Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YBR058C-A (TSC3)80804173e-55
Scas_718.48*88822533e-30
KLLA0F18634g84781989e-22
AGR026C107751963e-21
Kwal_27.1094984771718e-18
YGL065C (ALG2)50358620.55
Scas_697.3672419554.2
CAGL0K11792g88433545.5
YGR197C (SNG1)54769546.3
ACR037C55628539.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YBR058C-A
         (80 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YBR058C-A (TSC3) [249] chr2 complement(356284..356526) Protein a...   165   3e-55
Scas_718.48*                                                          102   3e-30
KLLA0F18634g 1713947..1714201 weakly similar to sgd|S0007521 Sac...    81   9e-22
AGR026C [4336] [Homologous to ScYBR058C-A (TSC3) - SH] (762745.....    80   3e-21
Kwal_27.10949                                                          70   8e-18
YGL065C (ALG2) [1914] chr7 complement(379761..381272) Mannosyltr...    28   0.55 
Scas_697.36                                                            26   4.2  
CAGL0K11792g complement(1134215..1136869) similar to tr|Q12071 S...    25   5.5  
YGR197C (SNG1) [2147] chr7 complement(892500..894143) Probable t...    25   6.3  
ACR037C [1085] [Homologous to ScYHR050W (SMF2) - SH] (425612..42...    25   9.6  

>YBR058C-A (TSC3) [249] chr2 complement(356284..356526) Protein
          associated with serine palmitoyltransferase and
          required for optimal enzyme activity [243 bp, 80 aa]
          Length = 80

 Score =  165 bits (417), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 80/80 (100%), Positives = 80/80 (100%)

Query: 1  MTQHKSSMVYIPTTKEAKRRNGKSEGILNTIEEVVEKLYWTYYIHLPFYLMASFDSFFLH 60
          MTQHKSSMVYIPTTKEAKRRNGKSEGILNTIEEVVEKLYWTYYIHLPFYLMASFDSFFLH
Sbjct: 1  MTQHKSSMVYIPTTKEAKRRNGKSEGILNTIEEVVEKLYWTYYIHLPFYLMASFDSFFLH 60

Query: 61 VFFLTIFSLSFFGILKYCFL 80
          VFFLTIFSLSFFGILKYCFL
Sbjct: 61 VFFLTIFSLSFFGILKYCFL 80

>Scas_718.48*
          Length = 88

 Score =  102 bits (253), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 49/82 (59%), Positives = 61/82 (74%), Gaps = 3/82 (3%)

Query: 2  TQHKSSMVYIPTTKE--AKRRNGKSEG-ILNTIEEVVEKLYWTYYIHLPFYLMASFDSFF 58
          T  + +M+++PT KE   KRR     G I+  +EE+VEKLYW YYIHLP+YLM SFDSF 
Sbjct: 7  TASQCTMIFVPTNKELKEKRRAANGRGSIMEKVEEIVEKLYWMYYIHLPYYLMTSFDSFC 66

Query: 59 LHVFFLTIFSLSFFGILKYCFL 80
          LH+FFLTIFSLS F ++KY FL
Sbjct: 67 LHLFFLTIFSLSVFAVIKYIFL 88

>KLLA0F18634g 1713947..1714201 weakly similar to sgd|S0007521
          Saccharomyces cerevisiae YBR058ca required for optimal
          serine palmitoyltransferase activity, start by
          similarity
          Length = 84

 Score = 80.9 bits (198), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 38/78 (48%), Positives = 50/78 (64%), Gaps = 5/78 (6%)

Query: 3  QHKSSMVYIPTTKEAKRRNGKSEGILNTIEEVVEKLYWTYYIHLPFYLMASFDSFFLHVF 62
          + + +M+Y PT ++  R      GI   + + V+ LYW YYIHLPFYLM S D+F LH  
Sbjct: 12 KSRGTMIYTPTNQQMSR-----GGIGEKLADFVKNLYWVYYIHLPFYLMTSLDAFCLHTI 66

Query: 63 FLTIFSLSFFGILKYCFL 80
          FL + SLS FG+LKY FL
Sbjct: 67 FLVVVSLSLFGLLKYIFL 84

>AGR026C [4336] [Homologous to ScYBR058C-A (TSC3) - SH]
          (762745..763068) [324 bp, 107 aa]
          Length = 107

 Score = 80.1 bits (196), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 53/75 (70%), Gaps = 5/75 (6%)

Query: 3  QHKSSMVYIPTTKEAKRRNGKSEGILNTIEEVVEKLYWTYYIHLPFYLMASFDSFFLHVF 62
          + + +MVY PT  +A++  GK   +   + +  E LYW YYIHLP+YLM SFDSF LHVF
Sbjct: 19 KDRGTMVYTPT--DAQQATGK---VHEKVYKFFESLYWMYYIHLPYYLMTSFDSFCLHVF 73

Query: 63 FLTIFSLSFFGILKY 77
          FL +F+LS FG+LK+
Sbjct: 74 FLVVFTLSLFGLLKW 88

>Kwal_27.10949
          Length = 84

 Score = 70.5 bits (171), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 47/77 (61%), Gaps = 5/77 (6%)

Query: 4  HKSSMVYIPTTKEAKRRNGKSEGILNTIEEVVEKLYWTYYIHLPFYLMASFDSFFLHVFF 63
          +  +M+Y PT +E    NG     L  +    E LYW YYIHLP+YLM + D+F LH FF
Sbjct: 13 NNGTMIYRPTDEELS--NGS---FLEKVSNFGENLYWMYYIHLPYYLMTTGDAFCLHTFF 67

Query: 64 LTIFSLSFFGILKYCFL 80
          L + +L  FG++KY FL
Sbjct: 68 LAMLTLGLFGLVKYIFL 84

>YGL065C (ALG2) [1914] chr7 complement(379761..381272)
           Mannosyltransferase involved in N-glycosylation,
           converts Man[2]GlcNAc-PP-Dolichol to
           Man[3]GlcNAc-PP-Dolichol [1512 bp, 503 aa]
          Length = 503

 Score = 28.5 bits (62), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 27/58 (46%), Gaps = 9/58 (15%)

Query: 19  RRNG--------KSEGILNTIEEVVEKLYWTYYIHLPFYLMA-SFDSFFLHVFFLTIF 67
            RNG          E +  + EE VEK+ W    + P+ +   SF +F LH+ F+ I 
Sbjct: 406 ERNGPLRVKKYFSREAMTQSFEENVEKVIWKEKKYYPWEIFGISFSNFILHMAFIKIL 463

>Scas_697.36
          Length = 724

 Score = 25.8 bits (55), Expect = 4.2,   Method: Composition-based stats.
 Identities = 11/19 (57%), Positives = 12/19 (63%)

Query: 4   HKSSMVYIPTTKEAKRRNG 22
           H    V IPTTK+A  RNG
Sbjct: 668 HHKKNVVIPTTKKASLRNG 686

>CAGL0K11792g complement(1134215..1136869) similar to tr|Q12071
           Saccharomyces cerevisiae YDR027c LUV1 interacts with the
           beta-tubulin binding protein RBL2P, hypothetical start
          Length = 884

 Score = 25.4 bits (54), Expect = 5.5,   Method: Composition-based stats.
 Identities = 12/33 (36%), Positives = 20/33 (60%)

Query: 7   SMVYIPTTKEAKRRNGKSEGILNTIEEVVEKLY 39
           ++ YI TT + K +   SE + N+I + + KLY
Sbjct: 449 TIEYIRTTNKEKEQYNFSEDLRNSIVDYIRKLY 481

>YGR197C (SNG1) [2147] chr7 complement(892500..894143) Probable
           transport protein, confers resistance to MNNG and
           nitrosoguanidine [1644 bp, 547 aa]
          Length = 547

 Score = 25.4 bits (54), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 18/69 (26%), Positives = 29/69 (42%), Gaps = 3/69 (4%)

Query: 10  YIPTTKEAKRRNGKSEGILNTIEEVVEKLYWTYYIHLPFY---LMASFDSFFLHVFFLTI 66
           Y+P+       N +   I      +  +L +TY  + PF    LMA      ++   LT+
Sbjct: 276 YLPSLMSNITSNDRDLNINMENWAIAGQLLFTYNDYRPFADRILMAPLQVGLIYCILLTV 335

Query: 67  FSLSFFGIL 75
             LS +G L
Sbjct: 336 LQLSLYGKL 344

>ACR037C [1085] [Homologous to ScYHR050W (SMF2) - SH]
           (425612..427282) [1671 bp, 556 aa]
          Length = 556

 Score = 25.0 bits (53), Expect = 9.6,   Method: Composition-based stats.
 Identities = 11/28 (39%), Positives = 16/28 (57%)

Query: 29  NTIEEVVEKLYWTYYIHLPFYLMASFDS 56
           +T+  V+  L W +   L FYL+ SF S
Sbjct: 523 STLTNVLAWLLWVFVSALNFYLLISFTS 550

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.331    0.143    0.443 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 2,496,226
Number of extensions: 86201
Number of successful extensions: 357
Number of sequences better than 10.0: 18
Number of HSP's gapped: 356
Number of HSP's successfully gapped: 18
Length of query: 80
Length of database: 16,596,109
Length adjustment: 52
Effective length of query: 28
Effective length of database: 14,795,973
Effective search space: 414287244
Effective search space used: 414287244
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)
S2: 54 (25.4 bits)