNELMKTSC---GSPCYAAPELVITTEPYKA--- 226

Query: 246 NEKSDIWALGVFLYKLLFFTTPFEMTGQ-----------FAILHSKYEFPVNKYSSKLIN 294
             K+DIW+ G+ LY +L    P++   Q             I  +  +FP   Y++ L  
Sbjct: 227 -RKADIWSCGIILYGMLAGYLPWDDDKQNPNGEDIVRLYHYITKTPLKFPRIHYTTFLGI 285

Query: 295 LIIIMLAENPNLR 307
            +  +L  NP  R
Sbjct: 286 CLRHILVSNPVRR 298

>Scas_629.16
          Length = 918

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 67/298 (22%), Positives = 120/298 (40%), Gaps = 51/298 (17%)

Query: 28  VCVGTHKVEVVNYLAEGGFAQIYVVK-----FLEYLNEFDNTASVPLKIGDVACLKRVLV 82
           + VG    E +  L +G   ++Y+V+      L  L  F  +  +  K      +KR+L 
Sbjct: 512 ITVGPQSFEKIKLLGQGDVGKVYLVREKKTNRLYALKIFSKSEMIKRKK-----IKRILA 566

Query: 83  QDENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDY 142
           + E            +      P +V  + S  S          +   ME C        
Sbjct: 567 EQE------------ILATSNHPFVVTLYHSFQSEDY-------LYFCMEYCMGGEFFRA 607

Query: 143 MNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFG- 201
           +  R +  ++E +      +V  ++  +H L    I+RD+K EN+L+    +  L+DF  
Sbjct: 608 LQTRRTKCISEDDARFYASEVTAALEYLHLL--GFIYRDLKPENILLHKSGHIMLSDFDL 665

Query: 202 ---STSTCFPIV-----TTHQDIALLTQNIYVHT---TPQYRSPEMIDLYRCLPINEKSD 250
              +     P++     +T  D  + +     ++   T +Y +PE+I   R        D
Sbjct: 666 SVQAKDAKVPVMKGSAESTVVDTKICSDGFRTNSFVGTEEYIAPEVI---RGNGHTAAVD 722

Query: 251 IWALGVFLYKLLFFTTPFEMTGQ---FA-ILHSKYEFPVNK-YSSKLINLIIIMLAEN 303
            W LG+ +Y++LF  TPF+ +     F+ IL +   FP N   S    +LI  +L +N
Sbjct: 723 WWTLGILIYEMLFGFTPFKGSSSNETFSNILKNDVSFPNNNDISRNCKDLIKKLLCKN 780

>Sklu_1995.2 YLR362W, Contig c1995 1578-3767
          Length = 729

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 48/193 (24%), Positives = 91/193 (47%), Gaps = 25/193 (12%)

Query: 88  LNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMNQRL 147
           ++ +++E+ ++K+L    NIV Y+ S+        +G  + + +E  P  S+   +N   
Sbjct: 510 IDALQHEMNLLKELHHE-NIVTYYGSSQ-------EGGNLNIFLEYVPGGSVSSMLNNY- 560

Query: 148 STKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTSTCF 207
                E  I      + + ++ +H    ++IHRDIK  NVL+D K   K+ DFG +    
Sbjct: 561 -GPFEEPLIKNFTRQILIGLAYLHR--KNIIHRDIKGANVLIDIKGCVKITDFGISKKLS 617

Query: 208 PIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGVFLYKLLFFTTP 267
           P+       A L  ++Y      + +PE++   + +   EK+DIW++G  + ++     P
Sbjct: 618 PLNKQQNKRASLQGSVY------WMAPEVV---KQVVTTEKADIWSVGCLVVEMFTGKHP 668

Query: 268 F----EMTGQFAI 276
           F    +M   F I
Sbjct: 669 FPDFSQMQAIFKI 681

>CAGL0H06259g 615045..619055 similar to sp|P31374 Saccharomyces
            cerevisiae YAL017w FUN31, start by similarity
          Length = 1336

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 48/167 (28%), Positives = 78/167 (46%), Gaps = 22/167 (13%)

Query: 147  LSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTSTC 206
              T +TE E   +   V   +  +H     ++HRDIK EN++VD++   K+ DFGS +  
Sbjct: 1178 FKTNMTEIEAKLLFKQVVSGVKHLH--DQGIVHRDIKDENIIVDSQGFVKIIDFGSAAY- 1234

Query: 207  FPIVTTHQDIALLTQNIYVHTTPQYRSPEMI--DLYRCLPINEKSDIWALGVFLYKLLFF 264
                     +     +++V T   Y +PE++    Y   P     DIWA+G+ LY ++F 
Sbjct: 1235 ---------VKSGPFDVFVGTI-DYAAPEVLGGSPYEGKP----QDIWAIGILLYTIVFK 1280

Query: 265  TTPFEMTGQFAILHSKYEFPVNKY-SSKLINLIIIMLAENPNLRPNI 310
              PF    +  IL  + +F  ++  S +   LI  +L  N   RP I
Sbjct: 1281 ENPFYNIDE--ILEGELKFNSSELVSEQCTTLIAKILNRNVQKRPTI 1325

>YHR082C (KSP1) [2372] chr8 complement(268460..271549)
           Serine/threonine kinase that suppresses prp20 mutant
           when oveproduced [3090 bp, 1029 aa]
          Length = 1029

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 49/195 (25%), Positives = 81/195 (41%), Gaps = 41/195 (21%)

Query: 90  EMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMNQRLST 149
           E   EV++  K+    NI    D            F+  ++ME C    L + +      
Sbjct: 130 EAMYEVDIQTKIGRHQNIAALLDF-----------FDSYIIMEYCSGGDLYEAIKADAVP 178

Query: 150 KLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKN-NFKLADFGSTSTCFP 208
           K T++ I  I+  +  +I  +H     + HRDIK EN+L+   +   KL D+G  +T   
Sbjct: 179 KKTKS-ITHIITQIMDAIEYVH--NKGIYHRDIKPENILISGIDWTIKLTDWGLATT--- 232

Query: 209 IVTTHQDIALLTQNIYVHTTPQYRSPEMIDL----------YRCLPINEKSDIWALGVFL 258
                 D   + +N+    + +Y SPE+ D           Y C     K D+WA+G+  
Sbjct: 233 ------DKTSMDRNV---GSERYMSPELFDSNLDIKERKEPYDCA----KVDLWAMGIVF 279

Query: 259 YKLLFFTTPFEMTGQ 273
             ++F   PF +  Q
Sbjct: 280 LNIVFHKNPFSIANQ 294

>ADR300C [2042] [Homologous to ScYHR082C (KSP1) - SH]
           (1222346..1225018) [2673 bp, 890 aa]
          Length = 890

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 46/191 (24%), Positives = 83/191 (43%), Gaps = 41/191 (21%)

Query: 94  EVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMNQRLSTKLTE 153
           EV++  K+    NI + +D            F+  ++ME C    L + +      + T 
Sbjct: 107 EVDIQSKIGKHKNITELYDY-----------FDSYIIMEYCSGGDLYEAIKADTIPRKTR 155

Query: 154 AEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLV-DAKNNFKLADFGSTSTCFPIVTT 212
            ++  I+  +  ++  +H     + HRDIK EN+L+ D+    KL D+G  +T       
Sbjct: 156 -QLTHIISQILDAVEFVH--SKGIYHRDIKPENILIADSNWTVKLTDWGLATT------- 205

Query: 213 HQDIALLTQNIYVHTTPQYRSPEMIDL----------YRCLPINEKSDIWALGVFLYKLL 262
             D   + +N+    + +Y +PE+ +           Y C     K DIWA+G+ L  ++
Sbjct: 206 --DQTSMDRNV---GSERYMAPELFESNLDYDERNEPYEC----SKVDIWAIGIVLLNIV 256

Query: 263 FFTTPFEMTGQ 273
           F   PF +  Q
Sbjct: 257 FHKNPFSVANQ 267

>Scas_477.5
          Length = 703

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 48/182 (26%), Positives = 91/182 (50%), Gaps = 24/182 (13%)

Query: 88  LNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMNQRL 147
           ++ +++E+ ++K+L    NIV Y+ S+        +G  + + +E  P  S+   +N   
Sbjct: 485 VDALQHEMNLLKELHHE-NIVTYYGSSQ-------EGPNLNIFLEYVPGGSVSSMLNNY- 535

Query: 148 STKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTSTCF 207
                E+ IV  +  V + ++ +H    ++IHRDIK  N+L+D K   K+ DFG +    
Sbjct: 536 -GPFEESLIVNFIRQVLIGVAYLH--NKNIIHRDIKGANILIDTKGCVKITDFGISKKLS 592

Query: 208 PIVTTHQDI-ALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGVFLYKLLFFTT 266
           P+  + QD  A L  ++Y      + +PE++   +     EK+DIW+ G  + ++     
Sbjct: 593 PL--SKQDKRASLQGSVY------WMAPEVV---KQTATTEKADIWSTGCVVIEMFTGKH 641

Query: 267 PF 268
           PF
Sbjct: 642 PF 643

>ADR313W [2054] [Homologous to ScYDL025C - SH]
           complement(1255932..1257668) [1737 bp, 578 aa]
          Length = 578

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 50/206 (24%), Positives = 90/206 (43%), Gaps = 27/206 (13%)

Query: 123 QGFEVLLLMELCPNKSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDI 182
           +G   L++ME CP     D+ N  +S ++T+ E+      +   +  +H     L HRD+
Sbjct: 334 EGELFLVVMEYCP----YDFFNLVMSNQMTKHEVWCYFKQICRGVDYLHS--QGLAHRDL 387

Query: 183 KIENVLVDAKNNFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRC 242
           K++N +V A    KL DFGS      I+  +   + L     +  +  Y +PE++     
Sbjct: 388 KLDNCVVTADGILKLIDFGSA-----IIFRYNFNSKLEPAKGIVGSDPYLAPELLTQLYY 442

Query: 243 LPINEKSDIWALGVFLYKLLF----FTTPFEMTGQFAIL---------HSKYEFPVNKYS 289
            P    +D+W++ V  Y +      +  P E    F +          HSK  + + K  
Sbjct: 443 DP--SAADVWSIAVMFYCMSLRRFPWKKPSEDVPSFKLFCQKPDDENDHSKGPYRLLKLL 500

Query: 290 SKLINLIII-MLAENPNLRPNIYQVL 314
            +   L+I  ML  +P  R +I +++
Sbjct: 501 PRATRLLISRMLELDPKKRASITEII 526

>KLLA0F14190g 1311121..1315137 gi|3021329|emb|CAA06336.1 Kluyveromyces
            lactis MAP kinase kinase kinase, start by similarity
          Length = 1338

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 67/303 (22%), Positives = 128/303 (42%), Gaps = 66/303 (21%)

Query: 41   LAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGDVACLKRVLV-----QDENGLN---EMR 92
            + +G F  +Y+      LN         +  G++  +K+V V     QDE+ ++    ++
Sbjct: 1044 IGKGSFGAVYLA-----LN---------VTTGEMLAVKQVTVPEFSSQDESAISMVEALK 1089

Query: 93   NEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMNQRLSTKLT 152
            +EV  +K L    NIVQY        ++G+      L +E     S+   +  R+  +  
Sbjct: 1090 SEVSTLKDLNHV-NIVQYL---GFEEKNGIYS----LFLEYVAGGSVGSLI--RMYGRFD 1139

Query: 153  EAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTSTCFPIVTT 212
            +  I  +   V   ++ +H     ++HRD+K +N+L+D     K++DFG           
Sbjct: 1140 DQLIRHLTKQVLEGLAYLHS--KGILHRDMKADNLLLDNDGVCKISDFG----------- 1186

Query: 213  HQDIALLTQNIYVHT------TPQYRSPEMIDLYRCLPINEKSDIWALGVFLYKLLFFTT 266
               I+  + NIY ++      T  + +PEM+D       + K DIW+LG  + ++     
Sbjct: 1187 ---ISRKSNNIYSNSDMTMRGTVFWMAPEMVDTAHGY--SAKVDIWSLGCVVLEMFAGKR 1241

Query: 267  PFE----MTGQFAILHSKYEFPVNKYSSKLI-----NLIIIMLAENPNLRPNIYQVLYH- 316
            P+     +   F I  SK   P+   +  L+     + +      +P +RP    ++ H 
Sbjct: 1242 PWSNFEVVAAMFQIGKSKTAPPIPDDTKDLVSPAGQSFLDQCFEIDPEMRPTADSLVGHP 1301

Query: 317  LCE 319
             C+
Sbjct: 1302 FCK 1304

>KLLA0B07205g complement(624606..625973) some similarities with
           sp|P05986 Saccharomyces cerevisiae YKL166c TPK3
           cAMP-dependent protein kinase 3, catalytic chain,
           hypothetical start
          Length = 455

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 52/200 (26%), Positives = 87/200 (43%), Gaps = 34/200 (17%)

Query: 162 DVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTSTCFPIVTTHQDIALLTQ 221
           +V L++  +H     +I+RD+K EN+L+D   + KL DFG       +  T         
Sbjct: 251 EVCLALEYLH--SKGIIYRDLKPENILLDKNGHIKLTDFGFAKYVPDVTYT--------- 299

Query: 222 NIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGVFLYKLLFFTTPFEMTGQFA----IL 277
              +  TP Y +PE++      P N+  D W+ GV +Y++L   TPF  +        IL
Sbjct: 300 ---LCGTPDYIAPEVVS---TKPYNKSVDWWSFGVLIYEMLAGYTPFYDSNTIKTYENIL 353

Query: 278 HSKYEFPVNKYS------SKLINLIIIML-------AENPNLRPNIYQVLYHLCEILNVE 324
           ++   FP   +S      SKLI   +          +E+    P   +V++      N+E
Sbjct: 354 NAPVRFPPFFHSDAQDLISKLITRDLSQRLGNLQNGSEDVKNHPWFSEVVWEKLLCKNIE 413

Query: 325 VPIEDKYAEGAYNFSKYTQF 344
            P E     G  + S+Y ++
Sbjct: 414 TPYEPPIQAGQGDTSQYDRY 433

>YCR091W (KIN82) [614] chr3 (274400..276562) Serine/threonine
           protein kinase with unknown role [2163 bp, 720 aa]
          Length = 720

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 68/290 (23%), Positives = 123/290 (42%), Gaps = 38/290 (13%)

Query: 28  VCVGTHKVEVVNYLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGDVACLKRVLVQDENG 87
           + V     E +  L +G   ++Y+++      E D      LK+     L +  +     
Sbjct: 317 ITVEPQSFEKIRLLGQGDVGKVYLMR------ERDTNQIFALKV-----LNKHEMIKRKK 365

Query: 88  LNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMNQRL 147
           +  +  E E++      P IV  + S  ++         + L ME C        +  R 
Sbjct: 366 IKRVLTEQEILAT-SDHPFIVTLYHSFQTKDY-------LYLCMEYCMGGEFFRALQTRK 417

Query: 148 STKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFG----ST 203
           S  + E +      +V  ++  +H L    I+RD+K EN+L+    +  L+DF     +T
Sbjct: 418 SKCIAEEDAKFYASEVVAALEYLHLL--GFIYRDLKPENILLHQSGHVMLSDFDLSIQAT 475

Query: 204 STCFPIV--TTHQDIALLTQNIYVHT---TPQYRSPEMIDLYRCLPINEKSDIWALGVFL 258
            +  P +  +T+ D  + +     ++   T +Y +PE+I   R        D W LG+ +
Sbjct: 476 GSKKPTMKDSTYLDTKICSDGFRTNSFVGTEEYLAPEVI---RGNGHTAAVDWWTLGILI 532

Query: 259 YKLLFFTTPFEMTGQ---FA-ILHSKYEFPVNKYSSK-LINLIIIMLAEN 303
           Y++LF  TPF+       F+ IL    +FP +K  SK   +LI  +L +N
Sbjct: 533 YEMLFGCTPFKGDNSNETFSNILTKDVKFPHDKEVSKNCKDLIKKLLNKN 582

>YJL164C (TPK1) [2757] chr10 complement(109959..111152) Catalytic
           subunit of cAMP-dependent protein kinase 1, protein
           kinase A or PKA [1194 bp, 397 aa]
          Length = 397

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 61/127 (48%), Gaps = 21/127 (16%)

Query: 162 DVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTSTCFPIVTTHQDIALLTQ 221
           +V L++  +H     +I+RD+K EN+L+D   + K+ DFG       +  T         
Sbjct: 193 EVCLALEYLH--SKDIIYRDLKPENILLDKNGHIKITDFGFAKYVPDVTYT--------- 241

Query: 222 NIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGVFLYKLLFFTTPF----EMTGQFAIL 277
              +  TP Y +PE++      P N+  D W+ G+ +Y++L   TPF     M     IL
Sbjct: 242 ---LCGTPDYIAPEVVS---TKPYNKSIDWWSFGILIYEMLAGYTPFYDSNTMKTYEKIL 295

Query: 278 HSKYEFP 284
           +++  FP
Sbjct: 296 NAELRFP 302

>KLLA0F01276g complement(120001..121560) similar to sp|P38147
           Saccharomyces cerevisiae YBR274w CHK1 regulats
           inhibitory Cdk phosphorylation of PDS1, start by
           similarity
          Length = 519

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 53/184 (28%), Positives = 88/184 (47%), Gaps = 24/184 (13%)

Query: 90  EMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMNQRLST 149
           ++  EV++  +     N+++  D N S        F + + MEL     L D +   +  
Sbjct: 61  DVLREVKLHSRCSNFVNVLKVIDCNLS------DPF-LWIAMELAEGGDLFDKIEPDIGV 113

Query: 150 KLTEAEIVKIMYDVAL-SISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTSTCFP 208
              ++E+ +  Y   + +IS +H     + HRDIK EN+L+D   N KLADFG  S    
Sbjct: 114 ---DSEVAQFYYKQLIKAISYLHD-TCGVAHRDIKPENILLDKDGNLKLADFGLAS---- 165

Query: 209 IVTTHQDIALLTQNIYVHTTPQYRSPEMI--DLYRCLPINEKSDIWALGVFLYKLLFFTT 266
            +   +D +         + P Y +PE+I  D Y      + +DIW++GV L+ LL   T
Sbjct: 166 -LFKRKDGSKRISRDQRGSLP-YMAPEIIYCDGYYA----DMTDIWSIGVLLFVLLTGET 219

Query: 267 PFEM 270
           P+E+
Sbjct: 220 PWEL 223

>Scas_689.25*
          Length = 409

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 38/127 (29%), Positives = 62/127 (48%), Gaps = 21/127 (16%)

Query: 162 DVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTSTCFPIVTTHQDIALLTQ 221
           +V L++  +H L   +I+RD+K EN+L+D   + K+ DFG       +  T         
Sbjct: 205 EVCLALDYLHSL--DIIYRDLKPENLLLDRNGHIKVTDFGFAKYVPDVTYT--------- 253

Query: 222 NIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGVFLYKLLFFTTPF----EMTGQFAIL 277
              +  TP Y +PE+I      P N+  D W+ G+ +Y++L   TPF     M     IL
Sbjct: 254 ---LCGTPDYIAPEVI---SAKPYNKSVDWWSFGILIYEMLSGHTPFYDSSTMKTYENIL 307

Query: 278 HSKYEFP 284
           ++  +FP
Sbjct: 308 NAPLKFP 314

>YOL045W (PSK2) [4773] chr15 (243495..246800) Serine/threonine protein
            kinase of unknown function [3306 bp, 1101 aa]
          Length = 1101

 Score = 58.5 bits (140), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 51/166 (30%), Positives = 81/166 (48%), Gaps = 22/166 (13%)

Query: 151  LTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTSTCFPIV 210
            + E E   +   V  SI  +H     ++HRDIK ENV+VD+    KL DFGS +      
Sbjct: 947  MVEHEAKLVFKQVVASIKHLH--DQGIVHRDIKDENVIVDSHGFVKLIDFGSAAY----- 999

Query: 211  TTHQDIALLTQNIYVHTTPQYRSPEMI--DLYRCLPINEKSDIWALGVFLYKLLFFTTPF 268
                 I     +++V T   Y +PE++    Y+  P     DIWALGV LY +++   P+
Sbjct: 1000 -----IKSGPFDVFVGTM-DYAAPEVLGGSSYKGKP----QDIWALGVLLYTIIYKENPY 1049

Query: 269  EMTGQFAILHSKYEFPVNKY-SSKLINLIIIMLAENPNLRPNIYQV 313
                +  IL  +  F  +++ S + I+LI  +L    + RP I ++
Sbjct: 1050 YNIDE--ILEGELRFDKSEHVSEECISLIKRILTREVDKRPTIDEI 1093

>KLLA0C18568g 1639958..1642282 gi|6967028|emb|CAB72435.1
           Kluyveromyces lactis MUP1 protein, hypothetical start
          Length = 774

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 73/303 (24%), Positives = 125/303 (41%), Gaps = 53/303 (17%)

Query: 28  VCVGTHKVEVVNYLAEGGFAQIYVVK-----FLEYLNEFDNTASVPLKIGDVACLKRVLV 82
           + VG    E +  L +G   ++Y+V+      L  L  F     +  K      +KR+L 
Sbjct: 372 ILVGPQSFEKIRLLGQGDVGRVYLVREKQTNRLYALKIFSKPEMIKRK-----KIKRILT 426

Query: 83  QDENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDY 142
           + E            +      P IV  + S  +          + L ME C        
Sbjct: 427 EQE------------ILATSNHPFIVTLYHSFQTEDY-------LYLCMEYCMGGEFFRA 467

Query: 143 MNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFG- 201
           +  R +  ++E +      +V  ++  +H +    I+RD+K EN+L+    +  L+DF  
Sbjct: 468 LQTRKTKCISEDDARFYSSEVTAALEYLHLM--GFIYRDLKPENILLHQSGHIMLSDFDL 525

Query: 202 ---STSTCFPIVTTHQDIALLTQNI---------YVHTTPQYRSPEMIDLYRCLPINEKS 249
              +  T  P V  +   +L+   I         +V T  +Y +PE+I   R        
Sbjct: 526 SVQAKDTKNPQVKGNASHSLVDTKICSDGFRTNSFVGTE-EYIAPEVI---RGNGHTAAV 581

Query: 250 DIWALGVFLYKLLFFTTPF--EMTGQ-FA-ILHSKYEFPVNKYSSKLI-NLIIIMLAENP 304
           D W LG+ +Y++LF  TPF  + T Q F+ IL ++   P N  +S+   +LI  +L +N 
Sbjct: 582 DWWTLGILIYEMLFGFTPFKGDNTNQTFSNILKNEVVIPNNNETSRACKDLIRKLLIKNE 641

Query: 305 NLR 307
           N R
Sbjct: 642 NKR 644

>Scas_643.20
          Length = 1082

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 73/280 (26%), Positives = 115/280 (41%), Gaps = 72/280 (25%)

Query: 15   GHPAVERYTPGHIVCVGTHK-------VEVVNYLAEGGFAQIYVVKFLEYLNEFDNTASV 67
            G  A   YTP     +G+ K         V+  L EG + ++ +      +++   T  V
Sbjct: 797  GFSASFNYTPS--TSIGSQKRIKKFSDFTVLQQLGEGAYGKVKLC-----IHKEKRTIVV 849

Query: 68   PLKIGDVACLKRVLVQDENGLNEMRNEVEVMKKLKGAP--NIVQ-----------YFDSN 114
               I     L    V+D   L  + +E+++M  L   P  NIV            Y ++ 
Sbjct: 850  IKMIFKERILVDTWVRDRK-LGTIPSEIQIMATLNKKPHKNIVALLDFFEDEEYYYMETP 908

Query: 115  ASRRRDGVQGFEVLLLMELCPNKSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLP 174
            A      +  F+   L+EL  N              +TE E   I   V   +  +H   
Sbjct: 909  AHGETGSIDLFD---LIELKKN--------------MTEYEEKLIFKQVVSGLKHLH--D 949

Query: 175  VSLIHRDIKIENVLVDAKNNFKLADFGSTSTCFPIVTTHQDIALLTQ----NIYVHTTPQ 230
              ++HRDIK ENV+VD+K + KL D+GS              A  T+    +++V T   
Sbjct: 950  QGIVHRDIKDENVIVDSKGHVKLIDYGS--------------AAYTKSGPFDVFVGTI-D 994

Query: 231  YRSPEMI--DLYRCLPINEKSDIWALGVFLYKLLFFTTPF 268
            Y +PE++   +Y   P     DIWA+G+ LY ++F   PF
Sbjct: 995  YAAPEVLGGSVYDGKP----QDIWAIGILLYTIIFKENPF 1030

>AEL185C [2321] [Homologous to ScYBR274W (CHK1) - SH]
           (291129..292676) [1548 bp, 515 aa]
          Length = 515

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 58/238 (24%), Positives = 101/238 (42%), Gaps = 32/238 (13%)

Query: 90  EMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMNQRLST 149
           ++  EV +  +  G  ++V+  D N SR         + + MEL     L D +   +  
Sbjct: 61  DLTREVVLQTRCAGHRHVVRVLDCNVSREY-------LWIAMELADGGDLFDKIEPDVGV 113

Query: 150 KLTEAEIVKIMYD-VALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTSTCFP 208
              ++E+ +  Y  +  +++ +H     + HRDIK EN+L+D   N K+ADFG  +    
Sbjct: 114 ---DSEVARFYYQQLVRALTHLHE-ACGVAHRDIKPENMLLDRAGNLKVADFGLATR--- 166

Query: 209 IVTTHQDIALLTQNIYVHTTPQYRSPEMID--LYRCLPINEKSDIWALGVFLYKLLFFTT 266
                     L ++     T  Y +PE++    Y      + +DIW+ GV ++ LL   T
Sbjct: 167 -FRRRDGTRRLARD--RRGTLPYLAPEVVGERAYH----ADTADIWSAGVLVFVLLTGET 219

Query: 267 PFEM----TGQFAILHSK----YEFPVNKYSSKLINLIIIMLAENPNLRPNIYQVLYH 316
           P+       G F    +      + P  K     +NL+  ML + P  R  + Q+  H
Sbjct: 220 PWSEPSVDDGMFRAFVADGGNLSDGPWGKIGLVELNLLRKMLQQRPAARATLAQLRQH 277

>CAGL0H01639g 158967..160532 similar to sp|P08458 Saccharomyces
           cerevisiae YDR523c SPS1 ser/thr protein kinase,
           hypothetical start
          Length = 521

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 55/231 (23%), Positives = 103/231 (44%), Gaps = 36/231 (15%)

Query: 39  NYLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGDVACLKRV-LVQDENGLNEMRNEVEV 97
           N +  G F  +Y  K   +LNE             V  +K V L   E  +  +  E+  
Sbjct: 9   NCIGRGNFGDVYKAK-DTWLNE-------------VVAVKVVNLENSEEEVELLAQEIFF 54

Query: 98  MKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMNQRLSTKLTEAEIV 157
           + +LK +P +  Y  +        V+   + + ME C   S+ D +    ++ L E +  
Sbjct: 55  LAELK-SPYVTNYIATV-------VEDVSMWIAMEYCGGGSVGDLLKYHYTSGLPEHKTR 106

Query: 158 KIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTSTCFPIVTTHQDIA 217
            I  ++   +S +H      IHRDIK  N+L+  +   KL+DFG +            ++
Sbjct: 107 FITREILKGLSYLH--SQRKIHRDIKAANILLTDEGKVKLSDFGVSGKL---------LS 155

Query: 218 LLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGVFLYKLLFFTTPF 268
              ++ +V  TP + +PE++  +     +E++DIW+LG+ + ++L  + P 
Sbjct: 156 SFRRDTFV-GTPYWMAPEIV-AHDSEGYDERADIWSLGITVIEMLRGSPPL 204

>KLLA0C04191g 384198..386591 weakly similar to sp|P27636
           Saccharomyces cerevisiae YAR019c CDC15 protein kinase of
           the MAP kinase kinase kinase family, hypothetical start
          Length = 797

 Score = 57.8 bits (138), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 57/214 (26%), Positives = 101/214 (47%), Gaps = 34/214 (15%)

Query: 77  LKRVLVQDENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQ-GFEVLLLMELCP 135
           +K++  +DE+ LNE   E++++K L+   NIV+Y        R  +Q   E+ +++E C 
Sbjct: 38  IKQIEFEDESELNEHMLEIDLLKNLRHQ-NIVEY--------RGFIQKAHELYIILEYCA 88

Query: 136 NKSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNF 195
             SL D +       L E + V  +      +  +H     +IHRDIK  N+L+  +   
Sbjct: 89  RGSLRDILKH---GPLLEDDTVNYVTQTLYGLQYLH--EQGVIHRDIKAANLLLTEEGIV 143

Query: 196 KLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALG 255
           KLADFG ++    +  T+              +P + +PE++       +   SDIW+LG
Sbjct: 144 KLADFGVSTRINRMAMTYAG------------SPNWMAPEVMTGQGASTV---SDIWSLG 188

Query: 256 VFLYKLLFFTTPFE----MTGQFAILHSKYEFPV 285
             + +LL    PF      +  +AI++ +Y  P+
Sbjct: 189 ATVVELLTGNPPFHNLVNESACYAIVNEEYIPPL 222

>YKL166C (TPK3) [3104] chr11 complement(134514..135710) Catalytic
           subunit of cAMP-dependent protein kinase 3, protein
           kinase A or PKA [1197 bp, 398 aa]
          Length = 398

 Score = 57.0 bits (136), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 62/127 (48%), Gaps = 21/127 (16%)

Query: 162 DVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTSTCFPIVTTHQDIALLTQ 221
           +V L++  +H     +I+RD+K EN+L+D   + K+ DFG       +  T         
Sbjct: 194 EVCLALEYLH--SKDIIYRDLKPENILLDKNGHIKITDFGFAKYVPDVTYT--------- 242

Query: 222 NIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGVFLYKLLFFTTPF----EMTGQFAIL 277
              +  TP Y +PE++      P N+  D W+ GV +Y++L   TPF     M     IL
Sbjct: 243 ---LCGTPDYIAPEVVS---TKPYNKSVDWWSFGVLIYEMLAGYTPFYNSNTMKTYENIL 296

Query: 278 HSKYEFP 284
           +++ +FP
Sbjct: 297 NAELKFP 303

>AFR372W [3564] [Homologous to ScYJR059W (PTK2 ) - SH]
           complement(1109175..1111499) [2325 bp, 774 aa]
          Length = 774

 Score = 57.8 bits (138), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 55/218 (25%), Positives = 91/218 (41%), Gaps = 32/218 (14%)

Query: 74  VACLKRVLV----QDENGLNEMRNEVEVMKKLKGAPNIVQ--YFDSNASRRRDGVQGFEV 127
           V  LKR  +    + E        E  + KKL G  NI++  Y     S   +GV+    
Sbjct: 262 VYALKRFKMFSYEEPEEFYQRCMKEYLIAKKLDGHINIIKTFYLMKVPSSATNGVKRSWA 321

Query: 128 LLLMELCPN----KSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIK 183
            ++ +   +     +L  + N+ L  K            +A  + QMH L   + HRDIK
Sbjct: 322 FVMQQCVQDMYYYTTLTGWHNKPLEEKWC------CFKQIARGVRQMHNL--GIAHRDIK 373

Query: 184 IENVLVDAKNNFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDL---- 239
           +ENVL       KL DFG ++  + I +     +   +      +P +  PE++ L    
Sbjct: 374 LENVLATDYGALKLTDFGVST--YAIESPDDPSSPRIKLKGFCGSPPHVPPEVMILSSEK 431

Query: 240 YRCLPINEKS--------DIWALGVFLYKLLFFTTPFE 269
            +  P+ E          D+WALG+ ++ L+  T PF+
Sbjct: 432 RKKTPVPENKLEYDPFSMDMWALGIVMWSLIIPTPPFQ 469

>Kwal_14.1273
          Length = 415

 Score = 57.0 bits (136), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 51/180 (28%), Positives = 83/180 (46%), Gaps = 27/180 (15%)

Query: 93  NEVEVMKKL-KGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMN--QRLST 149
           +E+EV++ L  G PN+    D      R+    F    +ME      L D +   +R S 
Sbjct: 51  SELEVLRVLGTGHPNVCALLDFY---ERETCYVF----VMEYAARGDLYDVIRGWKRHSA 103

Query: 150 KLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTSTCFPI 209
           +    E+ +++  +  +I   H     + HRDIK ENVL+D+  N KLAD+G        
Sbjct: 104 ERVPVELARVVLQLCSAIEYAH--SCGIAHRDIKPENVLLDSAGNVKLADWG-------- 153

Query: 210 VTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGVFLYKLLFFTTPFE 269
           ++T   ++  T+      T +Y +PE    Y        +D W+LGV L  ++F   PF+
Sbjct: 154 LSTRMRVSCDTRI----GTEKYLAPEA---YASPHDTFLADFWSLGVTLLFVMFGACPFK 206

>Sklu_2429.5 YOL016C, Contig c2429 9000-10298 reverse complement
          Length = 432

 Score = 57.0 bits (136), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 77/289 (26%), Positives = 131/289 (45%), Gaps = 52/289 (17%)

Query: 41  LAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGDVACLKRVLVQDENGLNEMRNEVEVMKK 100
           L  G F    VV+    ++  DN A   +KI     LK+ L  ++  L  + +E+ +++K
Sbjct: 52  LGAGSFG---VVRQARKISTGDNVA---VKI----LLKKALKGNDVQLQMLYDELMILQK 101

Query: 101 LKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMNQRLSTKLTEAEIVKIM 160
           L   PNIV++ D   S+ +         ++ +L     L D + Q+   K TE + VKI+
Sbjct: 102 L-NHPNIVKFKDWFESKEK-------FYIVTQLATGGELFDRILQK--GKFTEVDAVKIV 151

Query: 161 YDVALSISQMHYLPVSLIHRDIKIENVL-VDAKNN--FKLADFGSTSTCFPIVTTHQDIA 217
             +  ++  +H    +++HRD+K EN+L +D  +N    L DFG             D  
Sbjct: 152 VQILKAVEYLH--SRNIVHRDLKPENLLYLDKSDNSQLVLGDFGIAKEL------KNDGD 203

Query: 218 LLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGVFLYKLLFFTTPF--------- 268
           L+ +      +  Y +PE++         +  DIW++GV  Y LL   +PF         
Sbjct: 204 LIHK---AAGSMGYVAPEVL---TSNGHGKPCDIWSIGVITYTLLCGYSPFIAESVDGFL 257

Query: 269 -EMT-GQFAI-LHSKYEFPVNKYSSKLINLIIIMLAENPNLRPNIYQVL 314
            E T GQ+ +  H  Y   ++K  +KL   I+ +L  +P  RP    +L
Sbjct: 258 EECTSGQYPVTFHKPYWNNISK-EAKL--FILRVLTISPKKRPTATDLL 303

>ABR177C [770] [Homologous to ScYPR161C (SGV1) - SH]
           (735828..738089) [2262 bp, 753 aa]
          Length = 753

 Score = 57.4 bits (137), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 58/250 (23%), Positives = 103/250 (41%), Gaps = 56/250 (22%)

Query: 41  LAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGDVACLKRVLVQDENGLNEM--RNEVEVM 98
           L +G F ++Y                V L       +K++LV+ EN L  +  + E+ ++
Sbjct: 62  LGQGTFGEVY--------------RGVHLATQRQVAMKKILVKTENDLFPITAQREITIL 107

Query: 99  KKLKGAPNIVQYFD------------------SNASRRRDGVQGFEVLLLMELCPNKSLL 140
           K+L    N+VQ  +                  S AS   D ++ F ++L   +     +L
Sbjct: 108 KRLNHR-NVVQLIEMVYDYPPAQNGAAYGQDSSQASASADTMKSFYMILPYMVADLSGIL 166

Query: 141 DYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADF 200
              N R++ ++  A+I  +M  +   I+ +H      +HRDIK  N+L+D K   K+ADF
Sbjct: 167 H--NPRVTLEM--ADIKNMMLQILEGINYIHC--KKFMHRDIKTANILLDHKGILKIADF 220

Query: 201 GSTSTCF---PIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKS-----DIW 252
           G     +   P +          +   V  T  YR+PE++       + +K+     DIW
Sbjct: 221 GLARNYYGAPPNLKYPGGAGTDAKYTSVVVTRWYRAPELV-------LGDKNYTTAVDIW 273

Query: 253 ALGVFLYKLL 262
            +G    +  
Sbjct: 274 GIGCVFAEFF 283

>CAGL0F00913g 97023..100643 similar to sp|P31374 Saccharomyces
            cerevisiae YAL017w FUN31 or sp|Q08217 Saccharomyces
            cerevisiae YOL045w, start by similarity
          Length = 1206

 Score = 57.8 bits (138), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 41/123 (33%), Positives = 61/123 (49%), Gaps = 17/123 (13%)

Query: 147  LSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTSTC 206
              + +TE E   I   +   I  +H     ++HRDIK ENV+VD+K   KL DFGS +  
Sbjct: 1048 FKSNMTEFEAKLIFKQIVSGIKHLH--DQGIVHRDIKDENVIVDSKGFVKLIDFGSAAY- 1104

Query: 207  FPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKS-DIWALGVFLYKLLFFT 265
                     +     +++V T   Y +PE++      P   KS DIWA+G+ LY L++  
Sbjct: 1105 ---------VKSGPFDVFVGTI-DYAAPEVLGGN---PYEGKSQDIWAIGILLYTLIYKE 1151

Query: 266  TPF 268
             PF
Sbjct: 1152 NPF 1154

>Scas_720.103
          Length = 804

 Score = 57.4 bits (137), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 54/204 (26%), Positives = 85/204 (41%), Gaps = 28/204 (13%)

Query: 127 VLLLMELCPNKSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIEN 186
           + L ME C        +  R S  + E +      +V  ++  +H L    I+RD+K EN
Sbjct: 478 LYLCMEYCMGGEFFRALQTRDSKCICEDDARFYASEVLAALEYLHLL--GFIYRDLKPEN 535

Query: 187 VLVDAKNNFKLADFG----STSTCFPIVTTHQDIALLTQNIYVHT--------------T 228
           +L+    +  L+DF     +  +  PI      +     N+ V T              T
Sbjct: 536 ILLHKSGHIMLSDFDLSVHAKDSKNPIFMKDGILPTTNSNLIVDTKICSEGFRTNSFVGT 595

Query: 229 PQYRSPEMIDLYRCLPINEKSDIWALGVFLYKLLFFTTPFE---MTGQFA-ILHSKYEFP 284
            +Y +PE+I   R        D W LG+ ++++LF  TPF+       FA IL   +EFP
Sbjct: 596 EEYIAPEVI---RGNGHTVAVDWWTLGILIFEMLFGKTPFKGDTTNETFANILSKDFEFP 652

Query: 285 -VNKYSSKLINLIIIMLAENPNLR 307
             N  +    NLI  +L +N   R
Sbjct: 653 NSNDITRNCKNLIKKLLTKNETKR 676

>Scas_711.25
          Length = 1515

 Score = 57.8 bits (138), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 69/293 (23%), Positives = 124/293 (42%), Gaps = 53/293 (18%)

Query: 41   LAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGDVACLKRVLV-----QDE---NGLNEMR 92
            + +G F  +Y+      LN         +  G++  +K+V V     QDE   + +  +R
Sbjct: 1220 IGKGSFGAVYLC-----LN---------VTTGEMMAVKQVEVPKYSSQDEAIISTVEALR 1265

Query: 93   NEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMNQRLSTKLT 152
            +EV  +K L    NIVQY        +D +      L +E     S+   +  R+  +  
Sbjct: 1266 SEVSTLKDLDHL-NIVQYL---GFENKDNIYS----LFLEYVAGGSVGSLI--RMYGRFD 1315

Query: 153  EAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTSTCFPIVTT 212
            E  I  +   V   ++ +H     ++HRD+K +N+L+D     K++DFG       I   
Sbjct: 1316 EPLIRHLNTQVLRGLAYLHSR--GILHRDMKADNLLLDQDGVCKISDFG-------ISRK 1366

Query: 213  HQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGVFLYKLLFFTTPFE--- 269
             +DI     ++ +  T  + +PEM+D  +    + K DIW+LG  + ++     P+    
Sbjct: 1367 SKDI-YSNSDMTMRGTVFWMAPEMVDTKQGY--SAKVDIWSLGCIVLEMFAGKRPWSNYE 1423

Query: 270  -MTGQFAILHSKYEFPVNKYSSKLI-----NLIIIMLAENPNLRPNIYQVLYH 316
             +   F I  SK   P+   +  LI     + +      +P+ RP    +L H
Sbjct: 1424 VVAAMFKIGKSKSAPPIPPDTLPLISQNGRDFLDACFEIDPDNRPTADNLLSH 1476

>ABL011C [581] [Homologous to ScYLR362W (STE11) - SH]
           (378259..380364) [2106 bp, 701 aa]
          Length = 701

 Score = 57.4 bits (137), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 51/212 (24%), Positives = 96/212 (45%), Gaps = 37/212 (17%)

Query: 75  ACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELC 134
           A +K++    ++G      ++ ++K+L    NIV Y+ S+        +G  + + +E  
Sbjct: 468 AVVKKLTDPPQDGGRASSTKMNLLKELH-HENIVTYYGSSQ-------EGGNLNIFLEYV 519

Query: 135 PNKSLLDYMN------QRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVL 188
           P  S+   +N      + L    T   +V + Y        +H    ++IHRDIK  N+L
Sbjct: 520 PGGSVSSMLNSYGPFEEPLVKNFTRQTLVGLTY--------LHR--KNIIHRDIKGANLL 569

Query: 189 VDAKNNFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEK 248
           +D K + K+ DFG +    P+       A L  ++Y      + +PE++   + +   EK
Sbjct: 570 IDIKGSVKITDFGISKKLSPLNKKQNKRASLQGSVY------WMAPEVV---KQVVTTEK 620

Query: 249 SDIWALGVFLYKLLFFTTPF----EMTGQFAI 276
           +DIW++G  + ++     PF    +M   F I
Sbjct: 621 ADIWSVGCVVVEMFTGKHPFPDFSQMQAIFKI 652

>KLLA0B07579g 659591..661759 weakly similar to sp|P32944
           Saccharomyces cerevisiae YJL187c SWE1 ser/tyr
           dual-specifity protein kinase, start by similarity
          Length = 722

 Score = 57.0 bits (136), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 57/233 (24%), Positives = 112/233 (48%), Gaps = 30/233 (12%)

Query: 32  THKVEVVNYLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGDVACLKRVLVQDENGLNEM 91
           T K   V+ + +G F+ +Y V F E   ++   +  P K          ++Q+ N L+ +
Sbjct: 393 TTKFSNVSIMGKGQFSTVYQVTFPETGLKYAIKSVRPTK----HNFTNRILQEINMLSTI 448

Query: 92  RNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMNQRLSTK- 150
           ++ V      +G   IV++  S + +           ++ E C N +L  ++ + +  K 
Sbjct: 449 QDSV--TNDTEGKEYIVEFISSWSHKG-------SFYIMTEFCENGNLDAFIQEHVIAKQ 499

Query: 151 --LTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTSTCFP 208
             L +  I KI+ ++ L++  +H    S++H D+K  NVL+  + N KLADFG  +T  P
Sbjct: 500 QRLEDWRIWKIIVEICLALRFIHD-SCSIVHLDLKPANVLITFEGNLKLADFG-MATKLP 557

Query: 209 IVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGVFLYKL 261
           I    +D +   +        +Y +PE+I   R    + ++DI++LG+ + ++
Sbjct: 558 I----EDKSFENEG-----DREYIAPEII---RDGIYDFRADIFSLGLMMIEI 598

>Kwal_27.10004
          Length = 735

 Score = 57.0 bits (136), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 45/159 (28%), Positives = 66/159 (41%), Gaps = 34/159 (21%)

Query: 129 LLMELCPNKSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVL 188
            +ME C    L   +++    K    E  +    V   I  +H   V  +HRDIK ENVL
Sbjct: 361 FVMEYCTEGDLFSLISKPNWKKRPLKEKYEYWRQVVEGIKFIHSQGV--VHRDIKPENVL 418

Query: 189 VDAKNNFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTT----PQYRSPEMI------- 237
           +  +   K+ DFG +         ++D   LT  + +  T    P Y +PE++       
Sbjct: 419 ISKEGIAKMTDFGISDWG------NEDPDDLTSPVRLFDTYVGSPPYSAPEVVAFKDEDS 472

Query: 238 --------DLYRCLPINEKSDIWALGVFLYKLLFFTTPF 268
                   D Y       K D WALGV L+ L++  TPF
Sbjct: 473 TYQDRKPYDAY-------KMDCWALGVLLFTLVYQCTPF 504

>ACR191C [1238] [Homologous to ScYBL105C (PKC1) - SH] (680398..683847)
            [3450 bp, 1149 aa]
          Length = 1149

 Score = 57.0 bits (136), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 43/186 (23%), Positives = 88/186 (47%), Gaps = 24/186 (12%)

Query: 127  VLLLMELCPNKSLLDYM-NQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIE 185
            +   ME      L+ ++ NQRLS +  +       Y   + ++  ++    +I+RD+K+E
Sbjct: 898  IYFAMEFIGGGDLMWHVQNQRLSVRRAK------FYAAEVLLALKYFHDNGIIYRDLKLE 951

Query: 186  NVLVDAKNNFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPI 245
            N+L+  + + K+AD+G             ++    +      TP++ +PE++   R    
Sbjct: 952  NILLTLEGHIKIADYG---------LCKDEMWFGNRTSTFCGTPEFMAPEIL---REQAY 999

Query: 246  NEKSDIWALGVFLYKLLFFTTPFEMTGQ---F-AILHSKYEFPVNKYSSKLINLIIIMLA 301
             +  D WA GV LY++L   +PF    +   F AIL  +  +P++  +  ++ +   +L 
Sbjct: 1000 TKAVDWWAFGVLLYQMLLCQSPFSGDDEDEVFNAILTDEPLYPID-MAGDIVQIFQGLLT 1058

Query: 302  ENPNLR 307
            ++P  R
Sbjct: 1059 KDPEKR 1064

>ADR167W [1909] [Homologous to ScYNR047W - SH; ScYCR091W (KIN82) -
           SH] complement(994583..997204) [2622 bp, 873 aa]
          Length = 873

 Score = 57.0 bits (136), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 82/347 (23%), Positives = 140/347 (40%), Gaps = 60/347 (17%)

Query: 28  VCVGTHKVEVVNYLAEGGFAQIYVVKFLEYLNEFDNTASVPLKI-GDVACLKRVLVQDEN 86
             VG    E +  L +G   ++Y+V+      E  +     LKI G    +KR  ++   
Sbjct: 454 AVVGPQSFEKIRLLGQGDVGKVYLVR------EKKSDRLYALKIFGKAEMIKRKKIK--- 504

Query: 87  GLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMNQR 146
               +  E E++      P IV  + S  +          + L ME C        +  R
Sbjct: 505 ---RILAEQEILA-TSNHPFIVTLYHSFQTEDY-------LYLCMEYCMGGEFFRALQTR 553

Query: 147 LSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFG----S 202
            +  ++E +      +V  ++  +H +    I+RD+K EN+L+    +  L+DF     +
Sbjct: 554 KTKCISEDDARFYASEVTAALEYLHLM--GFIYRDLKPENILLHQSGHVMLSDFDLSVQA 611

Query: 203 TSTCFPIVTTHQDIALLTQNI---------YVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253
             T  P V  +   +L+   +         +V T  +Y +PE+I   R        D W 
Sbjct: 612 KGTRNPQVKGNAQSSLVDTKVCSDGFRTNSFVGTE-EYIAPEVI---RGNGHTASVDWWT 667

Query: 254 LGVFLYKLLFFTTPF--EMTGQ-FA-ILHSKYEFPVNKYSSKLI-NLIIIMLAENPNLR- 307
           LG+  Y++LF  TPF  + T Q F+ IL +   FP N   S+   +LI  +L +  + R 
Sbjct: 668 LGILTYEMLFGFTPFKGDNTNQTFSNILKNDVYFPNNNDISRTCKDLIKKLLVKKESKRL 727

Query: 308 ------------PNIYQVLYHLCEILNVEVPIEDKYAEGAYNFSKYT 342
                       P    V + L  + N E P+     E  Y+F+K +
Sbjct: 728 GSKFGASEIKKHPFFKTVQWAL--LRNQEPPLIPVLTEDGYDFAKLS 772

>Kwal_33.13846
          Length = 375

 Score = 55.8 bits (133), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 62/127 (48%), Gaps = 21/127 (16%)

Query: 162 DVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTSTCFPIVTTHQDIALLTQ 221
           +V L++  +H     +I+RD+K ENVL+D   + K+ DFG       +  T         
Sbjct: 171 EVCLALEYLH--AQDIIYRDLKPENVLLDKNGHVKITDFGFAKFVPDVTYT--------- 219

Query: 222 NIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGVFLYKLLFFTTPF----EMTGQFAIL 277
              +  TP Y +PE++      P N+  D W+ G+ ++++L   TPF     M     IL
Sbjct: 220 ---LCGTPDYIAPEVVS---TKPYNKSVDWWSFGILIFEMLAGYTPFYDSNTMKTYENIL 273

Query: 278 HSKYEFP 284
           +++ +FP
Sbjct: 274 NAELQFP 280

>ADR317C [2058] [Homologous to ScYDL028C (MPS1) - SH]
           (1263082..1265541) [2460 bp, 819 aa]
          Length = 819

 Score = 56.6 bits (135), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 72/319 (22%), Positives = 130/319 (40%), Gaps = 67/319 (21%)

Query: 27  IVCVGTHKVEVVNYLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGDVACLKRVLVQ--D 84
           ++ V   + E V  L  GG +++Y V+         N+++       +  LKRV     D
Sbjct: 484 VITVNGSEYEKVELLGRGGSSKVYKVR---------NSSN------RIYALKRVSFDEFD 528

Query: 85  ENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMN 144
           +   +  + E+E++KKL+    +V+  D   +          VL ++  C +  L   + 
Sbjct: 529 DASADGFKGEIELLKKLENQTRVVKLIDHEMNH--------GVLYVVMECGDHDLSQVLA 580

Query: 145 QRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTS 204
           QR S  L + E V+      L   ++ +    ++H D+K  N  V  K   K+ DFG  +
Sbjct: 581 QRSSMPL-DIEFVRYHAQEMLKCVKVVH-DAGIVHSDLKPAN-FVFVKGILKIIDFGIAN 637

Query: 205 TCFPIVTTHQDIALLTQNIYVHT---TPQYRSPEMIDL---------------YRCLPIN 246
                V  H      T NIY  T   TP Y +PE +                 +    + 
Sbjct: 638 A----VPDH------TVNIYRDTQIGTPNYMAPEALVAMNYTQDSDQIQQEMHHNRWKVG 687

Query: 247 EKSDIWALGVFLYKLLFFTTPF-EMTGQ---FAILHSKYEF------PVNKYSSKL-INL 295
           + SDIW+ G  +Y++++   P+    GQ    AI++ + +       P   +  +  ++ 
Sbjct: 688 KPSDIWSCGCIMYQMIYGKPPYGSFQGQNRLLAIMNPEVKIVYPEKTPTGDFVPRTALDT 747

Query: 296 IIIMLAENPNLRPNIYQVL 314
           I   L  NP  R  + ++L
Sbjct: 748 IKACLERNPERRWTVDELL 766

>CAGL0D02244g complement(229504..230967) similar to sp|P24719
           Saccharomyces cerevisiae YOR351c MEK1 ser/thr protein
           kinase, hypothetical start
          Length = 487

 Score = 56.2 bits (134), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 47/199 (23%), Positives = 94/199 (47%), Gaps = 36/199 (18%)

Query: 88  LNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMNQ-R 146
           L+++  E +++ +L   PNI++ F ++  +  +      + +  EL P   L  Y+ +  
Sbjct: 199 LSKLDKEAKILMQLN-HPNIIKVFKTHTDKSNN------LYIFQELIPGGDLFSYLAKGD 251

Query: 147 LSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFK---LADFGST 203
               +++ E +  +Y +  ++  +H     ++HRD+K++N+L+     F    LADFG  
Sbjct: 252 CLMPISQTEALVFVYQILHALKYLH--TKGIVHRDLKLDNILLCTPEPFTKIVLADFGIA 309

Query: 204 STCFPIVTTHQDIALLTQNIYVHTTPQYRSPEM---------IDLYRCLPINE-----KS 249
            T    VTT +     ++   V  TP+Y +PE+            +R   + +     K 
Sbjct: 310 RT----VTTMK-----SRMFTVVGTPEYCAPEVGFKANRKAYHSFFRAATLEQQGYDSKC 360

Query: 250 DIWALGVFLYKLLFFTTPF 268
           D+W+LGV  + +L   +PF
Sbjct: 361 DLWSLGVITHIMLTGISPF 379

>CAGL0B02739g complement(262590..264620) similar to sp|P23561
           Saccharomyces cerevisiae YLR362w STE11 ser/thr protein
           kinase of the MEKK family, hypothetical start
          Length = 676

 Score = 56.6 bits (135), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 45/193 (23%), Positives = 91/193 (47%), Gaps = 24/193 (12%)

Query: 88  LNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMNQRL 147
           ++ +++E+ ++K+L+   NIV Y+ S+        +G  + + +E  P  S+   ++   
Sbjct: 456 IDALQHEMSLLKELQHE-NIVTYYGSSQ-------EGGNLNIFLEYVPGGSVSSMLSNY- 506

Query: 148 STKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTSTCF 207
                E  IV     + + ++ +H    ++IHRDIK  N+L+D K   K+ DFG +    
Sbjct: 507 -GPFEEPLIVNFTRQILIGVAYLHR--KNIIHRDIKGANILIDIKGCVKITDFGISKKLS 563

Query: 208 PIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGVFLYKLLFFTTP 267
           P+   +QD     +   +  +  + SPE++   +      K+DIW+ G  + ++     P
Sbjct: 564 PLNQENQD-----KRTSLQGSVYWMSPEVV---KQTATTSKADIWSTGCVVIEMFTGKHP 615

Query: 268 F----EMTGQFAI 276
           +    +M   F I
Sbjct: 616 YPDFSQMQALFKI 628

>KLLA0D03190g 267933..269051 highly similar to sp|P06245
           Saccharomyces cerevisiae YPL203w TPK2 cAMP-dependent
           protein kinase 2, catalytic chain, start by similarity
          Length = 372

 Score = 55.8 bits (133), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 55/107 (51%), Gaps = 17/107 (15%)

Query: 162 DVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTSTCFPIVTTHQDIALLTQ 221
           +V L++  +H    ++I+RD+K EN+L+D   + K+ DFG       +  T         
Sbjct: 168 EVTLALEYLH--SHNIIYRDLKPENILLDRNGHIKITDFGFAKEVITVTWT--------- 216

Query: 222 NIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGVFLYKLLFFTTPF 268
              +  TP Y +PE+I      P N+  D W+LG+ ++++L   TPF
Sbjct: 217 ---LCGTPDYIAPEVI---TTKPYNKSVDWWSLGILIFEMLAGYTPF 257

>Sklu_2066.2 YJL128C, Contig c2066 5081-7000
          Length = 639

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 60/258 (23%), Positives = 118/258 (45%), Gaps = 38/258 (14%)

Query: 74  VACLKRVLVQ-DENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLME 132
           +  +K V ++ DE+   ++  E+EV+ K + +P+IV ++ +        ++G  V + ME
Sbjct: 357 IMAMKEVRLELDESKFTQILMELEVLHKCQ-SPHIVDFYGAFF------IEG-AVYMCME 408

Query: 133 LCPNKSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVD-A 191
                SL    +Q     + E ++  I   V   + ++  +  ++IHRD+K  N+L   A
Sbjct: 409 YMDGGSLDKCYDQDCIGGIDEPQLAYITEAVICGLKELKDV-HNIIHRDVKPTNILCSAA 467

Query: 192 KNNFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINE---- 247
           +   KL DFG        V+ +   ++   NI   +   Y +PE I   + L  ++    
Sbjct: 468 QGTIKLCDFG--------VSGNLVASMAKTNIGCQS---YMAPERI---KSLNPDKSTYT 513

Query: 248 -KSDIWALGVFLYKLLFFTTPF------EMTGQFAIL--HSKYEFPVNKYSSKLINLIII 298
            +SDIW+LG+ + ++     P+       +  Q + +      + P  K+S+   + + +
Sbjct: 514 VQSDIWSLGLSILEMALGAYPYPPETYDNIFSQLSAIVDGPPPKLPQAKFSADAQDFVSM 573

Query: 299 MLAENPNLRPNIYQVLYH 316
            L + P  RPN   +L H
Sbjct: 574 CLQKVPERRPNYAALLEH 591

>CAGL0K01617g complement(142479..144803) similar to sp|P54199
           Saccharomyces cerevisiae YDL028c Serine/threonine
           protein kinase, start by similarity
          Length = 774

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 61/271 (22%), Positives = 111/271 (40%), Gaps = 54/271 (19%)

Query: 26  HIVCVGTHKVEVVNYLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGDVACLKRVLVQ-- 83
           ++V V   + E V  L  GG + +Y V+ L+                 V  LK+V     
Sbjct: 438 NVVSVNGTEYERVELLGRGGSSNVYKVRGLK---------------NRVYALKKVSFDEF 482

Query: 84  DENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYM 143
           DE+ +   + E+ ++K+L+    +VQ +D           G  VL L+  C +  L   +
Sbjct: 483 DESSVEGFKGEISLLKQLQNQNRVVQLYDFE--------MGSGVLYLLMECGDYDLSQVL 534

Query: 144 NQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGST 203
           +QR +       I     ++   +  +H     ++H D+K  N  V  K   K+ DFG  
Sbjct: 535 HQRANQPFDMEFIRYHAREMVTCVKVVH--DAGIVHSDLKPAN-FVFVKGILKIIDFG-I 590

Query: 204 STCFP--IVTTHQDIALLTQNIYVHTTPQYRSPEMI--DLYRC------------LPINE 247
           +   P   V  ++D+ +         TP Y +PE +  + Y                I +
Sbjct: 591 ANAVPDHTVNIYRDMQI--------GTPNYMAPEALVANNYTADNDGKYDQKTNKWKIGK 642

Query: 248 KSDIWALGVFLYKLLFFTTPF-EMTGQFAIL 277
            +DIW+ G  +Y++++   P+ +  GQ  +L
Sbjct: 643 PADIWSCGCIIYQMIYGKPPYAKYQGQERLL 673

>Kwal_56.24059
          Length = 353

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 47/201 (23%), Positives = 86/201 (42%), Gaps = 36/201 (17%)

Query: 162 DVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTSTCFPIVTTHQDIALLTQ 221
           +V L++  +H     +I+RD+K EN+L+D   + K+ DFG       +  T         
Sbjct: 149 EVILALEYLH--SHDIIYRDLKPENILLDRNGHIKITDFGFAKEVDTVTWT--------- 197

Query: 222 NIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGVFLYKLLFFTTPF----EMTGQFAIL 277
              +  TP Y +PE+I      P N+  D W+LG+ ++++L   TPF     M     IL
Sbjct: 198 ---LCGTPDYIAPEVI---ATKPYNKSVDWWSLGILIFEMLAGYTPFYDATPMKTYEKIL 251

Query: 278 HSKYEFPVNKYSSKLINLIIIMLAENPNLR--------------PNIYQVLYHLCEILNV 323
             K  +P   +   +++L+  ++  +   R              P   +V++      ++
Sbjct: 252 QGKVAYP-PFFHPDVVDLLCKLITSDLTRRLGNLQSGPQDVKSHPWFSEVVWEKLLAKDI 310

Query: 324 EVPIEDKYAEGAYNFSKYTQF 344
           E P E     G  + S + Q+
Sbjct: 311 ETPYEPPITAGVGDTSLFDQY 331

>Kwal_55.20189
          Length = 812

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 47/191 (24%), Positives = 83/191 (43%), Gaps = 41/191 (21%)

Query: 94  EVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMNQRLSTKLTE 153
           EV++  K+    NI + +D            F+  ++ME C    L + +   L  K T+
Sbjct: 107 EVDIHTKVGKHKNITELYDF-----------FDSFIVMEYCSGGDLYEAIKADLIPKRTK 155

Query: 154 AEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKN-NFKLADFGSTSTCFPIVTT 212
             I  I   +  +I  +H     + HRD+K EN+L++  +   KL D+G  +T      T
Sbjct: 156 V-ITHIASQIMEAIEFVHQ--KGIYHRDLKPENILIEGSDWTIKLTDWGLATT----EPT 208

Query: 213 HQDIALLTQNIYVHTTPQYRSPEMID----------LYRCLPINEKSDIWALGVFLYKLL 262
             D ++ ++        +Y +PE+ +           Y C     K D+WA+G+ L  ++
Sbjct: 209 SLDRSVGSE--------RYMAPELFEENLDRDERSEPYDC----SKVDLWAIGIVLLNIV 256

Query: 263 FFTTPFEMTGQ 273
           F   PF +  Q
Sbjct: 257 FQKNPFSVANQ 267

>KLLA0A02717g 245082..246380 some similarities with sp|P53233
           Saccharomyces cerevisiae YGR052w, hypothetical start
          Length = 432

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 63/264 (23%), Positives = 103/264 (39%), Gaps = 66/264 (25%)

Query: 33  HKVEVVNYLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGDVACLKRVL-----VQDENG 87
           HK + ++ +  G F+ +Y          +D+      K G    +K V      V+ E  
Sbjct: 2   HKYQPIDVIQTGSFSTVY--------RAYDS------KTGSYVAMKVVSKPADPVKLEAI 47

Query: 88  LNEMRNEVEVMKKLKG-APNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMNQR 146
              +RNE  V+KKL    PNI    D      +        + ++E C N  L DYM + 
Sbjct: 48  SKLVRNEYRVLKKLGNRHPNICAMLDFYQDHEK-------FVFVLEYCHNGDLYDYMKRI 100

Query: 147 LSTKLTEA------------------EIVKIMYDVALSISQMHYLPVSLIHRDIKIENVL 188
             +  T+                       +M+ +  ++   H L ++  HRD K EN+L
Sbjct: 101 KESGGTDKNSKNARNSKSSSKSPPKLHFHSLMFQLCSALKYCHTLGIA--HRDFKPENIL 158

Query: 189 VDAKNNFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMI---DLYRCLPI 245
           V      KL DFG +   F  V +   I           T +Y +PE     D Y     
Sbjct: 159 VTNTGKIKLTDFGLSY--FGEVASDHGIG----------TEKYLAPETFSHNDTYN---- 202

Query: 246 NEKSDIWALGVFLYKLLFFTTPFE 269
              +D+W+LG+ +  ++F + PF+
Sbjct: 203 TYSADLWSLGISVLYIVFGSCPFK 226

>Kwal_56.24584
          Length = 435

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 57/201 (28%), Positives = 94/201 (46%), Gaps = 42/201 (20%)

Query: 89  NEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMN---- 144
           +++  E+ +M+ +K   NIV +F +  +         E+++LME     SL   M+    
Sbjct: 142 SQLIRELSIMQNVKPHDNIVGFFGAFYTASTSN----EIVILMEYMDCSSLDKIMSTYKA 197

Query: 145 ------QRLS-TKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKL 197
                 Q L+ T   E  + KI Y V   +S + Y    +IHRDIK  NVL+++K   K+
Sbjct: 198 FVARDMQSLTETWFPEFVLAKISYAVLNGLSYL-YRNYKIIHRDIKPSNVLINSKGFVKI 256

Query: 198 ADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMID--LYRCLPINEKSDIWALG 255
            DFG +            IA    + +V T+  Y SPE I   +Y     + K D+W+LG
Sbjct: 257 CDFGVSKKLI------NSIA----DTFVGTS-TYMSPERIQGSVY-----STKGDVWSLG 300

Query: 256 VFLYKLLFFTTPFEMTGQFAI 276
           + + +L        +TG+F +
Sbjct: 301 LMIIEL--------VTGEFPL 313

>YKL048C (ELM1) [3211] chr11 complement(346859..348781)
           Serine/threonine protein kinase that regulates
           pseudohyphal growth [1923 bp, 640 aa]
          Length = 640

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 53/184 (28%), Positives = 88/184 (47%), Gaps = 17/184 (9%)

Query: 158 KIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNF-KLADFGS---TSTCFPIVTTH 213
           KI+ D+   +  +H      IHRDIK  N+L+D +    KL+DFGS   T    P    +
Sbjct: 238 KILEDMTKGLEYLH--SQGCIHRDIKPSNILLDEEEKVAKLSDFGSCIFTPQSLPFSDAN 295

Query: 214 QDIALLTQNIYVHTTPQYRSPEMIDLYRC----LPINEKSDIWALGVFLYKLLFFTTPFE 269
            +     +   +  TP + +PE+  L       +    K DIW+LGV LY LL+   PF 
Sbjct: 296 FEDCFQRELNKIVGTPAFIAPELCHLGNSKRDFVTDGFKLDIWSLGVTLYCLLYNELPFF 355

Query: 270 MTGQFAILHSKYEFPV-NKYSSKLINLIII--MLAENPNLRPNIYQVLYHLCEILNVEVP 326
              +F   H   E  + +K +   +N ++I  +L ++  LR +I      L ++L+ + P
Sbjct: 356 GENEFETYHKIIEVSLSSKINGNTLNDLVIKRLLEKDVTLRISIQD----LVKVLSRDQP 411

Query: 327 IEDK 330
           I+ +
Sbjct: 412 IDSR 415

>YDR283C (GCN2) [1112] chr4 complement(1025062..1030041)
           Serine/threonine protein kinase that regulates
           initiation of translation by phosphorylation of
           eIF2alpha (Sui2p), involved in general amino acid
           control response and salt tolerance [4980 bp, 1659 aa]
          Length = 1659

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 60/229 (26%), Positives = 103/229 (44%), Gaps = 44/229 (19%)

Query: 114 NASRRRDGVQGFE-------VLLLMELCPNKSLLDYMNQRLSTKLTEA--EIVKIMYDVA 164
           N  RRR+ V+          + + ME C N++L D ++   S  L +   E  ++   + 
Sbjct: 764 NVPRRRNFVKPMTAVKKKSTLFIQMEYCENRTLYDLIH---SENLNQQRDEYWRLFRQIL 820

Query: 165 LSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTSTCFPIVTTHQDIALL---TQ 221
            ++S +H     +IHRD+K  N+ +D   N K+ DFG           H+ + +L   +Q
Sbjct: 821 EALSYIH--SQGIIHRDLKPMNIFIDESRNVKIGDFGLAKNV------HRSLDILKLDSQ 872

Query: 222 NI--------YVHTTPQYRSPEMIDLYRCLPINEKSDIWALGVFLYKLLF-FTTPFEMTG 272
           N+            T  Y + E++D       NEK D+++LG+  +++++ F+T  E   
Sbjct: 873 NLPGSSDNLTSAIGTAMYVATEVLD--GTGHYNEKIDMYSLGIIFFEMIYPFSTGMERVN 930

Query: 273 QFAILHS-KYEFPVN------KYSSKLINLIIIMLAENPNLRPNIYQVL 314
               L S   EFP +      K   K+I L+I     +PN RP    +L
Sbjct: 931 ILKKLRSVSIEFPPDFDDNKMKVEKKIIRLLI---DHDPNKRPGARTLL 976

>YFR014C (CMK1) [1695] chr6 complement(172529..173869)
           Calcium/calmodulin-dependent serine/threonine protein
           kinase (CaM kinase) type I [1341 bp, 446 aa]
          Length = 446

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 66/266 (24%), Positives = 123/266 (46%), Gaps = 46/266 (17%)

Query: 73  DVAC---LKRVLVQDENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLL 129
           DVA    +K+ L  ++  L  + +E++++++L   PNIV + D   S+ +         +
Sbjct: 62  DVAVKILIKKALKGNKVQLEALYDELDILQRLH-HPNIVAFKDWFESKDK-------FYI 113

Query: 130 LMELCPNKSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLV 189
           + +L     L D + ++   K TE + V+I+ ++  ++  MH    +++HRD+K EN+L 
Sbjct: 114 ITQLAKGGELFDRILKK--GKFTEEDAVRILVEILSAVKYMH--SQNIVHRDLKPENLLY 169

Query: 190 DAKNN---FKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMI--DLYRCLP 244
             K++     +ADFG             D  LL +      +  Y +PE++  D +    
Sbjct: 170 IDKSDESPLVVADFGIAKRL------KSDEELLYKP---AGSLGYVAPEVLTQDGH---- 216

Query: 245 INEKSDIWALGVFLYKLLFFTTPF--EMTGQFAILHSKYEFPV-------NKYSSKLINL 295
             +  DIW++GV  Y LL   + F  E    F    +  E+PV       +  S+K    
Sbjct: 217 -GKPCDIWSIGVITYTLLCGYSAFRAERVQDFLDECTTGEYPVKFHRPYWDSVSNKAKQF 275

Query: 296 IIIMLAENPNLRPNIYQVL---YHLC 318
           I+  L  +P+ RP   ++L   + +C
Sbjct: 276 ILKALNLDPSKRPTAAELLEDPWIIC 301

>Kwal_27.10581
          Length = 1154

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 42/186 (22%), Positives = 87/186 (46%), Gaps = 24/186 (12%)

Query: 127  VLLLMELCPNKSLLDYM-NQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIE 185
            +   ME      L+ ++ NQRLS +  +       Y   + ++  ++    +I+RD+K+E
Sbjct: 903  IYFAMEFIGGGDLMWHVQNQRLSVRRAK------FYAAEVLLALKYFHDNGVIYRDLKLE 956

Query: 186  NVLVDAKNNFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPI 245
            N+L+  + + K+AD+G             ++    +      TP++ +PE++        
Sbjct: 957  NILLTPEGHIKIADYG---------LCKDEMWYGNKTSTFCGTPEFMAPEILKEQE---Y 1004

Query: 246  NEKSDIWALGVFLYKLLFFTTPFEMTGQ---F-AILHSKYEFPVNKYSSKLINLIIIMLA 301
             +  D WA GV LY++L   +PF    +   F AIL  +  +P++  +  ++ +   +L 
Sbjct: 1005 TKAVDWWAFGVLLYQMLLCQSPFSGEDEDEVFNAILTDEPLYPID-MAGDIVQIFQGLLT 1063

Query: 302  ENPNLR 307
            ++P  R
Sbjct: 1064 KDPERR 1069

>Scas_544.6
          Length = 489

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 54/207 (26%), Positives = 99/207 (47%), Gaps = 42/207 (20%)

Query: 84  DENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMEL--CPNKSLLD 141
           +E  +N++  E+ +MK +K   NI+ ++ +  +      Q  E+++LME   C +   + 
Sbjct: 194 NEIVVNQLIRELTIMKSIKPHKNIISFYAAFYTHH----QNNEIVILMEYMDCGSLDRIF 249

Query: 142 YMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVS----------LIHRDIKIENVLVDA 191
              +R   +       K  ++ +L +S++ Y  ++          +IHRDIK  NVL+++
Sbjct: 250 STYKRFVARGVLDPREKNWFNDSLILSRISYAVLNGLNYLYENYKIIHRDIKPSNVLINS 309

Query: 192 KNNFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMI--DLYRCLPINEKS 249
           K   KL DFG +            IA    + +V T+  Y SPE I  ++Y     + K 
Sbjct: 310 KGLVKLCDFGVSKKLI------NSIA----DTFVGTS-TYMSPERIQGNVY-----STKG 353

Query: 250 DIWALGVFLYKLLFFTTPFEMTGQFAI 276
           D+W+LG+ + +L+        TGQF +
Sbjct: 354 DVWSLGLMIIELV--------TGQFPL 372

>YBL105C (PKC1) [98] chr2 complement(14241..17696) Protein kinase C,
            regulates MAP kinase cascade involved in regulating cell
            wall metabolism [3456 bp, 1151 aa]
          Length = 1151

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 42/186 (22%), Positives = 89/186 (47%), Gaps = 24/186 (12%)

Query: 127  VLLLMELCPNKSLLDYM-NQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIE 185
            +   ME      L+ ++ NQRLS +  +       Y   + ++  ++    +I+RD+K+E
Sbjct: 900  IYFAMEFIGGGDLMWHVQNQRLSVRRAK------FYAAEVLLALKYFHDNGVIYRDLKLE 953

Query: 186  NVLVDAKNNFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPI 245
            N+L+  + + K+AD+G             ++    +      TP++ +PE++   +    
Sbjct: 954  NILLTPEGHIKIADYG---------LCKDEMWYGNRTSTFCGTPEFMAPEIL---KEQEY 1001

Query: 246  NEKSDIWALGVFLYKLLFFTTPFEMTGQ---F-AILHSKYEFPVNKYSSKLINLIIIMLA 301
             +  D WA GV LY++L   +PF    +   F AIL  +  +P++  + +++ +   +L 
Sbjct: 1002 TKAVDWWAFGVLLYQMLLCQSPFSGDDEDEVFNAILTDEPLYPID-MAGEIVQIFQGLLT 1060

Query: 302  ENPNLR 307
            ++P  R
Sbjct: 1061 KDPEKR 1066

>Kwal_0.96
          Length = 427

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 65/253 (25%), Positives = 110/253 (43%), Gaps = 42/253 (16%)

Query: 77  LKRVLVQDENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPN 136
           LK+ L   +  L  + +E+ +++KL   PNIV++ D   S+ +         ++ +L   
Sbjct: 78  LKKALKGKDVELQMLYDELSILQKLD-HPNIVKFKDWFESKDK-------FYIVTQLATG 129

Query: 137 KSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLV---DAKN 193
             L D + ++   K TE + V+I+Y +  ++  +H    +++HRD+K EN+L     A +
Sbjct: 130 GELFDRILKQ--GKFTEEDAVRIVYQILKAVEYLH--SRNIVHRDLKPENLLYLTEAADS 185

Query: 194 NFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQ---YRSPEMIDLYRCLPINEKSD 250
              L DFG                L   +  +H       Y +PE++         +  D
Sbjct: 186 QLVLGDFGIAK------------ELKNDDELIHKAAGSMGYVAPEVVTTSGH---GKPCD 230

Query: 251 IWALGVFLYKLLFFTTPF--EMTGQFAILHSKYEFPVN---KYSSKLIN----LIIIMLA 301
           IW+LGV  Y LL   +PF  E    F    +    PV     Y S + N     I+  L 
Sbjct: 231 IWSLGVVTYTLLCGYSPFVAESVEGFLEECTIGRTPVTFHKPYWSNISNEAKDFILRALT 290

Query: 302 ENPNLRPNIYQVL 314
            NP+ RP   ++L
Sbjct: 291 VNPHDRPTATELL 303

>CAGL0F09075g 894761..897001 similar to sp|P11792 Saccharomyces
           cerevisiae YHR205w SCH9 serine/threonine protein kinase,
           start by similarity
          Length = 746

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 70/288 (24%), Positives = 126/288 (43%), Gaps = 51/288 (17%)

Query: 31  GTHKVEVVNYLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGDVACLKRVLVQDENGLNE 90
           G    EV+  L +G F Q+Y VK      + D      +K+      K+V+V+     NE
Sbjct: 336 GPQDFEVLRLLGKGTFGQVYQVK------KKDTKRIYAMKV----LSKKVIVKK----NE 381

Query: 91  MRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQ-GFE----VLLLMELCPNKSLLDYMNQ 145
           + + +       G  NI+    S AS    G++  F+    + L+ +      L  ++ +
Sbjct: 382 IAHTI-------GERNILVTTSSKASPFIVGLKFSFQTPTDLYLVTDYMSGGELFWHLQR 434

Query: 146 RLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTST 205
               + TE      + ++ L++  +H     +++RD+K EN+L+DA  N  L DFG +  
Sbjct: 435 E--GRFTEDRAKFYIAELVLALEHLH--DNDIVYRDLKPENILLDANGNIALCDFGLSKA 490

Query: 206 CFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGVFLYKLLFFT 265
                    D+   T N +  TT +Y +PE+  L       +  D W+LGV ++++    
Sbjct: 491 ---------DLKDRT-NTFCGTT-EYLAPEL--LLDESGYTKMVDFWSLGVLIFEMCCGW 537

Query: 266 TPF------EMTGQFAILHSKYEFPVNKYSSKLINLIIIMLAENPNLR 307
           +PF      +M  + A    K +FP +  S +  + +  +L  NP  R
Sbjct: 538 SPFYAEDNQKMYQKIAF--GKVKFPRDILSPEGRSFVKGLLNRNPKHR 583

>YPR054W (SMK1) [5484] chr16 (666275..667441) Sporulation-specific
           protein kinase of the MAP family required for completion
           of sporulation [1167 bp, 388 aa]
          Length = 388

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 59/231 (25%), Positives = 94/231 (40%), Gaps = 37/231 (16%)

Query: 36  EVVNYLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGDVACLKRV--LVQDENGLNEMRN 93
           E++ +L +G +  +  VKF           S   +I     +K++  +   E  L     
Sbjct: 39  EIIQFLGKGAYGTVCSVKF--------KGRSPAARIA----VKKISNIFNKEILLKRAIR 86

Query: 94  EVEVMKKLKGAPNIVQYFDSN--ASRRRDGVQGFEVLLLMELCPNKSLLDYMNQRL---S 148
           E++ M   KG  NIV   D     S   DG+  ++            L+DY   ++   S
Sbjct: 87  ELKFMNFFKGHKNIVNLIDLEIVTSSPYDGLYCYQ-----------ELIDYDLAKVIHSS 135

Query: 149 TKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTSTCFP 208
            +L+E  I   +Y +   +  +H     +IHRD+K  N+L       K+ DFG       
Sbjct: 136 VQLSEFHIKYFLYQILCGLKYIH--SADVIHRDLKPGNILCTLNGCLKICDFGLARGIHA 193

Query: 209 -IVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGVFL 258
                H  +     N YV  T  YR+PE+  L    P ++  DIWA+G  L
Sbjct: 194 GFFKCHSTVQPHITN-YV-ATRWYRAPEL--LLSNQPYSKSVDIWAVGCIL 240

>ACR119W [1166] [Homologous to ScYPL141C - SH; ScYOR233W (KIN4) -
           SH] complement(560761..563556) [2796 bp, 931 aa]
          Length = 931

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 52/230 (22%), Positives = 101/230 (43%), Gaps = 38/230 (16%)

Query: 100 KLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMNQRLSTKLTEAEIVKI 159
           KL   PNIV+  +   + +  G+       +++         Y+ ++   +L E    ++
Sbjct: 103 KLLSHPNIVRLEEVLQNSKYIGI-------VLQYASGGEFYKYIQKK--RRLKEPPACRL 153

Query: 160 MYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTSTCFPIVTTHQDIALL 219
              +   +  +HY    L HRD+K+EN+L+D   N  + DFG  +        H++  + 
Sbjct: 154 FAQLISGVHYIHY--KGLAHRDLKLENLLLDEHENLIITDFGFVNEF------HKNDLMR 205

Query: 220 TQNIYVHTTPQYRSPEMIDLYRCLPIN-EKSDIWALGVFLYKLLFFTTPFEMTGQFA--- 275
           T       +P Y +PE++      P + +K+D+W+ GV LY +L    P++   +     
Sbjct: 206 TSC----GSPCYAAPELV--VSSKPYSAQKADVWSCGVILYAMLAGYLPWDDDPENPEGE 259

Query: 276 --------ILHSKYEFPVNKYSSKLI-NLIIIMLAENPNLRPNIYQVLYH 316
                   I H+  +FP  +Y   +  +L+  +L  NP +R  +  +  H
Sbjct: 260 DIAKLYQYITHTSLKFP--EYIKPIPRDLLKRILVSNPEVRLTVADIEQH 307

>Scas_703.5
          Length = 749

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 68/285 (23%), Positives = 124/285 (43%), Gaps = 45/285 (15%)

Query: 31  GTHKVEVVNYLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGDVACLKRVLVQDENGLNE 90
           G +  EV+  L +G F Q+Y VK      + D      +K+      K+V+V+     + 
Sbjct: 340 GPNDFEVLRLLGKGTFGQVYQVK------KKDTKRIYAMKV----LSKKVIVKKNEVAHT 389

Query: 91  M--RNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMNQRLS 148
           +  RN + V    K +P IV    S  +         ++ L+ +      L  ++ +   
Sbjct: 390 IGERN-ILVTTATKASPFIVGLKFSFQTPT-------DLYLVTDFMSGGELFWHLQKE-- 439

Query: 149 TKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTSTCFP 208
            + TE      + ++ L++  +H     +++RD+K EN+L+DA  N  L DFG       
Sbjct: 440 GRFTEERAKFYIAELVLALEYLH--DNDIVYRDLKPENILLDANGNIALCDFG------- 490

Query: 209 IVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGVFLYKLLFFTTPF 268
              +  D+   T N +  TT +Y +PE+  L       +  D W+LGV ++++    +PF
Sbjct: 491 --LSKADLKDRT-NTFCGTT-EYLAPEL--LLDEAGYTKMVDFWSLGVLIFEMCCGWSPF 544

Query: 269 ------EMTGQFAILHSKYEFPVNKYSSKLINLIIIMLAENPNLR 307
                 +M  + A    K +FP +  S +  + +  +L  NP  R
Sbjct: 545 FAEDNQKMYQKIAF--GKVKFPRDVLSPEGRSFVKGLLNRNPKHR 587

>Scas_683.12
          Length = 356

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 51/189 (26%), Positives = 83/189 (43%), Gaps = 35/189 (18%)

Query: 91  MRNEVEVMKKL-KGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMN----- 144
           M NE E+MK L +  PNI    D               +L++E C    L D+++     
Sbjct: 44  MANEFEIMKILGRSHPNICSMLDFYQDTNY-------YVLVLEYCEYGDLYDFLSVAKRQ 96

Query: 145 -QRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGST 203
             ++     + +  K++  ++ +I   H L ++  HRDIK EN+L+  + + KLAD+G  
Sbjct: 97  GDQIHPSTIQLDFAKVLRQISSAIMYSHSLGIA--HRDIKPENILLTKEGDIKLADWG-- 152

Query: 204 STCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDL---YRCLPINEKSDIWALGVFLYK 260
                    H      ++  ++  T  YR+PE  D    Y    I    D W+LGV    
Sbjct: 153 ---------HAIRDSFSKESHI-GTDNYRAPETFDCTIEYDTFKI----DYWSLGVTSLY 198

Query: 261 LLFFTTPFE 269
           L+F   PF+
Sbjct: 199 LIFGQAPFK 207

>Kwal_33.14192
          Length = 577

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/149 (24%), Positives = 69/149 (46%), Gaps = 17/149 (11%)

Query: 123 QGFEVLLLMELCPNKSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDI 182
           +G   L++ME CP     D+ N  +S  +++ EI      +   +  +H +   L HRD+
Sbjct: 291 EGTNFLVVMEYCP----YDFFNLVMSDLMSKNEISCYFKQICNGVDYLHRM--GLAHRDL 344

Query: 183 KIENVLVDAKNNFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMID--LY 240
           K++N +V  +   KL DFGS      +     +  +L     V + P Y +PE++    Y
Sbjct: 345 KLDNCVVTKQGILKLIDFGSAV----VFQYPYEKEILRAKGIVGSDP-YLAPELLSHPSY 399

Query: 241 RCLPINEKSDIWALGVFLYKLLFFTTPFE 269
              P+    D+W++ +  Y +     P++
Sbjct: 400 DPRPV----DVWSIAIMFYCITLKRFPWK 424

>YOL016C (CMK2) [4800] chr15 complement(294777..296120)
           Calcium/calmodulin-dependent serine/threonine protein
           kinase (CaM kinase) type II [1344 bp, 447 aa]
          Length = 447

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 71/260 (27%), Positives = 115/260 (44%), Gaps = 45/260 (17%)

Query: 73  DVAC---LKRVLVQDENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLL 129
           DVA    LK+ L  +   L  +  E+ +++KL   PNIV + D   S+ +         +
Sbjct: 72  DVAIKILLKKALQGNNVQLQMLYEELSILQKL-SHPNIVSFKDWFESKDK-------FYI 123

Query: 130 LMELCPNKSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVL- 188
           + +L     L D +  R   K TE + V+I+  +  ++  MH    +++HRD+K ENVL 
Sbjct: 124 VTQLATGGELFDRILSR--GKFTEVDAVEIIVQILGAVEYMH--SKNVVHRDLKPENVLY 179

Query: 189 VDAKNN--FKLADFGSTSTCFPIVTTHQDIALLTQNIY-VHTTPQYRSPEMI--DLYRCL 243
           VD   N    +ADFG        +   +D+      IY    +  Y +PE++  D +   
Sbjct: 180 VDKSENSPLVIADFGIAKQ----LKGEEDL------IYKAAGSLGYVAPEVLTQDGH--- 226

Query: 244 PINEKSDIWALGVFLYKLLFFTTPF--EMTGQFAILHSKYEFPV-------NKYSSKLIN 294
              +  DIW++GV  Y LL   +PF  E    F    +   +PV       +  S  +  
Sbjct: 227 --GKPCDIWSIGVITYTLLCGYSPFIAESVEGFMEECTASRYPVTFHMPYWDNISIDVKR 284

Query: 295 LIIIMLAENPNLRPNIYQVL 314
            I+  L  NP  RP   ++L
Sbjct: 285 FILKALRLNPADRPTATELL 304

>YLR362W (STE11) [3744] chr12 (849865..852018) MAP kinase kinase
           kinase (MAPKKK or MEKK), component of pheromone
           response, filamentous growth, high-osmolarity sensing,
           and STE vegetative growth pathways [2154 bp, 717 aa]
          Length = 717

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 45/193 (23%), Positives = 89/193 (46%), Gaps = 25/193 (12%)

Query: 88  LNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMNQRL 147
           ++ +++E+ ++K+L    NIV Y+ ++        +G  + + +E  P  S+   +N   
Sbjct: 498 VDALQHEMNLLKELH-HENIVTYYGASQ-------EGGNLNIFLEYVPGGSVSSMLNNY- 548

Query: 148 STKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTSTCF 207
                E+ I      + + ++ +H    ++IHRDIK  N+L+D K   K+ DFG +    
Sbjct: 549 -GPFEESLITNFTRQILIGVAYLH--KKNIIHRDIKGANILIDIKGCVKITDFGISKKLS 605

Query: 208 PIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGVFLYKLLFFTTP 267
           P+       A L  +++      + SPE++   +      K+DIW+ G  + ++     P
Sbjct: 606 PLNKKQNKRASLQGSVF------WMSPEVV---KQTATTAKADIWSTGCVVIEMFTGKHP 656

Query: 268 F----EMTGQFAI 276
           F    +M   F I
Sbjct: 657 FPDFSQMQAIFKI 669

>AER222C [2724] [Homologous to ScYAR018C (KIN3) - SH]
           (1043479..1044750) [1272 bp, 423 aa]
          Length = 423

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 68/263 (25%), Positives = 106/263 (40%), Gaps = 67/263 (25%)

Query: 106 NIVQYFDSNASRRRDG-----VQGFEVLLLMELCPNKSLLDYMN--QRLSTKLTEAEIVK 158
           NIV++++ + +  R G       G  + L ME C    L   +   + +   + E +I +
Sbjct: 85  NIVEFYNWDHASSRTGNSVDYGNGEVLYLYMEYCSCGDLSQMIKHYKGMRKYVPERDIWR 144

Query: 159 IMYDVALSISQMHY---LP---------------------VSLIHRDIKIENVLVD---- 190
           I   + L++ + H    LP                      S+IHRD+K  N+ +     
Sbjct: 145 IAVQLLLALYKCHTSCDLPQLDTIYDKISKSAIESEAGKVTSVIHRDLKPGNIFLTGDGV 204

Query: 191 --------AKNNFKLADFG---STSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPE-MID 238
                   +K   KL DFG   S  +     TT           YV  TP Y SPE ++D
Sbjct: 205 GGRGSVDYSKVEVKLGDFGLAKSLQSAIEFATT-----------YV-GTPYYMSPEVLMD 252

Query: 239 LYRCLPINEKSDIWALGVFLYKLLFFTTPFE----MTGQFAILHSKYEFPVNKYSSKLIN 294
                P +  SDIW+LG  +Y+L     PF     M  Q  I  +  +   + YS +L  
Sbjct: 253 Q----PYSPLSDIWSLGCVIYELCALRVPFPARNFMELQRMIQRADVQPLPDYYSKELQQ 308

Query: 295 LIIIMLAENPNLRPNIYQVLYHL 317
           L+I  +  N  LRP+ + +L  L
Sbjct: 309 LVISCINPNEKLRPSAFDLLQCL 331

>YMR139W (RIM11) [4096] chr13 (546124..547236) Member of the GSK3
           subfamily of protein kinases, required for induction of
           IME2 by Ime1p [1113 bp, 370 aa]
          Length = 370

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 59/205 (28%), Positives = 101/205 (49%), Gaps = 30/205 (14%)

Query: 65  ASVPLKIGDVACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNIV--QYFDSNASRRRDGV 122
           A+V  +  +   +K+VL QD+   N    E+E+MK L    NI+  +YF       RD  
Sbjct: 55  ATVIQETNEKVAIKKVL-QDKRFKN---RELEIMKMLSHI-NIIDLKYF----FYERDSQ 105

Query: 123 QGFEVLLLMELCPN---KSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIH 179
               + L++E  P    + L  +++QR  T ++  EI   M+ +  S++ +H+   ++ H
Sbjct: 106 DEIYLNLILEYMPQSLYQRLRHFVHQR--TPMSRLEIKYYMFQLFKSLNYLHHF-ANVCH 162

Query: 180 RDIKIENVLVDAKN-NFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMID 238
           RDIK +N+LVD +  + KL DFGS     P   T  +++ +           YR+PE+I 
Sbjct: 163 RDIKPQNLLVDPETWSLKLCDFGSAKQLKP---TEPNVSYICSR-------YYRAPELI- 211

Query: 239 LYRCLPINEKSDIWALGVFLYKLLF 263
            +       + DIW+ G  + +LL 
Sbjct: 212 -FGATNYTNQIDIWSSGCVMAELLL 235

>Scas_634.5
          Length = 790

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 55/231 (23%), Positives = 111/231 (48%), Gaps = 31/231 (13%)

Query: 34  KVEVVNYLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGDVACLKRVLVQDENGLNEMRN 93
           K   V+ +  G F+ +Y V F     ++   A   +K      L R+L Q+   L+E+R 
Sbjct: 443 KFNNVHMIGSGQFSSVYQVTFAPTNKKY---AVKAVKANKYNSLNRIL-QEIKILDEIRT 498

Query: 94  EVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMNQRL---STK 150
                  L+G   ++ +    +S +  G       ++ E   N +L  ++ +++   +T+
Sbjct: 499 S---QLDLEGKEYVIDFI---SSWKYQG----SFYIMSEYYDNGNLDSFLQEQIISKNTR 548

Query: 151 LTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTSTCFPIV 210
           L +  I KI+ +++L++  +H     ++H D+K  N+L+  + N KLADFG        +
Sbjct: 549 LEDWRIWKIIVELSLALRFIHQT-CHVVHLDLKPTNILITFEGNLKLADFG--------M 599

Query: 211 TTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGVFLYKL 261
             H  + L  Q+       +Y +PE+I    C+  + K+DI++LG+ + ++
Sbjct: 600 AAH--LPLRDQDFENEGDREYIAPEIIS--ECI-YDFKADIFSLGLMIVEI 645

>Kwal_33.14081
          Length = 580

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 61/255 (23%), Positives = 115/255 (45%), Gaps = 32/255 (12%)

Query: 74  VACLKRVLVQ-DENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLME 132
           +  +K V ++ DE+   ++  E+EV+ K + +P IV ++ +        ++G  V + ME
Sbjct: 299 IMAMKEVRLELDESKFTQILMELEVLHKCQ-SPYIVDFYGAFF------IEG-AVYMCME 350

Query: 133 LCPNKSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDA- 191
                SL    +  +   + E E+  I   +   + ++  +  ++IHRD+K  NVL  A 
Sbjct: 351 YMDGGSLDKSYDSDVLGGIDEPELAYIANAIIQGLKELKDVH-NIIHRDVKPTNVLCSAA 409

Query: 192 KNNFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRC--LPINEKS 249
           +   KL DFG        V+ +   +L   NI   +   Y +PE I  +         +S
Sbjct: 410 QGTVKLCDFG--------VSGNLVASLAKTNIGCQS---YMAPERIKSFNPDKATYTVQS 458

Query: 250 DIWALGVFLYKLLFFTTPFEM-------TGQFAILHS-KYEFPVNKYSSKLINLIIIMLA 301
           DIW+LG+ + ++   T P+ +       +   AI+ S   + P  ++S    + + + L 
Sbjct: 459 DIWSLGLSILEMAIGTYPYPVETFDNIFSQLSAIVDSPPPQLPKGRFSPMAQDFVNMCLQ 518

Query: 302 ENPNLRPNIYQVLYH 316
           + P  R N   +L H
Sbjct: 519 KIPERRRNYAALLEH 533

>Kwal_27.9763
          Length = 868

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 64/249 (25%), Positives = 108/249 (43%), Gaps = 44/249 (17%)

Query: 94  EVEVMKKLKGAPNIVQYFDSNASRRRDGVQGF-----EVLLLMELCPNKSLLDYMNQRLS 148
           E++++K LK   NIV+Y             GF     ++ +L+E C   SL D + +   
Sbjct: 68  EIDLLKNLKHE-NIVKY------------HGFIQKSHQLFILLEYCSQGSLRDLIKR--- 111

Query: 149 TKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTSTCFP 208
             + E +    +      +  +H     +IHRDIK  N+L+DA+N  KLADFG ++    
Sbjct: 112 GPVEEQQCKTYIRQTLHGLKYLH--DQGVIHRDIKAANLLLDAQNVVKLADFGVSTRVNN 169

Query: 209 IVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGVFLYKLLFFTTPF 268
           +  T+              +P + +PE++        +  SDIW+LG  + ++L    PF
Sbjct: 170 LAMTYAG------------SPNWMAPEVM---MGQGASTVSDIWSLGATVVEILTGNPPF 214

Query: 269 E----MTGQFAILHSKYEFPVNKYSSKLINLIIIMLAENPNLRPNIYQVLYHLCEILNVE 324
                    +AI+H  Y  P +  SS     +     +N   RP    +L H   I   +
Sbjct: 215 HNLVNEAACYAIVHDVY-IPPSTLSSSCRKFLRSCFQKNMFKRPKAQDLLSHE-WIFETK 272

Query: 325 VPIEDKYAE 333
            PI +++ E
Sbjct: 273 KPILERFKE 281

>KLLA0D09328g complement(788565..791705) some similarities with
           sp|P38990 Saccharomyces cerevisiae YER129w PAK1 DNA
           polymerase alpha suppressing protein kinase,
           hypothetical start
          Length = 1046

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 52/207 (25%), Positives = 92/207 (44%), Gaps = 36/207 (17%)

Query: 82  VQDENGLNEMRNEVEVMKKL--KGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSL 139
           ++DE    +++ E+ +MKK   +    +++  D   SR+        + L++E C    +
Sbjct: 169 IEDE----KIKREIAIMKKCHHEHVVKLIEVLDDAKSRK--------IYLVLEYCSKGEI 216

Query: 140 LDYMNQRLSTK------LTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKN 193
                  + TK      L+     +I   V L +  +H+    +IHRDIK  N+L+    
Sbjct: 217 KWCPGDVIETKARGPPLLSFQRTREIFRGVLLGLEYLHF--QGIIHRDIKPANLLLSEDG 274

Query: 194 NFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEM------IDLYRCLP--- 244
             K++DFG  S  F   ++   +  L +      TP + +PE+      I  +   P   
Sbjct: 275 IVKISDFG-VSLAFSSDSSTDSLNEL-ELAKTAGTPAFFAPEICLVEDTIKKFDLDPNSK 332

Query: 245 ---INEKSDIWALGVFLYKLLFFTTPF 268
              I+  +DIWA+G+ L+ LLF   PF
Sbjct: 333 EPIISFPTDIWAMGITLHCLLFGMLPF 359

>ADR253W [1994] [Homologous to ScYMR139W (RIM11) - SH; ScYDL079C
           (MRK1) - SH] complement(1141943..1143085) [1143 bp, 380
           aa]
          Length = 380

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 64/217 (29%), Positives = 97/217 (44%), Gaps = 41/217 (18%)

Query: 72  GDVACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLM 131
           G+   +K+VL QD    N    E+E+MK L+  PN+V   D          Q  EV L +
Sbjct: 55  GEKVAIKKVL-QDRRFKN---RELEIMKLLQ-HPNVV---DLRYHFYESEPQTNEVYLNL 106

Query: 132 ELCPNKSLLDYMNQRLSTKLTEA----------EIVKIMYDVALSISQMHYLPVSLIHRD 181
                  +L+YM Q L  +L             EI   M+ +  S++ +H +   + HRD
Sbjct: 107 -------ILEYMPQSLYQRLRHFVTGRLLMPRDEIKVYMFQLFKSLNYLHRV-ARVCHRD 158

Query: 182 IKIENVLVDAKN-NFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLY 240
           IK +N+LVDA     KL DFGS     P   T  +++ +           YR+PE+I  +
Sbjct: 159 IKPQNLLVDAGTLQLKLCDFGSAKQLRP---TEPNVSYICSR-------YYRAPELI--F 206

Query: 241 RCLPINEKSDIWALGVFLYKLLFFTTPFEMTGQFAIL 277
                  + DIW+ G  + +LL     F   G+F I+
Sbjct: 207 GATNYTTQIDIWSTGCVMAELLLGQPMF--PGEFVIV 241

>Sklu_2211.5 YBL105C, Contig c2211 10237-13764
          Length = 1175

 Score = 55.1 bits (131), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 41/186 (22%), Positives = 88/186 (47%), Gaps = 24/186 (12%)

Query: 127  VLLLMELCPNKSLLDYM-NQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIE 185
            +   ME      L+ ++ NQRLS +  +       Y   + ++  ++    +++RD+K+E
Sbjct: 924  IYFAMEFIGGGDLMWHVQNQRLSVRRAK------FYAAEVLLALKYFHDNGVVYRDLKLE 977

Query: 186  NVLVDAKNNFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPI 245
            N+L+  + + K+AD+G             ++    +      TP++ +PE++   +    
Sbjct: 978  NILLTPEGHIKIADYG---------LCKDEMWYGNKTSTFCGTPEFMAPEIL---KEQEY 1025

Query: 246  NEKSDIWALGVFLYKLLFFTTPFEMTGQ---F-AILHSKYEFPVNKYSSKLINLIIIMLA 301
             +  D WA GV LY++L   +PF    +   F AIL  +  +P++  +  ++ +   +L 
Sbjct: 1026 TKSVDWWAFGVLLYQMLLCQSPFSGDDEDEVFNAILTDEPLYPID-MAGDIVQIFQGLLT 1084

Query: 302  ENPNLR 307
            ++P  R
Sbjct: 1085 KDPERR 1090

>Sklu_1886.2 YDL025C, Contig c1886 2790-4733
          Length = 647

 Score = 54.7 bits (130), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 36/149 (24%), Positives = 69/149 (46%), Gaps = 17/149 (11%)

Query: 123 QGFEVLLLMELCPNKSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDI 182
           +G   L++ME CP     D+    +S  +T+ EI      +   +  +H +   L HRD+
Sbjct: 356 EGENFLVVMEYCP----YDFFTLVMSDLMTKHEIACYFKQICRGVEYLHGM--GLAHRDL 409

Query: 183 KIENVLVDAKNNFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMI--DLY 240
           K++N +V  +   KL DFGS      +V  +     +T+   +  +  Y +PE++    Y
Sbjct: 410 KLDNCVVSPQGLLKLIDFGSA-----VVFQYPYENEITKARGIVGSDPYLAPEVLTQTYY 464

Query: 241 RCLPINEKSDIWALGVFLYKLLFFTTPFE 269
              P+    D+W++ +  Y +     P++
Sbjct: 465 DPRPV----DVWSIAIMFYCMSLRRFPWK 489

>KLLA0B03586g complement(326871..329075) similar to sp|P11792
           Saccharomyces cerevisiae YHR205w SCH9 serine/threonine
           protein kinase involved in stress response and
           nutrient-sensing signaling pathway, start by similarity
          Length = 734

 Score = 54.7 bits (130), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 63/285 (22%), Positives = 121/285 (42%), Gaps = 45/285 (15%)

Query: 31  GTHKVEVVNYLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGDVACLKRVLVQDENGLNE 90
           G    EV+  L +G F Q+Y V+               ++I  +  L + ++  +N +  
Sbjct: 321 GPQDFEVLRLLGKGTFGQVYQVR-----------KKDTMRIYAMKVLSKKVIVKKNEIAH 369

Query: 91  MRNEVEVMKKL--KGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMNQRLS 148
              E  ++ +   K +P IV    S  +         ++ L+ +      L  ++ +   
Sbjct: 370 TIGERNILVRTASKSSPFIVGLKFSFQTPT-------DLYLVTDFMSGGELFWHLQKE-- 420

Query: 149 TKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTSTCFP 208
            + TE      + ++ L++  +H     +++RD+K EN+L+DA  N  L DFG       
Sbjct: 421 GRFTEDRAKFYIAELVLALEYLH--DNDIVYRDLKPENILLDANGNIALCDFG------- 471

Query: 209 IVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGVFLYKLLFFTTPF 268
              +  D+   T N +  TT +Y +PE+  L       +  D W+LGV ++++    +PF
Sbjct: 472 --LSKADLKDRT-NTFCGTT-EYLAPEL--LMDETGYTKMVDFWSLGVLIFEMCCGWSPF 525

Query: 269 ------EMTGQFAILHSKYEFPVNKYSSKLINLIIIMLAENPNLR 307
                 +M  + A    K +FP +  S +  + +  +L  NP  R
Sbjct: 526 FASDNQKMYQKIAF--GKVKFPRDVLSPEGRSFVKGLLNRNPKHR 568

>AFL090W [3103] [Homologous to ScYPL203W (TPK2) - SH]
           complement(274336..275376) [1041 bp, 346 aa]
          Length = 346

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 55/107 (51%), Gaps = 17/107 (15%)

Query: 162 DVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTSTCFPIVTTHQDIALLTQ 221
           +V L++  +H    ++I+RD+K EN+L+D   + K+ DFG       +  T         
Sbjct: 142 EVTLALEYLH--AHNIIYRDLKPENILLDRNGHIKITDFGFAKEVDTVTWT--------- 190

Query: 222 NIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGVFLYKLLFFTTPF 268
              +  TP Y +PE+I      P N+  D W+LG+ ++++L   TPF
Sbjct: 191 ---LCGTPDYIAPEVIT---TKPYNKSIDWWSLGILIFEMLAGYTPF 231

>CAGL0M09361g complement(928484..931918) highly similar to sp|P24583
            Saccharomyces cerevisiae YBL105c PKC1 ser/thr protein
            kinase, start by similarity
          Length = 1144

 Score = 54.7 bits (130), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 44/186 (23%), Positives = 88/186 (47%), Gaps = 24/186 (12%)

Query: 127  VLLLMELCPNKSLLDYM-NQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIE 185
            +   ME      L+ ++ NQRLS +  +    +++    L++   H     +I+RD+K+E
Sbjct: 893  IYFAMEFIGGGDLMWHVQNQRLSVRRAKFYAAEVL----LALKFFH--DNGVIYRDLKLE 946

Query: 186  NVLVDAKNNFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPI 245
            N+L+  + + K+AD+G              +    +      TP++ +PE++   R    
Sbjct: 947  NILLTPEGHIKIADYG---------LCKDGMWYGNKTSTFCGTPEFMAPELL---REQDY 994

Query: 246  NEKSDIWALGVFLYKLLFFTTPFEMTGQ---F-AILHSKYEFPVNKYSSKLINLIIIMLA 301
             +  D WA GV LY++L   +PF    +   F AIL  +  +P++  +  ++ +   +L 
Sbjct: 995  TKAVDWWAFGVLLYQMLLCQSPFSGDDEDEVFNAILTDEPLYPID-MAGDIVQIFQGLLT 1053

Query: 302  ENPNLR 307
            ++P  R
Sbjct: 1054 KDPEKR 1059

>ADL389W [1352] [Homologous to ScYHR205W (SCH9) - SH]
           complement(27643..29778) [2136 bp, 711 aa]
          Length = 711

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 66/285 (23%), Positives = 123/285 (43%), Gaps = 45/285 (15%)

Query: 31  GTHKVEVVNYLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGDVACLKRVLVQDENGLNE 90
           G    EV+  L +G F Q+Y V+      + D      +K+      K+V+V+ +N +  
Sbjct: 300 GPQDFEVLRLLGKGTFGQVYQVR------KKDTKRIYAMKV----LSKKVIVK-KNEIAH 348

Query: 91  MRNEVEVMKKL--KGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMNQRLS 148
              E  ++ +   K  P IV    S  +         ++ L+ +      L  ++ +   
Sbjct: 349 TIGERNILVRTASKSCPFIVGLKFSFQTPT-------DLYLVTDFLSGGELFWHLQKE-- 399

Query: 149 TKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTSTCFP 208
            + TE      + ++ L++  +H     +++RD+K EN+L+DA  N  L DFG +     
Sbjct: 400 GRFTEERAKFYIAELVLALEYLH--DNDIVYRDLKPENILLDANGNIALCDFGLSKA--- 454

Query: 209 IVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGVFLYKLLFFTTPF 268
                 D+   T N +  TT +Y +PE+  L       +  D W+LGV ++++    +PF
Sbjct: 455 ------DLKDRT-NTFCGTT-EYLAPEL--LLDETGYTKMVDFWSLGVLIFEMCCGWSPF 504

Query: 269 ------EMTGQFAILHSKYEFPVNKYSSKLINLIIIMLAENPNLR 307
                 +M  + A    K +FP +  S +  + +  +L  NP  R
Sbjct: 505 FAEDNQKMYQKIAF--GKVKFPRDVLSPEGRSFVKGLLNRNPKHR 547

>YHR205W (SCH9) [2490] chr8 (509361..511835) Serine/threonine
           protein kinase involved in stress response and
           nutrient-sensing signaling pathway that is probably
           parallel to cAMP pathway, affects life span [2475 bp,
           824 aa]
          Length = 824

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 67/291 (23%), Positives = 125/291 (42%), Gaps = 57/291 (19%)

Query: 31  GTHKVEVVNYLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGDVACLKRVLVQDENGLNE 90
           G    EV+  L +G F Q+Y VK      + D      +K+      K+V+V+     NE
Sbjct: 408 GPQDFEVLRLLGKGTFGQVYQVK------KKDTQRIYAMKV----LSKKVIVKK----NE 453

Query: 91  MRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGF--------EVLLLMELCPNKSLLDY 142
           + + +       G  NI+    + AS+    + G         ++ L+ +      L  +
Sbjct: 454 IAHTI-------GERNILV---TTASKSSPFIVGLKFSFQTPTDLYLVTDYMSGGELFWH 503

Query: 143 MNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGS 202
           + +    + +E      + ++ L++  +H     +++RD+K EN+L+DA  N  L DFG 
Sbjct: 504 LQKE--GRFSEDRAKFYIAELVLALEHLH--DNDIVYRDLKPENILLDANGNIALCDFGL 559

Query: 203 TSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGVFLYKLL 262
           +           D+   T N +  TT +Y +PE+  L       +  D W+LGV ++++ 
Sbjct: 560 SKA---------DLKDRT-NTFCGTT-EYLAPEL--LLDETGYTKMVDFWSLGVLIFEMC 606

Query: 263 FFTTPF------EMTGQFAILHSKYEFPVNKYSSKLINLIIIMLAENPNLR 307
              +PF      +M  + A    K +FP +  S +  + +  +L  NP  R
Sbjct: 607 CGWSPFFAENNQKMYQKIAF--GKVKFPRDVLSQEGRSFVKGLLNRNPKHR 655

>KLLA0E15378g 1362851..1365025 some similarities with sp|P08018
           Saccharomyces cerevisiae YJL128c PBS2 tyrosine protein
           kinase of the MAP kinase kinase family, hypothetical
           start
          Length = 724

 Score = 54.3 bits (129), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 64/269 (23%), Positives = 121/269 (44%), Gaps = 40/269 (14%)

Query: 74  VACLKRVLVQ-DENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLME 132
           +  +K V ++ DE+   ++  E+EV+   + +P IV ++ +        ++G  V + ME
Sbjct: 443 IMAMKEVRLELDESKFRQILMELEVLHNCQ-SPYIVDFYGAFF------IEG-AVYMCME 494

Query: 133 LCPNKSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDA- 191
                SL    +      + E ++ +I   V   + ++  +  ++IHRD+K  N+L  A 
Sbjct: 495 YMDGGSLDKTYDDEQIGGIDEPQLARITSSVIQGLKELKDV-HNIIHRDVKPTNILCSAS 553

Query: 192 KNNFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINE---- 247
           +   KL DFG        V+ +   +L   NI   +   Y +PE I   + L  ++    
Sbjct: 554 QGTIKLCDFG--------VSGNLVASLAKTNIGCQS---YMAPERI---KSLNPDKSTYS 599

Query: 248 -KSDIWALGVFLYKLLFFTTPF---EMTGQFAILHSKYE-----FPVNKYSSKLINLIII 298
            +SDIW+LG+ + ++     P+        F+ L +  +      P  K+S+   N + +
Sbjct: 600 VQSDIWSLGLSILEMALGAYPYPPETFDNIFSQLSAIVDGPPPKLPEGKFSADAQNFVSM 659

Query: 299 MLAENPNLRPNIYQVLYH--LCEILNVEV 325
            L + P  RP    +L H  L +  NV+V
Sbjct: 660 CLQKIPERRPTYAALLEHPWLKKYENVDV 688

>Scas_690.13
          Length = 354

 Score = 53.5 bits (127), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 59/256 (23%), Positives = 105/256 (41%), Gaps = 42/256 (16%)

Query: 33  HKVEVVNYLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGDVACLKRVLVQDENGLNEMR 92
           H  +V+  L  G F ++++V+ +     +   A   LK   V  +K++         E  
Sbjct: 42  HDFQVMRTLGTGSFGRVHLVRSVHNGRYY---AIKVLKKQQVVRMKQI---------EHT 89

Query: 93  NEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMNQRLSTKLT 152
           N+   M KL   P +++ + +    R        + ++M+      L   +  R S +  
Sbjct: 90  NDERRMLKLVEHPFLIRMWGTFQDSR-------NLFMVMDYIEGGELFSLL--RKSQRFP 140

Query: 153 EAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTSTCFPIVTT 212
                    +V L +  +H    ++I+RD+K EN+L+D   + K+ DFG       +  T
Sbjct: 141 NPVAKFYAAEVTLGLEYLH--SHNIIYRDLKPENILLDRNGHIKITDFGFAKEVDTVTWT 198

Query: 213 HQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGVFLYKLLFFTTPF---- 268
                       +   P Y +PE+I      P N+  D W+LGV ++++L   TPF    
Sbjct: 199 ------------LCGPPDYIAPEVI---ATKPYNKSVDWWSLGVLIFEMLAGYTPFYDTT 243

Query: 269 EMTGQFAILHSKYEFP 284
            M     IL  K  +P
Sbjct: 244 PMKTYEKILQGKVVYP 259

>YDL025C (YDL025C) [836] chr4 complement(405341..407203)
           Serine/threonine protein kinase with similarity to
           members of the NPR1 subfamily [1863 bp, 620 aa]
          Length = 620

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 38/148 (25%), Positives = 72/148 (48%), Gaps = 15/148 (10%)

Query: 123 QGFEVLLLMELCPNKSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDI 182
           +G   LL+ME  P     D+ N  +S  +T+ E+      +   ++ +H +   L HRD+
Sbjct: 378 EGDTYLLVMEYAP----YDFFNLVMSNLMTQDEVNCYFKQLCHGVNYLHSM--GLAHRDL 431

Query: 183 KIENVLVDAKNNFKLADFGSTSTC-FPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYR 241
           K++N +V      KL DFGS     +P    ++D  + +  I V + P Y +PE++    
Sbjct: 432 KLDNCVVTKDGILKLIDFGSAVVFQYP----YEDTIVKSHGI-VGSDP-YLAPELLKQTS 485

Query: 242 CLPINEKSDIWALGVFLYKLLFFTTPFE 269
             P    +D+W++ +  Y ++    P++
Sbjct: 486 YDP--RVADVWSIAIIFYCMVLKRFPWK 511

>Scas_610.7
          Length = 668

 Score = 53.9 bits (128), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 61/246 (24%), Positives = 97/246 (39%), Gaps = 45/246 (18%)

Query: 41  LAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGDVACLKRVLVQDENGLNEM--RNEVEVM 98
           L +G F ++Y                V L       +K++LV  E  L  +  + E+ ++
Sbjct: 78  LGQGTFGEVY--------------KGVHLATQRQIAMKKILVNVEKDLFPITAQREIVIL 123

Query: 99  KKLKGAPNIVQ-------YFDSNASRRRDGVQGFEVLLLMELCPNKS---LLDYMNQRLS 148
           K+L    NI++       Y   ++S R   V+           P+K    +L YM   LS
Sbjct: 124 KRLNHK-NIIKLIEMVYDYAPDSSSSRAAEVKSLSTAAGPPASPSKHFYMILPYMVADLS 182

Query: 149 -------TKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFG 201
                    L   +I  IM  V   ++ +H      +HRDIK  N+L+D     KLADFG
Sbjct: 183 GILHNPRITLEMPDIKNIMLQVLEGVNYIHCQ--KFMHRDIKAANILIDHNGILKLADFG 240

Query: 202 STSTCF---PIVTTHQDIALLTQNIYVHTTPQYRSPEMI--DLYRCLPINEKSDIWALGV 256
              T +   P +          +   V  T  YR+PE++  D +    +    DIW +G 
Sbjct: 241 LARTYYGSPPNLKYPGGAGSGAKYTSVVVTRWYRAPELVLGDKHYTTAV----DIWGVGC 296

Query: 257 FLYKLL 262
              +L 
Sbjct: 297 VFAELF 302

>Kwal_27.12559
          Length = 414

 Score = 53.5 bits (127), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 46/177 (25%), Positives = 73/177 (41%), Gaps = 24/177 (13%)

Query: 88  LNEMRNEVEVMKKLKGAPNIVQYFDSNASRRR--DGVQGFEVLLLMELCPNKSLLDYMNQ 145
           L     E++ +   KG  NIV   D      +  DG+  ++            L+DY   
Sbjct: 110 LKRAIRELKFLNFFKGHKNIVSLVDLEIVSEKPYDGLYCYQ-----------ELVDYDLA 158

Query: 146 RL---STKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGS 202
           R+   + + +E  I   +Y +   +  +H     +IHRD+K  N+L     N K+ DFG 
Sbjct: 159 RVIHSTVQFSEFHIKHFLYQILCGLKYIH--SADVIHRDLKPGNILCSIGGNLKICDFGL 216

Query: 203 TSTCFP-IVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGVFL 258
                P       D   +T  +    T  YR+PE+I  +R     +  DIWA+G  L
Sbjct: 217 ARGIAPQYFEQKSDEIHITSYV---ATRWYRAPELILSHR--RYTKAIDIWAVGCIL 268

>Scas_715.34
          Length = 1150

 Score = 54.3 bits (129), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 42/186 (22%), Positives = 87/186 (46%), Gaps = 24/186 (12%)

Query: 127  VLLLMELCPNKSLLDYM-NQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIE 185
            +   ME      L+ ++ NQRLS +  +       Y   + ++  ++    +I+RD+K+E
Sbjct: 899  IYFAMEFIGGGDLMWHVQNQRLSVRRAK------FYAAEVLLALKYFHDNGVIYRDLKLE 952

Query: 186  NVLVDAKNNFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPI 245
            N+L+  + + K+AD+G             ++    +      TP++ +PE++   +    
Sbjct: 953  NILLTPQGHIKIADYG---------LCKDEMWYNNKTSTFCGTPEFMAPEIL---KEQGY 1000

Query: 246  NEKSDIWALGVFLYKLLFFTTPFEMTGQ---F-AILHSKYEFPVNKYSSKLINLIIIMLA 301
                D WA GV LY++L   +PF    +   F AIL  +  +P++  +  ++ +   +L 
Sbjct: 1001 TRAVDWWAFGVLLYQMLLCQSPFSGDDEDEVFNAILTDEPLYPID-MAGDIVQIFQGLLT 1059

Query: 302  ENPNLR 307
            ++P  R
Sbjct: 1060 KDPENR 1065

>YGR052W (YGR052W) [2015] chr7 (593598..594707) Serine/threonine
           protein kinase of unknown function [1110 bp, 369 aa]
          Length = 369

 Score = 53.1 bits (126), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 66/274 (24%), Positives = 108/274 (39%), Gaps = 65/274 (23%)

Query: 91  MRNEVEVMKKLKGA---PNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMNQRL 147
           M+NE +VMK L      PNI    D               ++++E C    L D+++   
Sbjct: 43  MKNEYDVMKILSSCNPHPNICSMLDFYTDDSY-------YIMVLEYCECGDLYDFLDIAK 95

Query: 148 ST------KLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFG 201
           S        L + ++ KI+  +  +IS  H L ++  HRDIK EN+L+    + KLAD+G
Sbjct: 96  SQGSPSSPSLIQIDMQKIIKQLCSAISFAHSLGIA--HRDIKPENILLTINGDIKLADWG 153

Query: 202 STSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMID---LYRCLPIN-----------E 247
                         I     N +   T  YR+PE         C   N            
Sbjct: 154 HA------------IQSPKSNDFQIGTDNYRAPETFSGRVSNSCFKKNFDRSSAPLYNTY 201

Query: 248 KSDIWALGVFLYKLLFFTTPFEMTGQFAILHSKY--EFPVNKYSSKLINLIIIMLAENPN 305
           ++D W+LG  ++ L+F    F ++    + H K   EF  + ++      ++  L+   N
Sbjct: 202 QADYWSLGATIFYLMFGDCLFRVSKSKKVQHLKNFDEFEKDPFAFIYRKYVVPRLSCGYN 261

Query: 306 LR------------------PNIYQVLYHLCEIL 321
                               P+IY V +HLC+I+
Sbjct: 262 DEEDLHVSLQHTRQYIWQDLPDIYDV-FHLCKIM 294

>AFR092W [3284] [Homologous to ScYJL095W (BCK1) - SH]
            complement(595092..599363) [4272 bp, 1423 aa]
          Length = 1423

 Score = 53.9 bits (128), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 78/330 (23%), Positives = 131/330 (39%), Gaps = 82/330 (24%)

Query: 41   LAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGDVACLKRVLV-----QDENGLN---EMR 92
            + +G F  +Y+               + +  G++  +K+V V     QDE  +N    + 
Sbjct: 1130 IGKGSFGAVYL--------------GLNVTTGEMMAVKQVEVPKFGSQDETTVNNAEALI 1175

Query: 93   NEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFE-----VLLLMELCPNKSLLDYMNQRL 147
            +EV  +K L    NIVQY             GFE       L +E     S+   +  RL
Sbjct: 1176 SEVSTLKDLDHL-NIVQYL------------GFENKNCIYSLFLEYVAGGSVGSLI--RL 1220

Query: 148  STKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTSTCF 207
                 E  I  +   V   ++ +H     ++HRD+K +N+L+D     K++DFG      
Sbjct: 1221 YGHFDEQLIRFLTTQVLEGLAYLHLR--GILHRDMKADNLLLDNDGVCKISDFG------ 1272

Query: 208  PIVTTHQDIALLTQNIY------VHTTPQYRSPEMIDLYRCLPINEKSDIWALGVFLYKL 261
                    I+  + NIY      +  T  + +PEM+D  +    + K DIW+LG  + ++
Sbjct: 1273 --------ISRKSNNIYSNSEMTMRGTVFWMAPEMVDTTQGY--SAKVDIWSLGCVVLEM 1322

Query: 262  LFFTTPFE----MTGQFAILHSKYEFPVNKYSSKLIN-----LIIIMLAENPNLRPNIYQ 312
                 P+     +   F I  SK   P+ + +   I+      +      +P  RP    
Sbjct: 1323 FAGKRPWSNLEVVAAMFQIGKSKSAPPIPEDTLPHISQDGRAFLDDCFMIDPEERPTADT 1382

Query: 313  VLYH-LCEILNVEVPIEDKYAE-GAYNFSK 340
            +L H  C     +VP E  + +   YNF K
Sbjct: 1383 LLSHPFC-----QVPKEFNFRDTDLYNFIK 1407

>Kwal_47.18307
          Length = 621

 Score = 53.5 bits (127), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 52/189 (27%), Positives = 87/189 (46%), Gaps = 17/189 (8%)

Query: 129 LLMELCPNKSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVL 188
            ++E      LL  + QRL  +LTE     I   +  ++  MH   V  IHRD+K ENVL
Sbjct: 89  FVLEYVSGGELLALI-QRLG-RLTEDLSRHITAQLVDTVDYMHSKGV--IHRDLKPENVL 144

Query: 189 VDAKNNFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEK 248
           +  +    + DFG+  T        +      +      T +Y SPE++   +C      
Sbjct: 145 LSQEGRVVITDFGAACT-----AADRKFENTKRTASFVGTAEYVSPELLLHSQC---GFS 196

Query: 249 SDIWALGVFLYKLLFFTTPF----EMTGQFAILHSKYEFPVNKYSSKLINLIIIMLAENP 304
           SDIWALG  +Y+L     PF    E+     I+   Y++  +  S ++++++  +L  +P
Sbjct: 197 SDIWALGCIIYQLNQGKPPFRGENELQTFEKIVALDYKWLFSN-SPQVVSIVQSILVTDP 255

Query: 305 NLRPNIYQV 313
             RP+  Q+
Sbjct: 256 LKRPSAAQL 264

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.311    0.128    0.357 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 30,978,667
Number of extensions: 1293184
Number of successful extensions: 5030
Number of sequences better than 10.0: 635
Number of HSP's gapped: 4759
Number of HSP's successfully gapped: 660
Length of query: 1089
Length of database: 16,596,109
Length adjustment: 112
Effective length of query: 977
Effective length of database: 12,718,893
Effective search space: 12426358461
Effective search space used: 12426358461
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 67 (30.4 bits)