Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YBR058C (UBP14)78176738100.0
CAGL0H10186g77877920790.0
Scas_718.49*82979218840.0
AGR023C78077518320.0
Kwal_56.2308476275918190.0
KLLA0F18700g77076917170.0
Sklu_1729.11361101671e-13
Scas_545.2*9183131267e-07
AGL079C5061171231e-06
Kwal_26.8090520681193e-06
Kwal_14.20084242641176e-06
YHL010C585391132e-05
CAGL0K02563g586701114e-05
CAGL0I05522g7241941097e-05
KLLA0E10252g7962831097e-05
KLLA0F25740g517701071e-04
Kwal_33.1362811601291071e-04
CAGL0G05247g9472571043e-04
AFR627C12871111043e-04
Scas_11.1*8841934e-04
Scas_609.9729461034e-04
KLLA0C06974g4462431024e-04
Scas_634.1412011011017e-04
AFR007W848304990.001
KLLA0A10791g48453970.001
Kwal_34.1626844950970.002
YJL197W (UBP12)1254104980.002
CAGL0K10494g49548960.002
YER098W (UBP9)754126960.003
YFR010W (UBP6)49950950.003
Scas_618.549357940.003
AEL029W44643940.004
YDR069C (DOA4)926257940.004
Kwal_26.9151454142920.007
KLLA0C03476g1252128880.023
YBL067C (UBP13)68895870.027
CAGL0A04477g77048870.031
Scas_671.377057870.031
KLLA0A00396g1012119850.056
YIL156W (UBP7)1071100850.060
YMR223W (UBP8)471383840.064
Scas_655.487539830.090
Scas_715.271741830.093
AGR370W74055820.12
YER144C (UBP5)805255810.16
Kwal_27.1144475723800.19
CAGL0L01639g1147104800.20
Sklu_2079.379131800.22
CAGL0J11352g77139790.24
KLLA0D08459g75039780.30
ABL145W74939780.33
Scas_692.39466174780.34
Kwal_33.1443051146770.36
YNL186W (UBP10)79239780.36
Sklu_1544.2454161760.46
CAGL0K10252g126742760.61
CAGL0H05335g48321750.64
AGR389C77520760.66
CAGL0H10582g79031750.74
YDL122W (UBP1)80930750.77
Kwal_55.2126760439750.82
Scas_695.748220740.83
Kwal_55.21393123322741.1
Sklu_2425.8754152731.2
CAGL0I06765g88792731.4
KLLA0E01848g60970721.5
Scas_555.691752731.5
CAGL0G02563g63137721.7
Scas_698.7103044721.8
KLLA0E08767g77141712.1
KLLA0E00979g774100712.5
AGR139C78931702.7
KLLA0E08679g59668702.7
Kwal_55.1964597037702.9
Scas_721.100113728703.6
Sklu_2418.6129740694.1
CAGL0H06721g108119694.4
Scas_714.11126921694.4
KLLA0E20449g69793684.6
YOR124C (UBP2)127221685.1
Scas_664.1749422675.7
ACL164C138922685.9
Kwal_27.12129233389686.4
CAGL0F04609g131140678.1
Scas_623.2*795105668.4
Sklu_1489.1108468668.5
CAGL0M11198g46120669.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YBR058C
         (767 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YBR058C (UBP14) [248] chr2 complement(353632..355977) Ubiquitin-...  1472   0.0  
CAGL0H10186g complement(993354..995690) similar to sp|P38237 Sac...   805   0.0  
Scas_718.49*                                                          730   0.0  
AGR023C [4333] [Homologous to ScYBR058C (UBP14) - SH] (756967..7...   710   0.0  
Kwal_56.23084                                                         705   0.0  
KLLA0F18700g 1718738..1721050 similar to sp|P38237 Saccharomyces...   665   0.0  
Sklu_1729.1 YBR058C, Contig c1729 2315-2720 reverse complement         69   1e-13
Scas_545.2*                                                            53   7e-07
AGL079C [4232] [Homologous to ScYHL010C - SH] (557422..558942) [...    52   1e-06
Kwal_26.8090                                                           50   3e-06
Kwal_14.2008                                                           50   6e-06
YHL010C (YHL010C) [2276] chr8 complement(81959..83716) Protein t...    48   2e-05
CAGL0K02563g complement(230983..232743) similar to sp|P38748 Sac...    47   4e-05
CAGL0I05522g complement(521749..523923) some similarities with s...    47   7e-05
KLLA0E10252g 906675..909065 gi|10444512|gb|AAG17929.1|AF303215_1...    47   7e-05
KLLA0F25740g complement(2389226..2390779) similar to sp|P38748 S...    46   1e-04
Kwal_33.13628                                                          46   1e-04
CAGL0G05247g complement(491024..493867) similar to sp|P32571 Sac...    45   3e-04
AFR627C [3819] [Homologous to ScYJL197W (UBP12) - SH] (1572372.....    45   3e-04
Scas_11.1*                                                             40   4e-04
Scas_609.9                                                             44   4e-04
KLLA0C06974g complement(604344..605684) similar to sp|P50102 Sac...    44   4e-04
Scas_634.14                                                            44   7e-04
AFR007W [3199] [Homologous to ScYDR069C (DOA4) - SH; ScYER144C (...    43   0.001
KLLA0A10791g join(complement(935718..935733),complement(934135.....    42   0.001
Kwal_34.16268                                                          42   0.002
YJL197W (UBP12) [2729] chr10 (63804..67568) Ubiquitin-specific p...    42   0.002
CAGL0K10494g 1022869..1024356 highly similar to sp|P43593 Saccha...    42   0.002
YER098W (UBP9) [1530] chr5 (355462..357726) Ubiquitin C-terminal...    42   0.003
YFR010W (UBP6) [1690] chr6 (165060..166559) Ubiquitin C-terminal...    41   0.003
Scas_618.5                                                             41   0.003
AEL029W [2477] [Homologous to ScYFR010W (UBP6) - SH] complement(...    41   0.004
YDR069C (DOA4) [920] chr4 complement(584935..587715) Ubiquitin-s...    41   0.004
Kwal_26.9151                                                           40   0.007
KLLA0C03476g 314815..318573 weakly similar to sp|P39538 Saccharo...    39   0.023
YBL067C (UBP13) [130] chr2 complement(93817..95883) Ubiquitin C-...    38   0.027
CAGL0A04477g 437397..439709 similar to sp|P38187 Saccharomyces c...    38   0.031
Scas_671.3                                                             38   0.031
KLLA0A00396g 29717..32755 similar to sp|P40453 Saccharomyces cer...    37   0.056
YIL156W (UBP7) [2521] chr9 (48091..51306) Putative ubiquitin-spe...    37   0.060
YMR223W (UBP8) [4179] chr13 (716714..718129) Putative ubiquitin-...    37   0.064
Scas_655.4                                                             37   0.090
Scas_715.2                                                             37   0.093
AGR370W [4681] [Homologous to ScYER098W (UBP9) - SH; ScYBL067C (...    36   0.12 
YER144C (UBP5) [1573] chr5 complement(457801..460218) Ubiquitin-...    36   0.16 
Kwal_27.11444                                                          35   0.19 
CAGL0L01639g 176107..179550 similar to sp|P39538 Saccharomyces c...    35   0.20 
Sklu_2079.3 YDL122W, Contig c2079 1528-3903 reverse complement         35   0.22 
CAGL0J11352g complement(1101349..1103664) similar to sp|P53874 S...    35   0.24 
KLLA0D08459g complement(718046..720298) some similarities with s...    35   0.30 
ABL145W [447] [Homologous to ScYNL186W (UBP10) - SH] complement(...    35   0.33 
Scas_692.39                                                            35   0.34 
Kwal_33.14430                                                          34   0.36 
YNL186W (UBP10) [4415] chr14 (289498..291876) Ubiquitin C-termin...    35   0.36 
Sklu_1544.2 YMR223W, Contig c1544 592-1956 reverse complement          34   0.46 
CAGL0K10252g complement(997315..1001118) similar to sp|Q01476 Sa...    34   0.61 
CAGL0H05335g complement(512683..514134) weakly similar to sp|Q02...    33   0.64 
AGR389C [4700] [Homologous to ScYDL122W (UBP1) - SH] (1443891..1...    34   0.66 
CAGL0H10582g complement(1029876..1032248) similar to sp|P25037 S...    33   0.74 
YDL122W (UBP1) [748] chr4 (242552..244981) Ubiquitin-specific pr...    33   0.77 
Kwal_55.21267                                                          33   0.82 
Scas_695.7                                                             33   0.83 
Kwal_55.21393                                                          33   1.1  
Sklu_2425.8 YER098W, Contig c2425 12113-14377 reverse complement       33   1.2  
CAGL0I06765g 655806..658469 similar to sp|P32571 Saccharomyces c...    33   1.4  
KLLA0E01848g complement(175162..176991) some similarities with s...    32   1.5  
Scas_555.6                                                             33   1.5  
CAGL0G02563g complement(235498..237393) weakly similar to sp|P36...    32   1.7  
Scas_698.7                                                             32   1.8  
KLLA0E08767g 784991..787306 similar to sp|P25037 Saccharomyces c...    32   2.1  
KLLA0E00979g 104991..107315 some similarities with sp|Q01477 Sac...    32   2.5  
AGR139C [4450] [Homologous to ScYER151C (UBP3) - SH] (1010466..1...    32   2.7  
KLLA0E08679g 777005..778795 some similarities with sp|P53968 Sac...    32   2.7  
Kwal_55.19645                                                          32   2.9  
Scas_721.100                                                           32   3.6  
Sklu_2418.6 YBL047C, Contig c2418 10006-13899 reverse complement       31   4.1  
CAGL0H06721g complement(667816..671061) similar to sp|P40453 Sac...    31   4.4  
Scas_714.11                                                            31   4.4  
KLLA0E20449g 1810593..1812686 weakly similar to sp|P39967 Saccha...    31   4.6  
YOR124C (UBP2) [4926] chr15 complement(554824..558642) Ubiquitin...    31   5.1  
Scas_664.17                                                            30   5.7  
ACL164C [885] [Homologous to ScYOR124C (UBP2) - SH] (67792..7196...    31   5.9  
Kwal_27.12129                                                          31   6.4  
CAGL0F04609g 463702..467637 similar to sp|P34216 Saccharomyces c...    30   8.1  
Scas_623.2*                                                            30   8.4  
Sklu_1489.1 YGR218W, Contig c1489 219-3473 reverse complement          30   8.5  
CAGL0M11198g 1101217..1102602 similar to sp|P50102 Saccharomyces...    30   9.2  

>YBR058C (UBP14) [248] chr2 complement(353632..355977)
           Ubiquitin-specific protease, ubiquitin C-terminal
           hydrolase [2346 bp, 781 aa]
          Length = 781

 Score = 1472 bits (3810), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 718/767 (93%), Positives = 718/767 (93%)

Query: 1   MAEAVLENVNVPAVVSKDECIYCFESPYNEPLALNASPKHSLNICLNCFQATCNRHVPLH 60
           MAEAVLENVNVPAVVSKDECIYCFESPYNEPLALNASPKHSLNICLNCFQATCNRHVPLH
Sbjct: 1   MAEAVLENVNVPAVVSKDECIYCFESPYNEPLALNASPKHSLNICLNCFQATCNRHVPLH 60

Query: 61  IRVTEYACDTIHSNYLTIAXXXXXXXXXXXXXXXXXXIKLQVIETSEDDTHNTIWSLQRF 120
           IRVTEYACDTIHSNYLTIA                  IKLQVIETSEDDTHNTIWSLQRF
Sbjct: 61  IRVTEYACDTIHSNYLTIAKVEKPKQENVEENNNNKKIKLQVIETSEDDTHNTIWSLQRF 120

Query: 121 NGENVPRTVLSKSTDSDISSTALEKIEKILKAKSQDFEDKKNSWVLEISTCPHTENFQIP 180
           NGENVPRTVLSKSTDSDISSTALEKIEKILKAKSQDFEDKKNSWVLEISTCPHTENFQIP
Sbjct: 121 NGENVPRTVLSKSTDSDISSTALEKIEKILKAKSQDFEDKKNSWVLEISTCPHTENFQIP 180

Query: 181 SKPENTVNLNQCSSCDLTQNLWLCLHCGNIGCGREQIGIDGHSHALDHYRSNNNHPLAIK 240
           SKPENTVNLNQCSSCDLTQNLWLCLHCGNIGCGREQIGIDGHSHALDHYRSNNNHPLAIK
Sbjct: 181 SKPENTVNLNQCSSCDLTQNLWLCLHCGNIGCGREQIGIDGHSHALDHYRSNNNHPLAIK 240

Query: 241 LGSLSSSTYDLYCYACDDETRFPDNVNLGSALQIYGINIQEKIADEKTLVQLQVEQNENW 300
           LGSLSSSTYDLYCYACDDETRFPDNVNLGSALQIYGINIQEKIADEKTLVQLQVEQNENW
Sbjct: 241 LGSLSSSTYDLYCYACDDETRFPDNVNLGSALQIYGINIQEKIADEKTLVQLQVEQNENW 300

Query: 301 QFRMVDSSGKEFEKLSASKNYGCGLINLGNSCYLNSVIQSLVNGGVPNWSLDFLGSKFPL 360
           QFRMVDSSGKEFEKLSASKNYGCGLINLGNSCYLNSVIQSLVNGGVPNWSLDFLGSKFPL
Sbjct: 301 QFRMVDSSGKEFEKLSASKNYGCGLINLGNSCYLNSVIQSLVNGGVPNWSLDFLGSKFPL 360

Query: 361 DVVYPDNNLKCQWIKLLNAMKCEPELYPNGIKPTTFKKCIGQNHQEFSSNRQQDAMEXXX 420
           DVVYPDNNLKCQWIKLLNAMKCEPELYPNGIKPTTFKKCIGQNHQEFSSNRQQDAME   
Sbjct: 361 DVVYPDNNLKCQWIKLLNAMKCEPELYPNGIKPTTFKKCIGQNHQEFSSNRQQDAMEFLT 420

Query: 421 XXXXXXXXXXXXXXXXGIPNPNDLVRFMMEDRLQCNICGKVKYSYEPTEAIQIPLEENDE 480
                           GIPNPNDLVRFMMEDRLQCNICGKVKYSYEPTEAIQIPLEENDE
Sbjct: 421 FLLDLLDKKFFSSSSSGIPNPNDLVRFMMEDRLQCNICGKVKYSYEPTEAIQIPLEENDE 480

Query: 481 PQDMLERIKAYFEGQTIEFKCANCKEKVTANKKPGFKSLPQTLILNPIRIRLQNWIPVKT 540
           PQDMLERIKAYFEGQTIEFKCANCKEKVTANKKPGFKSLPQTLILNPIRIRLQNWIPVKT
Sbjct: 481 PQDMLERIKAYFEGQTIEFKCANCKEKVTANKKPGFKSLPQTLILNPIRIRLQNWIPVKT 540

Query: 541 SNELSLPGLIDRDDMLDVSSYLSQGFDPQTENLLPDEDENRSSFTPNQCSISQLIEMGFT 600
           SNELSLPGLIDRDDMLDVSSYLSQGFDPQTENLLPDEDENRSSFTPNQCSISQLIEMGFT
Sbjct: 541 SNELSLPGLIDRDDMLDVSSYLSQGFDPQTENLLPDEDENRSSFTPNQCSISQLIEMGFT 600

Query: 601 QNASVRALFNTGNQDAESAMNWLFQHMDDPDLNDPFVPPPNVPKKDKREVDEVSLTSMLS 660
           QNASVRALFNTGNQDAESAMNWLFQHMDDPDLNDPFVPPPNVPKKDKREVDEVSLTSMLS
Sbjct: 601 QNASVRALFNTGNQDAESAMNWLFQHMDDPDLNDPFVPPPNVPKKDKREVDEVSLTSMLS 660

Query: 661 MGLNPNLCRKALILNNGDVNRSVEWVFNNMDDDGTFXXXXXXXXXXXXKKDLGYSTAKPY 720
           MGLNPNLCRKALILNNGDVNRSVEWVFNNMDDDGTF            KKDLGYSTAKPY
Sbjct: 661 MGLNPNLCRKALILNNGDVNRSVEWVFNNMDDDGTFPEPEVPNEEQQQKKDLGYSTAKPY 720

Query: 721 ALTAVICHKGNSVHSGHYVVFIRKLVADKWKWVLYNDEKLVAADSIE 767
           ALTAVICHKGNSVHSGHYVVFIRKLVADKWKWVLYNDEKLVAADSIE
Sbjct: 721 ALTAVICHKGNSVHSGHYVVFIRKLVADKWKWVLYNDEKLVAADSIE 767

>CAGL0H10186g complement(993354..995690) similar to sp|P38237
           Saccharomyces cerevisiae YBR058c UBP14 ubiquitin
           specific protease, hypothetical start
          Length = 778

 Score =  805 bits (2079), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/779 (51%), Positives = 523/779 (67%), Gaps = 27/779 (3%)

Query: 1   MAEAVLENVNVPAVVSKDECIYCFESPYN--------EPLALNASPKHSLNICLNCFQAT 52
           M++ +L+ + VPA+++K+ECIYCFE+PYN        + L  +    H+LNICL CFQA 
Sbjct: 1   MSDQILQGLEVPAIIAKEECIYCFETPYNPEKPGSKEQQLTDSTKAAHTLNICLVCFQAV 60

Query: 53  CNRHVPLHIRVTEYACDTIHSNYLTIAXXXXXXXX----XXXXXXXXXXIKLQVIETSED 108
           C RH P HI V ++  D  H +YL +A                      IKLQVIE S D
Sbjct: 61  CPRHTPFHIEVGKHN-DAQHFDYLNVAKVRKYEDMLDGEEDEDTNSSKKIKLQVIEKSRD 119

Query: 109 DTHNTIWSLQRFNGENVPRTVLSKSTDSDISSTALEKIEKILKAKSQDFEDKKNSWVLEI 168
           + +N +WSL  F        ++ KS +++ + T  EK++ +L AKSQD  D+ N W L+I
Sbjct: 120 EDYNDVWSLLHFESSQSSPHIVLKSNEANAAQT--EKVDHVLNAKSQDLADQANVWELDI 177

Query: 169 STCPHTENFQIPSKPENTVNLNQCSSCDLTQNLWLCLHCGNIGCGREQIGIDGHSHALDH 228
             C H ++F   +  E  +    CSSC+LTQNLW+CL+CGN+GCGREQ+GI+GHSHAL+H
Sbjct: 178 KPCKHVDSFSFANVQEKPLE-THCSSCELTQNLWICLYCGNLGCGREQVGIEGHSHALEH 236

Query: 229 YRSNNNHPLAIKLGSLSSSTYDLYCYACDDETRFPDNVNLGSALQIYGINIQEKIADEKT 288
           ++S N+H LAIKLGSLSSS++DLYCYACDDE +F D   L + L  YGI++ +K ADEKT
Sbjct: 237 FKSKNDHCLAIKLGSLSSSSFDLYCYACDDEVKFNDLQVLKTTLAKYGIDMDKKSADEKT 296

Query: 289 LVQLQVEQNENWQFRMVDSSGKEFEKLSASKNYGCGLINLGNSCYLNSVIQSLVNGGVPN 348
           LV+LQVEQN NW F+MVD  G++ ++L+AS+  GCGLINLGNSCYLNS +Q L NGGV  
Sbjct: 297 LVELQVEQNMNWDFKMVDEKGQQLKQLNASQELGCGLINLGNSCYLNSTLQCLFNGGVKG 356

Query: 349 WSLDFLGSKFPLDVVYPDNNLKCQWIKLLNAMKCEPELYPNGIKPTTFKKCIGQNHQEFS 408
           W  D LG+   L+VVYP NNLK Q  KL  A+K EP +Y  GI+P +FKKCIG +H+EFS
Sbjct: 357 WDTDMLGNSPSLNVVYPANNLKSQLTKLRTALKEEPTIYKQGIRPKSFKKCIGGSHEEFS 416

Query: 409 SNRQQDAMEXXXXXXXXXXXXXXXXXXXGIPNPNDLVRFMMEDRLQCNICGKVKYSYEPT 468
           S RQQDA+E                      NPNDL++FMMEDRLQC  C  VKYS E +
Sbjct: 417 SGRQQDALEFFTYFVDELDKKLFKNSDY---NPNDLMKFMMEDRLQCQECHGVKYSTETS 473

Query: 469 EAIQIPLEENDEPQDMLERIKAYFEGQTIEFKCANCKEKVTANKKPGFKSLPQTLILNPI 528
             IQ+PL+E+++ QD+ ERI AYF G+ IEFKC NCK+ V A KKP  ++ P TL++NPI
Sbjct: 474 NVIQLPLQESNDAQDLEERINAYFSGEVIEFKCPNCKKMVNAVKKPAMRTFPDTLVINPI 533

Query: 529 RIRLQNWIPVKTSNELSLPGLIDRDDMLDVSSYLSQGFDPQTENLLPDEDENRSSFTPNQ 588
           RI+++NW PVKTSN L++PGL    ++L+++ Y   G    TE  L D D +   F  N+
Sbjct: 534 RIKIENWTPVKTSNLLTIPGLETPTEVLELTQYKGNGLQKDTETQLND-DNDEIQFEVNE 592

Query: 589 CSISQLIEMGFTQNASVRALFNTGNQDAESAMNWLFQHMDDPDLNDPFVPPPNVPKKDKR 648
             ++QL+EMGFT+NA VRAL++TGN+D E AMNWLF H++D D+N  F+P    PKK K 
Sbjct: 593 TFVNQLMEMGFTENACVRALYHTGNKDPELAMNWLFGHIEDADVNAEFIP----PKKAKN 648

Query: 649 EVDEVSLTSMLSMGLNPNLCRKALILNNGDVNRSVEWVFNNMDDDGTFXXXXXXXXXXXX 708
           +V+   ++ M+ MGL+P LCRKALILNN DV RSV+WVFNNMDDDG              
Sbjct: 649 DVNPEHISMMVGMGLDPKLCRKALILNNHDVTRSVDWVFNNMDDDGEIEELKEQSDTS-- 706

Query: 709 KKDLGYSTAKPYALTAVICHKGNSVHSGHYVVFIRKLVADKWKWVLYNDEKLVAADSIE 767
            K  G+  AKPY L+A+ICHKGNSVHSGHYV FIRK+V  K  WVLYNDEK+V +++ E
Sbjct: 707 -KTYGHHDAKPYELSAIICHKGNSVHSGHYVAFIRKMVDGKPTWVLYNDEKIVVSNNFE 764

>Scas_718.49*
          Length = 829

 Score =  730 bits (1884), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/792 (47%), Positives = 513/792 (64%), Gaps = 36/792 (4%)

Query: 1   MAEAVLENVNVPAVVSKDECIYCFESPYNEPLALNASPKHSLNICLNCFQATCNRHVPLH 60
           M E V  N+ VP  ++KD+CIYCFES YN  +    +  HSL+IC++CFQATC  H  LH
Sbjct: 35  MEEQVFTNLAVPTSIAKDQCIYCFESLYNN-ITATFNTTHSLDICISCFQATCPNHSLLH 93

Query: 61  IRVTEYACDTIHSNYLTIAX-----XXXXXXXXXXXXXXXXXIKLQVIETSEDDTHNTIW 115
            +VT+++ D+ H +YL ++                       IKLQ+   SED+ + T W
Sbjct: 94  YKVTQHSSDSPHGHYLNLSKWERPASSPSSASMNNDESNNKKIKLQIDTKSEDELYETKW 153

Query: 116 SLQRFNGE-NVPRTVLSKSTDSD-ISSTALEKIEKILKAKSQDFEDKKNSWVLEISTCPH 173
           S Q+ + + ++   +   +T+++ +SS  L KI  I++AKS+   ++  SW LE+++C H
Sbjct: 154 SFQKISTDGSLLEPLFDNNTNTETLSSNTLNKINDIIRAKSKTLVEETQSWELELNSCSH 213

Query: 174 TENFQI--PSKPENTVNLNQCSSCDLTQNLWLCLHCGNIGCGREQIGIDGHSHALDHYRS 231
           T + Q    S       L+ C  CDL  NLWLCLHCGN+GCGR Q+GIDG+SHAL H+ +
Sbjct: 214 TRSLQSGESSISPTPAALDHCHDCDLDSNLWLCLHCGNVGCGRNQVGIDGNSHALAHFDT 273

Query: 232 NNNHPLAIKLGSLSSSTYDLYCYACDDETRFPDNVNLGSALQI--YGINIQEKIADEKTL 289
           + +HPLAIKLGSLS  + D+YCY C+DE RF  + +  +   +  Y I++  K+  EK+L
Sbjct: 274 HKDHPLAIKLGSLSPESSDVYCYQCNDEVRFDGDKDFLAKFLLTNYQIDVSSKMGTEKSL 333

Query: 290 VQLQVEQNENWQFRMVDSSGKEFEKLSASKNYGCGLINLGNSCYLNSVIQSLVNGGVPNW 349
           ++LQVEQN NW F+MVDS G E  +L  SK  GCG INLGNSCYLNSV+Q L N GVPNW
Sbjct: 334 IELQVEQNMNWNFKMVDSHGNELIQLPPSKELGCGFINLGNSCYLNSVLQCLFNDGVPNW 393

Query: 350 SL---DFLGSKFPLDVVYPDNNLKCQWIKLLNAMKCEPELYPNGIKPTTFKKCIGQNHQE 406
           +    + +G++FPLD VYP  NLKCQ IK+LNA K  PE YP GIKP +FK  +GQ+++E
Sbjct: 394 ATLLANLIGNEFPLDCVYPTTNLKCQLIKILNAFKLNPENYPEGIKPQSFKNYVGQSNKE 453

Query: 407 FSSNRQQDAMEXXXXXXXXXXXXXXXXXXXGIPNPNDLVRFMMEDRLQCNICGKVKYSYE 466
           F SN QQDA E                      NPN++++F+MED++QC  CG VKYSYE
Sbjct: 454 FKSNNQQDATEFLTFLLEQLEKTLFKKDN----NPNNIMKFIMEDKIQCQSCGNVKYSYE 509

Query: 467 PTEAIQIPLEENDEPQDMLERIKAYFEGQTIEFKCANCKEKVTANKKPGFKSLPQTLILN 526
           PTE IQ+PL+  + PQ+++E +  +F G+ I+F C  CK+ V A K+  FK+ P TL+++
Sbjct: 510 PTEYIQLPLDGTNNPQNLVETLTNFFNGENIDFDCPTCKKTVVATKRQRFKTSPNTLVIS 569

Query: 527 PIRIRL--QNWIPVKTSNELSLPGLID-RDDMLDVSSYLSQGFDPQTENLLP-DEDENRS 582
           P RI    + W P+KTS EL+LP L D  +++LD+SS++S+GFDP  E L P D +E+ +
Sbjct: 570 PHRISFEKETWTPIKTSAELTLPNLDDSSNELLDLSSFISKGFDPTKETLFPEDVNEDNN 629

Query: 583 SFTPNQCSISQLIEMGFTQNASVRALFNTG-NQDAESAMNWLFQHMDDPDLNDPFVPPPN 641
           +F PN+ ++  L+EMGFT+N + +AL++TG N D E A+ WL QHMDD D  D FVPPP 
Sbjct: 630 TFKPNEQAVPPLLEMGFTENLAAKALYHTGNNNDPEPALQWLMQHMDDSDFQDEFVPPPQ 689

Query: 642 VPKKD-KREVDEVSLTSMLSMGLNPNLCRKALILNNGDVNRSVEWVFNNMDDDGTFXXXX 700
                   +VD+ SL++M+ MGLN  L  KAL+LN GD+N S+EWVFNN DD+G      
Sbjct: 690 TKAAGPAAKVDQESLSNMIDMGLNEKLSIKALVLNKGDINASIEWVFNNPDDNGEL---- 745

Query: 701 XXXXXXXXKKD-----LGYSTAKPYALTAVICHKGNSVHSGHYVVFIRKLVADKWKWVLY 755
                   K+D      G   AKPY LTAV+CHKGNS HSGHYV FIRK++ D+ KWVLY
Sbjct: 746 --PSETTPKRDEEGIIYGNLDAKPYRLTAVVCHKGNSAHSGHYVAFIRKMIDDELKWVLY 803

Query: 756 NDEKLVAADSIE 767
           NDEK+V +D+I+
Sbjct: 804 NDEKIVVSDNID 815

>AGR023C [4333] [Homologous to ScYBR058C (UBP14) - SH]
           (756967..759309) [2343 bp, 780 aa]
          Length = 780

 Score =  710 bits (1832), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/775 (47%), Positives = 499/775 (64%), Gaps = 30/775 (3%)

Query: 5   VLENVNVPAVVSKDECIYCFESPYNEPLALN--ASPKHSLNICLNCFQATCNRHVPLHIR 62
           V++ + +P+ + KD+C YCFE+  N        A P+H LNICL CFQ+ C+ HV LH +
Sbjct: 4   VVKQLKIPSTIYKDDCGYCFETMINPNFGDGGPAEPEHQLNICLGCFQSFCHEHVNLHQQ 63

Query: 63  VTEYACDTIHSNYLTIAXXXXXXXXXXXXXXXXXXIKLQVIETSEDDTHNTIWSLQRFNG 122
           V        H  YL +                   +KL+V + SE++ + T+WSL R N 
Sbjct: 64  VVRRVQQATHDLYLNV----YKIERPKATESAEKRLKLEVQDLSEEELYETVWSLVRINN 119

Query: 123 ENVPRTVLSKSTDSDISSTALEKIEKILKAKSQDFEDKKNSWVLEISTCPHTENFQIPSK 182
               R   SK     + +T + K+E+I++ +S DF+D   +W LEI  CPH+E F +P  
Sbjct: 120 ACTARLGSSKQKQK-MDTTVVSKLEQIIRTRSSDFKDMAATWQLEIKACPHSEQFVVP-- 176

Query: 183 PENTVNLNQ-CSSCDLTQNLWLCLHCGNIGCGREQIGIDGHSHALDHYR-SNNNHPLAIK 240
            ++ + + + C  CDL +NLWLCLHCGNIGCGREQ+GI+GHSHAL HY+ S NNHPLA+K
Sbjct: 177 -QDAMPVRETCGDCDLDRNLWLCLHCGNIGCGREQVGIEGHSHALKHYQQSENNHPLAVK 235

Query: 241 LGSLSSSTYDLYCYACDDETRFPDNVNLGSALQIYGINIQEKIADEKTLVQLQVEQNENW 300
           LGSL+S + D+YCY+C+DE  FPD     + L  +GI+++ ++A EKTLV+LQVEQN NW
Sbjct: 236 LGSLTSESNDIYCYSCNDEVAFPDPNRFSAVLAKFGIDLEGQVAKEKTLVELQVEQNMNW 295

Query: 301 QFRMVDSSGKEFEKLSASKNYGCGLINLGNSCYLNSVIQSLVNGGVPNWSLDFLGSKFPL 360
            F+M DS  +  +K+ ASK YGCGLINLGNSCYLNSV+Q L NGGV +W+LD LG  FP 
Sbjct: 296 DFQMRDSGNEFTKKIFASKEYGCGLINLGNSCYLNSVVQVLFNGGVKDWNLDMLGD-FPR 354

Query: 361 DVVYPDNNLKCQWIKLLNAMKCEPELYPNGIKPTTFKKCIGQNHQEFSSNRQQDAMEXXX 420
           DVV+P  NLKCQ IKL NA+K  PE Y +G+KP + KKCIG++++EFSS RQQDAME   
Sbjct: 355 DVVFPSTNLKCQLIKLRNALKIHPEKYQHGVKPASVKKCIGEDNEEFSSGRQQDAMEFLT 414

Query: 421 XXXXXXXXXXXXXXXXGIPNPNDLVRFMMEDRLQCNICGKVKYSYEPTEAIQIPLEENDE 480
                              NPNDL+RFM+EDRL+C  C  VKYS +  E +QIPL ++++
Sbjct: 415 YFIDKLDRKVFSKASSS--NPNDLMRFMVEDRLECTKCEHVKYSSQVCEILQIPLLDSND 472

Query: 481 PQDMLERIKAYFEGQTIEFKCANCKEKVTANKKPGFKSLPQTLILNPIRIRLQNWIPVKT 540
           PQ +++R+ +YF G++++  C  C E   A K    K+ P TL++NPIRI+LQNW P+KT
Sbjct: 473 PQFLMDRLHSYFNGESLDIHCPQCSEITVATKNSMLKTAPATLLINPIRIKLQNWTPIKT 532

Query: 541 SNELSLPGLIDRDDMLDVSSYLSQGFDPQTENLLPDEDENRS-------SFTPNQCSISQ 593
           SN+L +PGL D +  L +S + + G  P  E +  D  ++ S       SF P++  +  
Sbjct: 533 SNQLFVPGLRD-EKRLKLSQFKAHGRQP-GEKIFEDSPDDNSNVPASAISFNPDEDKVIS 590

Query: 594 LIEMGFTQNASVRALFNTGNQDAESAMNWLFQHMDDPDLNDPFVPPPNVPKKDKREVDEV 653
           +I MGF++NA++RAL+NTG++  E A+NW+F+HM+DP+LN  F  P    KK    VD+ 
Sbjct: 591 IISMGFSKNAALRALYNTGSE-VERALNWIFEHMEDPELNAEFSVPGT--KKQAAVVDQG 647

Query: 654 SLTSMLSMGLNPNLCRKALILNNGDVNRSVEWVFNNMDDDGTFXXXXXXXXXXXXKKDLG 713
           +L SM+SMGL    CRKALILN+GDV RSVEWVFNN D+                 +D G
Sbjct: 648 ALDSMVSMGLAERHCRKALILNDGDVTRSVEWVFNNADN--LDDDDTQESIDPPVSRDYG 705

Query: 714 YSTAKP-YALTAVICHKGNSVHSGHYVVFIRKLVADKWKWVLYNDEKLVAADSIE 767
           Y    P YAL+AVICHKGNSV SGHYV FI+K V  + KWVLYNDEKL+A    E
Sbjct: 706 YPGDIPDYALSAVICHKGNSVQSGHYVAFIKKAVDGEPKWVLYNDEKLMAVGGNE 760

>Kwal_56.23084
          Length = 762

 Score =  705 bits (1819), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/759 (46%), Positives = 495/759 (65%), Gaps = 29/759 (3%)

Query: 9   VNVPAVVSKDECIYCFESPYNEPLALNASPKHSLNICLNCFQATCNRHVPLHIRVTEYAC 68
           + +P+V+ KD+C YCFE+ +NE    + +  H+L+ICL+CFQ+ C  HVPLH  VT+   
Sbjct: 10  LQIPSVIYKDDCGYCFETLHNE----SQTTSHALHICLDCFQSFCKSHVPLHQCVTKKEF 65

Query: 69  DTIHSNYLTIAXXXXXXXXXXXXXXXXXXIKLQVIETSEDDTHNTIWSLQRFNGENVPRT 128
              H   L ++                  +KL+V+E SEDD ++++W L + N       
Sbjct: 66  ARSHDFLLKVSKCKKAEQSQPIEKK----LKLEVMERSEDDIYDSLWWLMKGND------ 115

Query: 129 VLSKSTDSDISSTALEKIEKILKAKSQDFEDKKNSWVLEISTCPHTENFQIPSKPENTVN 188
           +++     D  +    K+ +IL A+S  F+    SW LEI  C H  +F+ P      ++
Sbjct: 116 IIADYKSQDFEADVQNKVAQILNARSNTFQRATESWQLEIKPCSHVTSFETPVNKSECLS 175

Query: 189 LNQCSSCDLTQNLWLCLHCGNIGCGREQIGIDGHSHALDHYRSNNNHPLAIKLGSLSSST 248
            + C  C L  NLWLCLHCGN+GCGR+Q+GI+GHSHAL H+  N  HPLA+KLGSLS+++
Sbjct: 176 -DVCVECKLGSNLWLCLHCGNVGCGRQQVGIEGHSHALTHFEENPEHPLAVKLGSLSNTS 234

Query: 249 YDLYCYACDDETRFPDNVNLGSALQIYGINIQEKIADEKTLVQLQVEQNENWQFRMVDSS 308
            D+YCY CDDE +F D     + L+ +GINI++K+A EK+LV+LQVEQN +W F+MVDS 
Sbjct: 235 ADIYCYFCDDEVQFQDLDKWHNVLEHWGINIRDKVAQEKSLVELQVEQNASWDFQMVDSQ 294

Query: 309 GKEFEKLSASKNYGCGLINLGNSCYLNSVIQSLVNGGVPNWSLDFLGSKFPLDVVYPDNN 368
           G E   L +SK YGCGL+NLGNSCY+N+V+Q L NGGV +WSLD LG  FP DVVY  +N
Sbjct: 295 GHELHHLRSSKRYGCGLLNLGNSCYMNAVLQVLFNGGVSSWSLDELGD-FPTDVVYVSSN 353

Query: 369 LKCQWIKLLNAMKCEPELYPNGIKPTTFKKCIGQNHQEFSSNRQQDAMEXXXXXXXXXXX 428
           LKCQ IKL NA++  PE+YPNG+KP+TFK C+G  H+EFSS RQQDA+E           
Sbjct: 354 LKCQLIKLRNALRTNPEMYPNGVKPSTFKDCVGGTHEEFSSGRQQDALEFFSYLIDLLDK 413

Query: 429 XXXXXXXXGIPNPNDLVRFMMEDRLQCNICGKVKYSYEPTEAIQIPLEENDEPQDMLERI 488
                      +PNDL++F ++DR++C  C  VKY  + ++ +Q+PL E+D+PQ ++  +
Sbjct: 414 KLFNRSEF---HPNDLMKFSLQDRIECTSCHGVKYVTQVSDYLQVPLPESDDPQMLITNL 470

Query: 489 KAYFEGQTIEFKCANCKEKVTANKKPGFKSLPQTLILNPIRIRLQNWIPVKTSNELSLPG 548
           + Y +G+T+EF C  C     A K  GF++ P+TL+++  RI+L NW+P KTS E+++PG
Sbjct: 471 ERYLQGETVEFSCPKCNRVTEAVKSSGFQTYPETLVVSCSRIKLVNWVPTKTSQEVTMPG 530

Query: 549 LIDRD-DMLDVSSYLSQGFDPQTENLLPDEDENRSSFTPNQCSISQLIEMGFTQNASVRA 607
           +   D  +L +    S GF+ ++E+LLP EDE+        C +SQL+EMGFT+NAS+RA
Sbjct: 531 IDAADTSLLQLGHLKSNGFNSESEHLLP-EDESPGFKAKPHC-VSQLMEMGFTENASIRA 588

Query: 608 LFNTGNQDAESAMNWLFQHMDDPDLNDPFVPPPNVPKKDKREVDEVSLTSMLSMGLNPNL 667
           L++TGN D +SAMNWLFQH++D D+N+ FV  PN P K   EV+  +L SM+SMGLNP+L
Sbjct: 589 LYHTGNSDTDSAMNWLFQHVEDDDINELFV-APNAPSK-PSEVNPQALESMVSMGLNPDL 646

Query: 668 CRKALILNNGDVNRSVEWVFNNMD--DDGTFXXXXXXXXXXXXKKDLGYSTAKPYALTAV 725
           C KAL+L+ G+V+ SVEWVFNN D  DD                 D    T   + L+AV
Sbjct: 647 CHKALVLHKGNVSASVEWVFNNADNTDDTLLETQDGLDSNSYGISD---ETKANFRLSAV 703

Query: 726 ICHKGNSVHSGHYVVFIRKLVADKWKWVLYNDEKLVAAD 764
           ICHKG+SVHSGHYV FI+K V ++ KWVLYNDEK+V AD
Sbjct: 704 ICHKGSSVHSGHYVAFIKKDVENETKWVLYNDEKMVVAD 742

>KLLA0F18700g 1718738..1721050 similar to sp|P38237 Saccharomyces
           cerevisiae YBR058c UBP14 ubiquitin specific protease
           singleton, start by similarity
          Length = 770

 Score =  665 bits (1717), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/769 (45%), Positives = 483/769 (62%), Gaps = 25/769 (3%)

Query: 1   MAEAVLENVNVPAVVSKDECIYCFESPYNEPLALNASPKHSLNICLNCFQATCNRHVPLH 60
           M+ + + ++NVP V+  D+C+YCFE+  N+    +   +HSL ICL CFQ+    H  LH
Sbjct: 1   MSGSDILDINVPRVIDTDDCVYCFETMKNK----DEGREHSLFICLRCFQSFSEEHWELH 56

Query: 61  IRVTEYACDTIHSNYLTIAXXXXXXXXXXXXXX--XXXXIKLQVIETSEDDTHNTIWSLQ 118
             V      + H  YL +                     +KL+V + +EDD ++T W L 
Sbjct: 57  QEVVLSETGSTHDLYLRVFKVLKPKQEREEAGTPPLEKKLKLEVKDVNEDDLYDTHWLL- 115

Query: 119 RFNGENVPRTVLSKSTDSDISSTALEKIEKILKAKSQDFEDKKNSWVLEISTCPHTENFQ 178
              G      +LS  T S I     +KI +IL+ KS  ++D  N+W LE+ +CPH + F 
Sbjct: 116 ---GSVEHGELLSSDTPS-IPKEWSDKISEILQTKSSSYQDMSNTWTLELKSCPHIQTFD 171

Query: 179 IPSKPENTVNLNQ-CSSCDLTQNLWLCLHCGNIGCGREQIGIDGHSHALDHYRSNNNHPL 237
           + +  +    ++Q C+ C LT NLWLCLHCGN+ CGREQ+GI+G+SHAL HY S + H L
Sbjct: 172 LSNLEKREGGISQSCNDCGLTSNLWLCLHCGNVACGREQVGIEGYSHALKHYESTDGHAL 231

Query: 238 AIKLGSLSSSTYDLYCYACDDETRFPDNVNLGSALQIYGINIQEKIADEKTLVQLQVEQN 297
           AIKLGSL++   D+YCY+CD++ +F  N+ L   L+ + + +  K + EKTLV+LQVEQ+
Sbjct: 232 AIKLGSLTADAADIYCYSCDEDVKFTHNLQLQDILKFWEVEVPAK-SKEKTLVELQVEQS 290

Query: 298 ENWQFRMVDSSGKEFEKLSASKNYGCGLINLGNSCYLNSVIQSLVNGGVPNWSLDFLGSK 357
             W F+MVDS GK  + L     YG GL+NLGNSCYLNSV+Q L+NGG+ NW+LD LGS 
Sbjct: 291 LKWDFQMVDSQGKSLKHLQNGPEYGLGLLNLGNSCYLNSVLQVLLNGGIRNWNLDGLGS- 349

Query: 358 FPLDVVYPDNNLKCQWIKLLNAMKCEPELYPNGIKPTTFKKCIGQNHQEFSSNRQQDAME 417
           FP DVVYP  NL CQ IK+ NAM  +   YP GIKPTTFKK IG +H+EFSS RQQD++E
Sbjct: 350 FPTDVVYPRTNLHCQLIKIRNAMTLQQSRYPEGIKPTTFKKVIGGSHEEFSSGRQQDSLE 409

Query: 418 XXXXXXXXXXXXXXXXXXXGIPNPNDLVRFMMEDRLQCNICGKVKYSYEPTEAIQIPLEE 477
                                 NPNDL RF ++D+++C+ C KVK+  + +E IQ+PL +
Sbjct: 410 FFSYLSDKLDREIFKNTTT---NPNDLFRFNIQDKIKCDNCNKVKFMDQVSEVIQLPLRK 466

Query: 478 NDEPQDMLERIKAYFEGQTIEFKCANCKEKVTANKKPGFKSLPQTLILNPIRIRLQNWIP 537
            D  Q++++R+  YF G+ IE++C   K+  TA+K PGF S P+TLI+NPIRI L NW P
Sbjct: 467 LDGEQNLIDRLNDYFSGEKIEYRCLTNKKINTASKVPGFSSFPRTLIINPIRIELINWQP 526

Query: 538 VKTSNELSLPGLIDRDDMLDVSSYLSQGFDPQTENLLPDEDENRSSFTPNQCSISQLIEM 597
            KTS ++ +PG+ D D +LD+S + + G     E    +E+E   SF  N+  + QL +M
Sbjct: 527 SKTSEQVVVPGVRD-DALLDMSPFKATGI---CEGEEVEEEEESDSFQFNELFLGQLEQM 582

Query: 598 GFTQNASVRALFNTGNQDAESAMNWLFQHMDDPDLNDPFVPPPNVPKKDKREVDEVSLTS 657
           GF++NA+ RALF TGN D  +A  WLFQHM+DP+LN+ F P  +   K++  VD  +L S
Sbjct: 583 GFSRNATKRALFETGNSDPNAATEWLFQHMEDPNLNEAFDPHASSSAKNR--VDSEALNS 640

Query: 658 MLSMGLNPNLCRKALILNNGDVNRSVEWVFNNMDDDGTFXXXXXXXXXXXXKKDLGYST- 716
           M +MGL+  LCRKALIL NGDVN SVEWVF++MDDDG                 +  S+ 
Sbjct: 641 MTAMGLDSKLCRKALILKNGDVNASVEWVFSHMDDDGELPEAEEWKDQSRKSFGIPASSI 700

Query: 717 -AKPYALTAVICHKGNSVHSGHYVVFIRKLVADKWKWVLYNDEKLVAAD 764
            +  Y LTAVICHKGNSVHSGHYV FI+K+V  K +WVLYNDEK++ A+
Sbjct: 701 ASAKYKLTAVICHKGNSVHSGHYVAFIKKVVEGKEQWVLYNDEKILLAN 749

>Sklu_1729.1 YBR058C, Contig c1729 2315-2720 reverse complement
          Length = 136

 Score = 68.9 bits (167), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 54/110 (49%), Gaps = 7/110 (6%)

Query: 6   LENVNVPAVVSKDECIYCFESPYNEPLALNASPKHSLNICLNCFQATCNRHVPLHIRVTE 65
            +N+ VP+ + KD+C YCFE+ YN     + S  H LNICL+CFQ+ C  HV LH  +  
Sbjct: 7   FKNLAVPSSIYKDDCGYCFETMYNS----DDSTNHHLNICLSCFQSFCVDHVHLHQSIVG 62

Query: 66  YACDTIHSNYLTIAXXXXXXXXXXXXXXXXXXIKLQVIETSEDDTHNTIW 115
                 H  YL +                   +KL+V E SED+ + T W
Sbjct: 63  KELSESHDLYLKLK---KTRKPEVEEQRMEKKLKLEVKEQSEDEIYETKW 109

>Scas_545.2*
          Length = 918

 Score = 53.1 bits (126), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 67/313 (21%), Positives = 117/313 (37%), Gaps = 57/313 (18%)

Query: 320 NYGCGLINLGNSCYLNSVIQSLVNGGVPNWSLDFLGSKFPLDV-----VYPDNNLKCQWI 374
           ++  GL N+GNSCYLN +IQ L+  G    +  FL + +   +     +     L   + 
Sbjct: 556 DFIVGLQNIGNSCYLNCIIQCLL--GTHELTKIFLNNFYERHINLNSKLGSKGVLAKYFA 613

Query: 375 KLLNAM--KCEPELYPNGIKPTTFKKCIGQNHQEFSSNRQQDAMEX-------------- 418
           +L++ M     P+L  N ++P  FK  +G  +  F +  QQD  E               
Sbjct: 614 RLIHLMHNHANPKLKNNYVRPAQFKMAVGSVNTLFKNCSQQDCQEFCQFLLDGLHEDLNQ 673

Query: 419 -----XXXXXXXXXXXXXXXXXXGIPNPNDLVRFMMED--------------RLQCNICG 459
                                   I +  +  RF+  D              RLQC +C 
Sbjct: 674 CGSNPPLKELSSAAEKNREKLSLRIASSIEWERFLTTDFSVIVDLFQGQYASRLQCEVCK 733

Query: 460 KVKYSYEPTEAIQIPLEE--NDEPQDMLERIKAYFEGQTI----EFKCANCKEKVTANKK 513
               +Y+P   + +P+         ++L+  K + + + +    ++ C  CK+K  + KK
Sbjct: 734 HTSTTYQPFSVLSVPIPRVPKGVKVNILDCFKDFTKLELLDTDEQWLCPTCKKKQRSTKK 793

Query: 514 PGFKSLPQTLILNPIRIRLQNWIPVKTSNELSLPGLIDRDDMLDVSSYLSQGFDPQTENL 573
                LP+ LI++  R           +N       ID   +LD++ +    FD +    
Sbjct: 794 LTITRLPRNLIIHLKRF---------DNNLNKNNNFIDYPFILDLTQFWVDDFDGKLPPG 844

Query: 574 LPDEDENRSSFTP 586
           + DE   R    P
Sbjct: 845 VRDELPKRGQIPP 857

>AGL079C [4232] [Homologous to ScYHL010C - SH] (557422..558942)
           [1521 bp, 506 aa]
          Length = 506

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 36/117 (30%), Positives = 58/117 (49%), Gaps = 12/117 (10%)

Query: 184 ENTVNLNQCSSCDLTQNLWLCLHCGNIGCGREQIGIDGHSHALDHYRSNNNHPLAIKLGS 243
           E+  N + C  C  ++NLW+CL CG++GCGR         HA+ HY S ++H  A+ +  
Sbjct: 260 EDGANQSHCDVCGSSENLWVCLICGHMGCGRY-----NSKHAIQHYES-SSHCFAMDI-- 311

Query: 244 LSSSTYDLYCYACDDET-RFPDNVNLGSALQIYGINIQEKIADEKTLVQLQVEQNEN 299
              +T  ++ YA D+   R   N   G  ++I GI  +         VQ+ + Q E+
Sbjct: 312 ---ATKRVWDYAGDNYVHRLVQNEVDGKLVEIGGITSKRTQEYHLEYVQVLISQLES 365

>Kwal_26.8090
          Length = 520

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 39/68 (57%), Gaps = 11/68 (16%)

Query: 191 QCSSCDLTQNLWLCLHCGNIGCGREQIGIDGHSHALDHYRSNNNHPLAIKLGSLSSSTYD 250
           +CS+C + +NLW+CL CGNIGCGR         HA+ H++    H  A+ +     +T  
Sbjct: 284 RCSTCGVNENLWICLICGNIGCGRYNF-----KHAVQHFK-ETAHFFAMDV-----ATQR 332

Query: 251 LYCYACDD 258
           ++ YA D+
Sbjct: 333 VWDYAGDN 340

>Kwal_14.2008
          Length = 424

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 59/264 (22%), Positives = 97/264 (36%), Gaps = 57/264 (21%)

Query: 320 NYGCGLINLGNSCYLNSVIQSLVNGGVPNWSLDFL--------------GSKFPLDVVYP 365
           N   GL+NLGNSCY+N +IQ L+  G       FL              GSK  L   + 
Sbjct: 53  NINVGLVNLGNSCYMNCIIQCLL--GTRELVQIFLDDSYKNHVNLNSRLGSKGVLAKYFS 110

Query: 366 D--NNLKCQWIKLLNAMKCEPELYPNGIKPTTFKKCIGQNHQEFSSNRQQDAMEX----- 418
              +N++ Q I   +  K       N ++P  FK   G  +  F +  QQD  E      
Sbjct: 111 QLIHNMQQQAISA-SGRKSTSGNERNAVQPLHFKVACGSINSLFKTTSQQDCQEFCQFLL 169

Query: 419 --------------XXXXXXXXXXXXXXXXXXGIPNPNDLVRFMMED------------- 451
                                            I +  +  R++  D             
Sbjct: 170 DGLHEDLNQCGGNPALKELSEEAEAIREKLCMRIASSIEWERYLTTDFSVIVDLFQGQYA 229

Query: 452 -RLQCNICGKVKYSYEPTEAIQIPLEENDEPQDMLERIKAYFEGQTIE----FKCANCKE 506
            +L C +CG+   +Y+P   + +P+       ++L+  + + + +T+E    + C  CK 
Sbjct: 230 SQLMCKVCGRTSTTYQPFSVLSVPVPRGARC-NLLDCFEEFTKIETLEKDEQWSCPRCKV 288

Query: 507 KVTANKKPGFKSLPQTLILNPIRI 530
           K  + KK     LP+ LI++  R 
Sbjct: 289 KQPSTKKITITRLPRNLIIHLKRF 312

>YHL010C (YHL010C) [2276] chr8 complement(81959..83716) Protein that
           binds in vitro to proteins containing canonical nuclear
           localization signal, has similarity to human BRAP2
           breast cancer-associated protein which may regulate
           protein import into the nucleus [1758 bp, 585 aa]
          Length = 585

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 19/39 (48%), Positives = 24/39 (61%), Gaps = 5/39 (12%)

Query: 191 QCSSCDLTQNLWLCLHCGNIGCGREQIGIDGHSHALDHY 229
            C++C  T NLW+CL CGN+GCGR         HA+ HY
Sbjct: 300 HCATCGSTDNLWICLICGNVGCGRY-----NSKHAIKHY 333

>CAGL0K02563g complement(230983..232743) similar to sp|P38748
           Saccharomyces cerevisiae YHL010c, hypothetical start
          Length = 586

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 37/70 (52%), Gaps = 11/70 (15%)

Query: 188 NLNQCSSCDLTQNLWLCLHCGNIGCGREQIGIDGHSHALDHYRSNNNHPLAIKLGSLSSS 247
           N  +CS C  ++NLW+CL CG++GCGR         HA+ H+    +H  A     + S 
Sbjct: 303 NKEKCSECGSSENLWICLICGHVGCGRY-----NSRHAIKHFEE-TSHCFA-----MDSK 351

Query: 248 TYDLYCYACD 257
           T  ++ YA D
Sbjct: 352 TDRVWDYAGD 361

>CAGL0I05522g complement(521749..523923) some similarities with
           sp|P39967 Saccharomyces cerevisiae YER098w UBP9 or
           sp|P38187 Saccharomyces cerevisiae YBL067c UBP13,
           hypothetical start
          Length = 724

 Score = 46.6 bits (109), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 47/194 (24%), Positives = 84/194 (43%), Gaps = 21/194 (10%)

Query: 373 WIKLLNAMKCEPE-LYPNGI-KPTTFKKCIGQNHQEFSSNRQQDAMEXXXXXXXXXXXXX 430
           +  L + M+C  E  Y +G+  P  F K + + +  F+S  QQDA E             
Sbjct: 375 YYALKDIMECITENRYLSGVVSPAEFVKLLKRQNPLFNSTMQQDAHEFLNFLLNNISDFA 434

Query: 431 XXXXXXGIPNPN--------DLVRFMME----DRLQCNICGKVKYSYEPTEAIQIPLE-E 477
                  + + N        D V+   E    +R++C  C  V  + EP   +  P+E +
Sbjct: 435 GKYKSNYLKSSNEEECEISHDFVKDQFEGVLLNRIKCLTCDCVSANEEP--FLDFPIEIQ 492

Query: 478 NDEPQDMLERIKAYFEGQTI----EFKCANCKEKVTANKKPGFKSLPQTLILNPIRIRLQ 533
           NDE  ++ +  +++++ + +    +F C  C     A K  GF+ LP+TL L+  R +  
Sbjct: 493 NDEAINIQDTFRSFYQREILCGPNKFYCNECCGLQEAEKTVGFEKLPKTLALHLKRFKCD 552

Query: 534 NWIPVKTSNELSLP 547
             +  K  N++  P
Sbjct: 553 GIVNSKLFNKIEYP 566

 Score = 38.9 bits (89), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 26/46 (56%), Gaps = 3/46 (6%)

Query: 715 STAKPYALTAVICHKGNSVHSGHYVVFIRKLVADKWKWVLYNDEKL 760
           S  K Y LT V+ H G S   GHYV   +    +K+ W++Y+DE +
Sbjct: 578 SLCKTYELTGVVLHVGASPTHGHYVSICKH---EKYGWLMYDDETI 620

>KLLA0E10252g 906675..909065 gi|10444512|gb|AAG17929.1|AF303215_1
           Kluyveromyces lactis deubiquitinating enzyme,
           hypothetical start
          Length = 796

 Score = 46.6 bits (109), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 63/283 (22%), Positives = 106/283 (37%), Gaps = 56/283 (19%)

Query: 320 NYGCGLINLGNSCYLNSVIQSLVNGGVPNWSLDFLGSKFPLDV-----VYPDNNLKCQWI 374
           ++  GL+NLGNSCYLN +IQ L+  G    S  FL + +   V     +     L   + 
Sbjct: 429 DFAIGLVNLGNSCYLNCIIQCLL--GCHELSYIFLTNSYRKHVNVNSRLGSKGLLANYFS 486

Query: 375 KLLNAMKCEPEL--YPN------GIKPTTFKKCIGQNHQEFSSNRQQDAMEXXX------ 420
           +L+  M  + +L  Y N       + PT FK   G  +  F   +QQD  E         
Sbjct: 487 QLVQKMYQQGKLQAYNNTNMESTAVHPTQFKLACGSINSLFKGKQQQDCQEFCQFLLDGL 546

Query: 421 -------------XXXXXXXXXXXXXXXXGIPNPNDLVRFMMED--------------RL 453
                                         I +  +  R++  D              +L
Sbjct: 547 HEDLNQCGTNPPLKELSPEAEKMRETMPMRIASAIEWERYLTTDFSVIVDLFQGQYASQL 606

Query: 454 QCNICGKVKYSYEPTEAIQIPLEENDEPQDMLERIKAYFEGQTIE----FKCANCKEKVT 509
           +C IC     +Y+    + +P+        + +  K + + +T+E    + C  CK++  
Sbjct: 607 RCKICAHTSTTYQAFSVLSVPVPR-ARSCTIYDCFKEFTKLETLEKDELWYCPYCKQRQP 665

Query: 510 ANKKPGFKSLPQTLILNPIR---IRLQNWIPVKTSNELSLPGL 549
           + K+     LP  LI++  R   +  +N + V   NEL L G 
Sbjct: 666 STKQIIITRLPNNLIIHLKRFDNMMNKNNVFVNYPNELDLTGF 708

>KLLA0F25740g complement(2389226..2390779) similar to sp|P38748
           Saccharomyces cerevisiae YHL010c singleton, start by
           similarity
          Length = 517

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/70 (38%), Positives = 38/70 (54%), Gaps = 11/70 (15%)

Query: 189 LNQCSSCDLTQNLWLCLHCGNIGCGREQIGIDGHSHALDHYRSNNNHPLAIKLGSLSSST 248
           L +C  C  T NLW+CL CG++GCGR         HA+ HY   +NH  A+ L     +T
Sbjct: 267 LPRCLECGETNNLWICLICGHLGCGRY-----NSQHAICHYE-QSNHCFAMDL-----TT 315

Query: 249 YDLYCYACDD 258
             ++ YA D+
Sbjct: 316 KRVWDYAGDN 325

>Kwal_33.13628
          Length = 1160

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 37/129 (28%), Positives = 59/129 (45%), Gaps = 13/129 (10%)

Query: 294 VEQNENWQFRMVDSSGKEFEKLSASKNYGCGLINLGNSCYLNSVIQSLVNGGVPNWSLDF 353
           VE++++W      S+   + KLS       GL NLGNSCY+NS +Q LV+  +P     F
Sbjct: 275 VEKDQHWL-----SNYYYYNKLSPPSGI-VGLSNLGNSCYMNSALQCLVH--IPELRDYF 326

Query: 354 LGSKFPLDV-----VYPDNNLKCQWIKLLNAMKCEPELYPNGIKPTTFKKCIGQNHQEFS 408
           L   F  D+     +     +   +  L+ ++  +         P  FK  IG ++  F+
Sbjct: 327 LYGGFEQDINTSNPLGYQGQIAQAFAALVKSLFDDKASALQAFSPRAFKSIIGHHNGMFA 386

Query: 409 SNRQQDAME 417
              QQD+ E
Sbjct: 387 GFLQQDSQE 395

>CAGL0G05247g complement(491024..493867) similar to sp|P32571
           Saccharomyces cerevisiae YDR069c DOA4 ubiquitin-specific
           protease, hypothetical start
          Length = 947

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 50/257 (19%), Positives = 97/257 (37%), Gaps = 48/257 (18%)

Query: 320 NYGCGLINLGNSCYLNSVIQSLVNGGVPNWSLDFLGSKFPLDV-----VYPDNNLKCQWI 374
           N+  GL N+GNSCY+N ++Q ++  G    S  FL + +   +     +     L   + 
Sbjct: 580 NFTVGLENMGNSCYMNCILQCIM--GTNELSQIFLNNSYEKHININSKLGSKGVLARYFA 637

Query: 375 KLLNAM---KCEPELYPNGIKPTTFKKCIGQNHQEFSSNRQQDAMEX------------- 418
           +L + M     + E     ++PT F+  I   +  F +  QQD  E              
Sbjct: 638 RLAHIMHQTSYDQEKKAAIVRPTQFRMAIASINSMFRNTNQQDCQEFCQFLLDGLHEDLN 697

Query: 419 ------XXXXXXXXXXXXXXXXXXGIPNPNDLVRFMMED--------------RLQCNIC 458
                                    I +  +  RF+  +              RL+C++C
Sbjct: 698 QCGNNPPLKELSEEAEKKRELLSLRIASSIEWERFLTTNFSVIIDLFQGQYASRLKCSVC 757

Query: 459 GKVKYSYEPTEAIQIPLEENDEPQ-DMLERIKAYFEGQTIE----FKCANCKEKVTANKK 513
                +Y+P   + +PL    +   ++++    + + + +E    + C  CK+K  + K+
Sbjct: 758 SNTSTTYQPFSVLSVPLPTGTKSSVNLMDCFNEFTKCEKLEHDEYWNCPTCKKKQPSTKQ 817

Query: 514 PGFKSLPQTLILNPIRI 530
                LP+ LI++  R 
Sbjct: 818 LTITRLPRNLIIHLKRF 834

>AFR627C [3819] [Homologous to ScYJL197W (UBP12) - SH]
           (1572372..1576235) [3864 bp, 1287 aa]
          Length = 1287

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 55/111 (49%), Gaps = 8/111 (7%)

Query: 312 FEKLSASKNYGCGLINLGNSCYLNSVIQSLVNGGVPNWSLDFLGSKFPLDV-----VYPD 366
           + +L +SK    GL NLGN+CY+NS +Q L++  +P +   FL + +  +V     +   
Sbjct: 336 YNQLLSSKG-TIGLSNLGNTCYMNSALQCLLH--IPEFKDYFLYNGYEKEVNIENPLGHK 392

Query: 367 NNLKCQWIKLLNAMKCEPELYPNGIKPTTFKKCIGQNHQEFSSNRQQDAME 417
            ++   +  ++ A+  +         P  FK  IG  +  FS  +QQD+ E
Sbjct: 393 GHIAWAFASMVQALFGKRHSAATSYSPRNFKNTIGHLNSMFSGYQQQDSQE 443

>Scas_11.1*
          Length = 88

 Score = 40.4 bits (93), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 19/41 (46%), Positives = 26/41 (63%), Gaps = 1/41 (2%)

Query: 720 YALTAVICHKGNSVHSGHYVVFIRKLVADKWKWVLYNDEKL 760
           Y L  VI H+G +  SGHY  FIR  + D+ KW  +ND+K+
Sbjct: 19  YDLIGVITHQGANSESGHYQAFIRDEM-DENKWYKFNDDKV 58

>Scas_609.9
          Length = 729

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 27/46 (58%), Gaps = 3/46 (6%)

Query: 715 STAKPYALTAVICHKGNSVHSGHYVVFIRKLVADKWKWVLYNDEKL 760
           S AK Y LT V+ H G S   GHYV   +    DK+ W+L++DE +
Sbjct: 583 SIAKKYELTGVVIHMGGSPQHGHYVSLCKN---DKFGWLLFDDETV 625

 Score = 35.0 bits (79), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 43/184 (23%), Positives = 73/184 (39%), Gaps = 16/184 (8%)

Query: 391 IKPTTFKKCIGQNHQEFSSNRQQDAME------XXXXXXXXXXXXXXXXXXXGIPNPN-- 442
           + P  F K + + +  F+S  QQDA E                          IP  N  
Sbjct: 401 VSPVEFVKVLKKENILFNSMMQQDAHEFLNFLLNELSEYLQNHISHPSNKPTDIPFKNYV 460

Query: 443 -DLVRFMMEDRLQCNICGKVKYSYEPTEAIQIPLEENDEPQDMLERIKAYFEGQTI---- 497
            DL + ++ +R++C  C  +    EP     I ++  DE  D+ + ++ Y   + +    
Sbjct: 461 IDLFQGVLTNRIKCLTCDNITSRDEPFLDFPIGVK-GDENIDIQDVLRCYHTREMLNGSN 519

Query: 498 EFKCANCKEKVTANKKPGFKSLPQTLILNPIRIRL--QNWIPVKTSNELSLPGLIDRDDM 555
           +F C+ C     A +  G K LP TL L+  R +   +    +K  N++  P  +D    
Sbjct: 520 KFYCSQCCGLQEAERIVGLKQLPHTLALHLKRFKYSEEQNTNIKLFNKVQYPLKLDVAST 579

Query: 556 LDVS 559
            D S
Sbjct: 580 FDSS 583

>KLLA0C06974g complement(604344..605684) similar to sp|P50102
           Saccharomyces cerevisiae YMR223w UBP8, start by
           similarity
          Length = 446

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 51/243 (20%), Positives = 100/243 (41%), Gaps = 28/243 (11%)

Query: 324 GLINLGNSCYLNSVIQSLVNGGVPNWSLDFLGSKFP--LDVVYPDNNLKCQWIKLLNAMK 381
           GL+N+G++C+++S+IQ++++   P +  D L  K     D+      + C     L+ + 
Sbjct: 134 GLVNMGSTCFMSSIIQTIIHN--PYFVEDLLSHKHCNNCDIKSGTKCVSCA----LDEIA 187

Query: 382 CEPELYPNG---IKPTTFKKCIGQ--------NHQEFSSNRQQDAMEX-XXXXXXXXXXX 429
           C+   Y NG    K ++  K            NH    S+ QQDA E             
Sbjct: 188 CD--FYGNGPGTGKSSSVSKGFVNLLSASWHINHHLVGSS-QQDAHEYWQFLLNQLHTDH 244

Query: 430 XXXXXXXGIPN----PNDLVRFMMEDRLQCNICGKVKYSYEPTEAIQIPLEENDEPQDML 485
                    P+     + + +  +++ LQC+ CG  K + +P   + + ++ N + +D L
Sbjct: 245 ARVFGSSKAPDCQCITHRIFQGYLKNTLQCSQCGFSKTTIDPIMDLSLEIKNNPKLEDCL 304

Query: 486 ERIKAYFEGQTIEFKCANCKEKVTANKKPGFKSLPQTLILNPIRIRLQ-NWIPVKTSNEL 544
           +  +         ++C +CK+     K+      P  L++   R   Q N    K ++ +
Sbjct: 305 DHFQREETLTDFHYECQSCKQNQGVVKQLTLHKAPNVLVIQLKRFEHQLNGQSAKLNDRV 364

Query: 545 SLP 547
             P
Sbjct: 365 QFP 367

>Scas_634.14
          Length = 1201

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 51/101 (50%), Gaps = 9/101 (8%)

Query: 323 CGLINLGNSCYLNSVIQSLVNGGVPNWSLDFLGSKFPLDVVYPDNNLKCQ------WIKL 376
            GL+NLGN+CY+NS +Q + +  +P +   FL S +  + +  DN L  Q      + +L
Sbjct: 321 TGLVNLGNTCYMNSALQCITH--IPVFREYFLYSGYEKE-LNTDNPLGYQGHVAEAFSEL 377

Query: 377 LNAMKCEPELYPNGIKPTTFKKCIGQNHQEFSSNRQQDAME 417
           +  +  +  +  +   P  FK  IG  +  FS   QQD+ E
Sbjct: 378 IRCLFGDKLVQFSAYAPNHFKATIGHFNSMFSGYLQQDSQE 418

>AFR007W [3199] [Homologous to ScYDR069C (DOA4) - SH; ScYER144C
           (UBP5) - SH] complement(448632..451178) [2547 bp, 848
           aa]
          Length = 848

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 59/304 (19%), Positives = 111/304 (36%), Gaps = 65/304 (21%)

Query: 320 NYGCGLINLGNSCYLNSVIQSLVNGGVPNWSLDF--------------LGSKFPLDVVYP 365
           N+  GL+N GNSCY++ +IQ L+  G       F              LGSK  L   + 
Sbjct: 485 NFSVGLVNCGNSCYMSCIIQCLL--GTQELCTMFLNNSYQNHINLNSRLGSKGLLARYF- 541

Query: 366 DNNLKCQWIKLLNAMKCEPELYPNGIKPTTFKKCIGQNHQEFSSNRQQDAMEX------- 418
            + L  Q  +    ++ +       + PT FK   G  +  F  N QQD  E        
Sbjct: 542 -SQLIHQMYQYGKDIRKKMGNEKTAVIPTQFKIACGSINSSFKDNTQQDCQEFCQFLLDG 600

Query: 419 ------------XXXXXXXXXXXXXXXXXXGIPNPNDLVRFMMED--------------R 452
                                          + +  +  R++  D              +
Sbjct: 601 LHEDLNQCGNNPPLKELSEEAEKMREMMPMRLASAIEWERYLTTDFSVIVDLFQGQYASQ 660

Query: 453 LQCNICGKVKYSYEPTEAIQIPLEENDEPQDMLERIKAYFEGQTIE----FKCANCKEKV 508
           LQC +C +   +Y+P   + +P+        + +    + + +T+E    + C +CK++ 
Sbjct: 661 LQCKVCQRTSTTYQPFSVLSVPVPST-RTCTLTDCFTEFTKIETLEQEEQWSCPSCKKRQ 719

Query: 509 TANKKPGFKSLPQTLILNPIRIRLQNWIPVKTSNELSLPGLIDRDDMLDVSSYLSQGFDP 568
            + KK     LP+ LI     I L+ +  +   N +     +    +LD++++ +  +D 
Sbjct: 720 PSTKKITITRLPRNLI-----IHLKRFDNMLNKNNV----FVSYPSVLDLTAFWANDYDK 770

Query: 569 QTEN 572
           +  N
Sbjct: 771 KVTN 774

>KLLA0A10791g
           join(complement(935718..935733),
           complement(934135..935573)) similar to sp|P43593
           Saccharomyces cerevisiae YFR010w UBP6 ubiquitin-specific
           protease singleton, start by similarity
          Length = 484

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 32/53 (60%), Gaps = 3/53 (5%)

Query: 710 KDL--GYSTAKPYALTAVICHKGNSVHSGHYVVFIRKLVADKWKWVLYNDEKL 760
           KDL  G + +  Y L  V+ H+G +  SGHY  F+R   AD+ KW  YND+K+
Sbjct: 403 KDLRQGENPSSVYNLIGVVTHQGANSDSGHYQAFVRD-DADENKWYKYNDDKV 454

>Kwal_34.16268
          Length = 449

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 30/50 (60%), Gaps = 3/50 (6%)

Query: 720 YALTAVICHKGNSVHSGHYVVFIRKLVADKWKWVLYNDEK--LVAADSIE 767
           Y L  VI H+G +  SGHY  FIR  V D+ KW  +ND+K  ++  + IE
Sbjct: 380 YNLIGVITHQGANSESGHYQSFIRDEV-DENKWYRFNDDKVSIIEKEKIE 428

 Score = 33.1 bits (74), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 16/19 (84%)

Query: 323 CGLINLGNSCYLNSVIQSL 341
            GL NLGN+CY+NS +Q+L
Sbjct: 60  VGLKNLGNTCYMNSTLQAL 78

>YJL197W (UBP12) [2729] chr10 (63804..67568) Ubiquitin-specific
           protease, ubiquitin C-terminal hydrolase [3765 bp, 1254
           aa]
          Length = 1254

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/104 (30%), Positives = 46/104 (44%), Gaps = 12/104 (11%)

Query: 323 CGLINLGNSCYLNSVIQSLVNGGVPNWSLDFLGSKFPLDVVYPDNNLKCQWIKLLNAMKC 382
            GL+NLGN+CY+NS +Q LV+  +P     FL   +  D +  +N L             
Sbjct: 364 TGLVNLGNTCYMNSALQCLVH--IPQLRDYFLYDGYE-DEINEENPLGYHGYVARAFSDL 420

Query: 383 EPELYPN---------GIKPTTFKKCIGQNHQEFSSNRQQDAME 417
             +L+ N            P+ FK  IG  +  FS   QQD+ E
Sbjct: 421 VQKLFQNRMSIMQRNAAFPPSMFKSTIGHFNSMFSGYMQQDSQE 464

>CAGL0K10494g 1022869..1024356 highly similar to sp|P43593
           Saccharomyces cerevisiae YFR010w UBP6 ubiquitin-specific
           protease, start by similarity
          Length = 495

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 29/48 (60%), Gaps = 1/48 (2%)

Query: 713 GYSTAKPYALTAVICHKGNSVHSGHYVVFIRKLVADKWKWVLYNDEKL 760
           G + +  Y L  VI H+G +  SGHY  FIR   +D+ KW  +ND+K+
Sbjct: 419 GENPSSVYDLIGVITHQGANSESGHYQAFIRD-ESDENKWYKFNDDKV 465

 Score = 32.0 bits (71), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 11/22 (50%), Positives = 16/22 (72%)

Query: 323 CGLINLGNSCYLNSVIQSLVNG 344
            GL N+GN+CYLN+ +Q+L   
Sbjct: 109 LGLQNMGNTCYLNATLQALFRA 130

>YER098W (UBP9) [1530] chr5 (355462..357726) Ubiquitin C-terminal
           hydrolase, has similarity to Ubp13p [2265 bp, 754 aa]
          Length = 754

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 31/126 (24%), Positives = 57/126 (45%), Gaps = 9/126 (7%)

Query: 443 DLVRFMMEDRLQCNICGKVKYSYEPTEAIQIPLE-ENDEPQDMLERIKAYFEGQTI---- 497
           DL +  + +R++C  C  +    EP   +  P+E + DE  D+ + +K+Y + + +    
Sbjct: 475 DLFKGTLTNRIKCLTCDNITSRDEP--FLDFPIEVQGDEETDIQKMLKSYHQREMLNGVN 532

Query: 498 EFKCANCKEKVTANKKPGFKSLPQTLILNPIRIRL--QNWIPVKTSNELSLPGLIDRDDM 555
           +F C  C     A +  G K LP  L L+  R +   +    +K  N++  P  +D    
Sbjct: 533 KFYCNKCYGLQEAERMVGLKQLPHILSLHLKRFKYSEEQKSNIKLFNKILYPLTLDVSST 592

Query: 556 LDVSSY 561
            + S Y
Sbjct: 593 FNTSVY 598

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 26/46 (56%), Gaps = 3/46 (6%)

Query: 715 STAKPYALTAVICHKGNSVHSGHYVVFIRKLVADKWKWVLYNDEKL 760
           S  K Y L+ V+ H G+    GHYV   R    +K+ W+LY+DE +
Sbjct: 596 SVYKKYELSGVVIHMGSGPQHGHYVCICRN---EKFGWLLYDDETV 638

 Score = 30.4 bits (67), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 23/40 (57%), Gaps = 4/40 (10%)

Query: 324 GLINLGNSCYLNSVIQSLVNGGVPNWSLDFLGSKFPLDVV 363
           G  N GN+CY NSV+Q L N  +P +  + L  ++P  V 
Sbjct: 135 GYENFGNTCYCNSVLQCLYN--IPEFRCNVL--RYPERVA 170

>YFR010W (UBP6) [1690] chr6 (165060..166559) Ubiquitin C-terminal
           hydrolase associated with the 26S proteaseome, involved
           in ubiquitin turnover [1500 bp, 499 aa]
          Length = 499

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 30/50 (60%), Gaps = 3/50 (6%)

Query: 720 YALTAVICHKGNSVHSGHYVVFIRKLVADKWKWVLYNDEK--LVAADSIE 767
           Y L  VI H+G +  SGHY  FIR  + D+ KW  +ND+K  +V  + IE
Sbjct: 430 YNLIGVITHQGANSESGHYQAFIRDEL-DENKWYKFNDDKVSVVEKEKIE 478

>Scas_618.5
          Length = 493

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 32/57 (56%), Gaps = 3/57 (5%)

Query: 713 GYSTAKPYALTAVICHKGNSVHSGHYVVFIRKLVADKWKWVLYNDEK--LVAADSIE 767
           G + +  Y L  +I H+G +  SGHY  FIR    D+ KW  +ND+K  +V  + IE
Sbjct: 417 GENPSSVYNLVGIITHQGANSESGHYQAFIRD-ETDENKWYKFNDDKVSVVEKEKIE 472

>AEL029W [2477] [Homologous to ScYFR010W (UBP6) - SH]
           complement(580062..581402) [1341 bp, 446 aa]
          Length = 446

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 25/43 (58%), Gaps = 1/43 (2%)

Query: 720 YALTAVICHKGNSVHSGHYVVFIRKLVADKWKWVLYNDEKLVA 762
           Y L  VI H+G +  SGHY  F+R    D  KW  +ND+K+ A
Sbjct: 377 YDLIGVITHQGANSESGHYQAFMRDEFDDD-KWYKFNDDKVTA 418

 Score = 32.7 bits (73), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 41/96 (42%), Gaps = 26/96 (27%)

Query: 258 DETRFPDNVNLGSALQIYGINIQEKIADEKTLVQLQVEQNENWQFRMVDSSGKEFEKLSA 317
           DET   D V  GS++ + G   ++ +   +T                   + K  E L A
Sbjct: 8   DETAVADVVKPGSSVLLLGTPDKDMVVKPRT-------------------AEKFIEDLGA 48

Query: 318 SKNYG------CGLINLGNSCYLNSVIQSLVNGGVP 347
               G       G++N+GN+CY+N+ +Q L  G VP
Sbjct: 49  DAQSGQLSRVPMGIVNMGNTCYMNATLQGLY-GIVP 83

>YDR069C (DOA4) [920] chr4 complement(584935..587715)
           Ubiquitin-specific protease (ubiquitin C-terminal
           hydrolase), involved in recycling ubiquitin from protein
           substrates targeted to the proteasome and the vacuole
           [2781 bp, 926 aa]
          Length = 926

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 48/257 (18%), Positives = 95/257 (36%), Gaps = 48/257 (18%)

Query: 320 NYGCGLINLGNSCYLNSVIQSLVNGGVPNWSLDFLGSKFP----LDVVYPDNNLKCQWIK 375
           ++  GL NLGNSCY+N +IQ ++  G    +  FL   +     ++       +  ++  
Sbjct: 559 DFAVGLENLGNSCYMNCIIQCIL--GTHELTQIFLDDSYAKHININSKLGSKGILAKYFA 616

Query: 376 LLNAMKCEPELYPN---GIKPTTFKKCIGQNHQEFSSNRQQDAMEX-------------- 418
            L  M  + ++  +    I P  FK   G  +  F +  QQD  E               
Sbjct: 617 RLVHMMYKEQVDGSKKISISPIKFKLACGSVNSLFKTASQQDCQEFCQFLLDGLHEDLNQ 676

Query: 419 -----XXXXXXXXXXXXXXXXXXGIPNPNDLVRFMMED--------------RLQCNICG 459
                                   I +  +  RF+  D              RL+C +C 
Sbjct: 677 CGSNPPLKELSQEAEARREKLSLRIASSIEWERFLTTDFSVIVDLFQGQYASRLKCKVCS 736

Query: 460 KVKYSYEPTEAIQIPLEENDEPQDML--ERIKAYFEGQTIEFK----CANCKEKVTANKK 513
               +Y+P   + IP+ + +   ++   +  + + + + +E      C +C+++  + K+
Sbjct: 737 HTSTTYQPFTVLSIPIPKKNSRNNITIEDCFREFTKCENLEVDEQWLCPHCEKRQPSTKQ 796

Query: 514 PGFKSLPQTLILNPIRI 530
                LP+ LI++  R 
Sbjct: 797 LTITRLPRNLIVHLKRF 813

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 24/40 (60%), Gaps = 3/40 (7%)

Query: 720 YALTAVICHKGNSVHSGHYVVFIRKLVADKWKWVLYNDEK 759
           Y L  V CH G +++ GHY  +++K +  K  W+ ++D K
Sbjct: 864 YELYGVACHFG-TLYGGHYTAYVKKGL--KKGWLYFDDTK 900

>Kwal_26.9151
          Length = 454

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 35/142 (24%), Positives = 61/142 (42%), Gaps = 42/142 (29%)

Query: 202 WLCLHCGNIGCGREQIGIDGHSHALDHYRSNNNHPLAIKLGSLSSSTYDLYCYACDDETR 261
           ++CL CG  GC  +Q       H   H +       A  +  ++SS   L+C+ C     
Sbjct: 57  FMCLQCGVCGCWNKQ-------HFALHSKK------AGHIFGVNSSNGLLFCFKC----- 98

Query: 262 FPDNVNLGSALQIYGINIQEKIADEKTLVQLQVEQNENWQFRMVDSSGKEFEKLSASKNY 321
                              E +   + L    +  N+NW     D S K    L+  ++ 
Sbjct: 99  ------------------VEYVTGNEMLTNSML--NKNWD----DISVKSSVPLAKGRDG 134

Query: 322 GCGLINLGNSCYLNSVIQSLVN 343
            CGL+N+G++C+++S+IQ+LV+
Sbjct: 135 LCGLVNMGSTCFMSSIIQTLVH 156

>KLLA0C03476g 314815..318573 weakly similar to sp|P39538
           Saccharomyces cerevisiae YJL197w UBP12 ubiquitin
           C-terminal hydrolase, hypothetical start
          Length = 1252

 Score = 38.5 bits (88), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 34/128 (26%), Positives = 57/128 (44%), Gaps = 9/128 (7%)

Query: 293 QVEQNENWQFRMVDSSGKEFEKLSASKNYGCGLINLGNSCYLNSVIQSLVNGGVPNWSLD 352
           Q   N++W      S+   + KL+A      GL NLGN+CY+NS +Q L++    N    
Sbjct: 315 QKSSNQHWP-----SNFFHYNKLNAPSGI-MGLSNLGNTCYMNSALQCLLHIPELNEYFL 368

Query: 353 FLGSKFPLDVVYP---DNNLKCQWIKLLNAMKCEPELYPNGIKPTTFKKCIGQNHQEFSS 409
           + G +  +++  P     ++   +  LL ++            P  FK  IG  +  F+ 
Sbjct: 369 YKGYEREININNPLGHKGDVAHAFGHLLYSLFAPSYGQSTFYAPRNFKNTIGHYNSLFAG 428

Query: 410 NRQQDAME 417
             QQD+ E
Sbjct: 429 YGQQDSQE 436

>YBL067C (UBP13) [130] chr2 complement(93817..95883) Ubiquitin
           C-terminal hydrolase [2067 bp, 688 aa]
          Length = 688

 Score = 38.1 bits (87), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 47/95 (49%), Gaps = 7/95 (7%)

Query: 442 NDLVRFMMEDRLQCNICGKVKYSYEPTEAIQIPLE-ENDEPQDMLERIKAYFEGQTI--- 497
           +DL +  + ++++C  C  +    EP   +  P+E + DE  D+ E +K+Y + + +   
Sbjct: 475 SDLFQGTLTNQIKCLTCDNITSRDEP--FLDFPIEVQGDEETDIQEILKSYHQREMLNGS 532

Query: 498 -EFKCANCKEKVTANKKPGFKSLPQTLILNPIRIR 531
            +F C  C     A +  G K LP TL L+  R +
Sbjct: 533 NKFYCDECCGLQEAERLVGLKQLPDTLTLHLKRFK 567

 Score = 35.8 bits (81), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 14/44 (31%), Positives = 23/44 (52%), Gaps = 3/44 (6%)

Query: 720 YALTAVICHKGNSVHSGHYVVFIRKLVADKWKWVLYNDEKLVAA 763
           Y L  ++ H G     GHYV   +    +K+ W+L++DE + A 
Sbjct: 602 YELAGIVVHMGGGPQHGHYVSLCKH---EKFGWLLFDDETVEAV 642

>CAGL0A04477g 437397..439709 similar to sp|P38187 Saccharomyces
           cerevisiae YBL067c UBP13 or sp|P39967 Saccharomyces
           cerevisiae YER098w UBP9 ubiquitin carboxyl-terminal
           hydrolase, hypothetical start
          Length = 770

 Score = 38.1 bits (87), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 27/48 (56%), Gaps = 3/48 (6%)

Query: 715 STAKPYALTAVICHKGNSVHSGHYVVFIRKLVADKWKWVLYNDEKLVA 762
           S +K Y L+ ++ H G     GHY+   +    +K+ W+L++DE + A
Sbjct: 608 SISKNYELSGIVVHMGGGPQHGHYISLCKN---EKFGWLLFDDETVEA 652

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 23/93 (24%), Positives = 45/93 (48%), Gaps = 5/93 (5%)

Query: 443 DLVRFMMEDRLQCNICGKVKYSYEPTEAIQIPLEENDEPQDMLERIKAYFEGQTI----E 498
           D+ +  + +R++C  C       EP     I ++EN +  D+ E ++++ + + +    +
Sbjct: 487 DIFQGTLTNRIKCLTCDNTTARDEPFLDFPIEVQENVD-IDIQEILESFHQKEMLHGPNK 545

Query: 499 FKCANCKEKVTANKKPGFKSLPQTLILNPIRIR 531
           F C  C     A +  G K LP+TL L+  R +
Sbjct: 546 FYCDECCGLQEAERVVGLKQLPKTLALHLKRFK 578

 Score = 31.6 bits (70), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 23/37 (62%), Gaps = 4/37 (10%)

Query: 324 GLINLGNSCYLNSVIQSLVNGGVPNWSLDFLGSKFPL 360
           G  N GN+CY NSV+Q L N  +P +  D L  ++PL
Sbjct: 151 GYENFGNTCYCNSVLQCLYN--LPEFRNDML--RYPL 183

>Scas_671.3
          Length = 770

 Score = 38.1 bits (87), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 32/57 (56%)

Query: 296 QNENWQFRMVDSSGKEFEKLSASKNYGCGLINLGNSCYLNSVIQSLVNGGVPNWSLD 352
           +N N   R +  +G   +K+     +  GL+N GN+C++NSV+QSL +    N  LD
Sbjct: 64  KNNNMFRRWIPRAGNIDDKILKKGGFVGGLVNDGNTCFMNSVLQSLASSKELNAFLD 120

>KLLA0A00396g 29717..32755 similar to sp|P40453 Saccharomyces
           cerevisiae YIL156w UBP7 ubiquitin carboxy terminal
           hydrolase, start by similarity
          Length = 1012

 Score = 37.4 bits (85), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 54/119 (45%), Gaps = 19/119 (15%)

Query: 305 VDSSGKEFEKLSASKNYGCGLINLGNSCYLNSVIQSLVNGGVPNWSLDFLGSKFPLDVVY 364
           ++ S  EF  LS +     GL N+GN+CY+NS++Q L   G   +   FLG K+    + 
Sbjct: 575 IERSPNEFVSLSIT-----GLRNMGNTCYINSMLQCLF--GCSQFRDLFLGGKYH-RYLN 626

Query: 365 P--DNNLKCQWIKLLNAMKCEPELYPNG---IKPTTFKKCIGQNHQEFS-SNRQQDAME 417
           P   N +  +W  LL       ++Y NG   + P  F K       +F     QQD  E
Sbjct: 627 PKRSNTIISKWFSLLFR-----KMYLNGGCSVVPNGFLKACHMLRPDFHIPTDQQDTQE 680

>YIL156W (UBP7) [2521] chr9 (48091..51306) Putative
           ubiquitin-specific protease (ubiquitin C-terminal
           hydrolase) [3216 bp, 1071 aa]
          Length = 1071

 Score = 37.4 bits (85), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 48/100 (48%), Gaps = 7/100 (7%)

Query: 323 CGLINLGNSCYLNSVIQSLVNGGVPNWSLDFLGSKFPLDVVYPDNNLKCQWIKLLNAMK- 381
            GL NLGN+CY+NS+IQ L       +   F+ SK+   +    +N      KL N++  
Sbjct: 609 TGLRNLGNTCYINSMIQCLF--AAKTFRTLFISSKYKSYLQPIRSNGSHYSPKLSNSLSM 666

Query: 382 CEPELYPNG---IKPTTFKKCIGQNHQEFS-SNRQQDAME 417
              ++Y NG   + PT F K I Q   +    + QQD  E
Sbjct: 667 LFNKMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQE 706

>YMR223W (UBP8) [4179] chr13 (716714..718129) Putative
           ubiquitin-specific protease, ubiquitin C-terminal
           hydrolase [1416 bp, 471 aa]
          Length = 471

 Score = 37.0 bits (84), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 76/383 (19%), Positives = 138/383 (36%), Gaps = 77/383 (20%)

Query: 176 NFQIPSKPENTVNLNQCSSCDLTQN--LWLCLHCGNIGCGREQIGIDGHSHALDHYRSNN 233
           N  +P   E  +N  +C +C    +   ++CL CG  GC         HSH L H +   
Sbjct: 32  NHSVP--KEKFLNTMKCGTCHEINSGATFMCLQCGFCGCWN-------HSHFLSHSKQIG 82

Query: 234 NHPLAIKLGSLSSSTYDLYCYACDDETRFPDNVNLGSALQIYGINIQEKIADEKTLVQLQ 293
           +      +  ++S+   L+C+ C+D     D +N  + L  Y  ++  K           
Sbjct: 83  H------IFGINSNNGLLFCFKCEDYIGNIDLIN-DAILAKYWDDVCTKT---------- 125

Query: 294 VEQNENWQFRMVDSSGKEFEKLSASKNYGCGLINLGNSCYLNSVIQSLV-NGGVPNWSLD 352
                     MV S  +  + LS       GLIN+G++C+++S++Q L+ N      S+ 
Sbjct: 126 ----------MVPSMERR-DGLS-------GLINMGSTCFMSSILQCLIHNPYFIRHSMS 167

Query: 353 FLGSKFPLDVVYPDNNLKCQWIKLLNAMKCEPELYPNGIKPTTFKK---------CIGQN 403
            + S     V  PD    C   K+++ +             T+  +         C  + 
Sbjct: 168 QIHSN-NCKVRSPDKCFSCALDKIVHELYGALNTKQASSSSTSTNRQTGFIYLLTCAWKI 226

Query: 404 HQEFSSNRQQDAMEXXXXXXXXXXXXXXXXXXXGIPNPNDLVRF---------------M 448
           +Q  +   QQDA E                    +PN  ++ R                 
Sbjct: 227 NQNLAGYSQQDAHEFWQFIINQIHQSYVLD----LPNAKEVSRANNKQCECIVHTVFEGS 282

Query: 449 MEDRLQCNIC-GKVKYSYEPTEAIQIPLEENDEPQDMLERIKAYFEGQTIEFKCANCKEK 507
           +E  + C  C    K + +P   + + +++  +  + L+      + +   + C  C   
Sbjct: 283 LESSIVCPGCQNNSKTTIDPFLDLSLDIKDKKKLYECLDSFHKKEQLKDFNYHCGECNST 342

Query: 508 VTANKKPGFKSLPQTLILNPIRI 530
             A K+ G   LP  L+L   R 
Sbjct: 343 QDAIKQLGIHKLPSVLVLQLKRF 365

>Scas_655.4
          Length = 875

 Score = 36.6 bits (83), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 22/39 (56%), Gaps = 3/39 (7%)

Query: 720 YALTAVICHKGNSVHSGHYVVFIRKLVADKWKWVLYNDE 758
           Y L +V+ H+G S+ SGHY+   R+       W  Y+DE
Sbjct: 691 YELLSVVVHEGRSLSSGHYIAHCRQ---PDGSWATYDDE 726

 Score = 31.6 bits (70), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 17/66 (25%), Positives = 33/66 (50%), Gaps = 6/66 (9%)

Query: 294 VEQNENWQFRMVDSSGKEFEKLSASKNYGCGLINLGNSCYLNSVIQSLVN-GGVPNWSLD 352
            +Q  N   R++ + G EF           GL+N G +CY N+ +Q++++   + ++  D
Sbjct: 382 ADQGSNLPSRIIKNWGPEFANRKPK-----GLLNHGVTCYTNAAVQAMLHIPAIQHYLFD 436

Query: 353 FLGSKF 358
            L  K+
Sbjct: 437 ILRGKY 442

>Scas_715.2
          Length = 717

 Score = 36.6 bits (83), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 13/41 (31%), Positives = 23/41 (56%), Gaps = 3/41 (7%)

Query: 720 YALTAVICHKGNSVHSGHYVVFIRKLVADKWKWVLYNDEKL 760
           Y L+ ++ H G+    GHYV   +    +K+ W+ Y+DE +
Sbjct: 565 YELSGIVIHVGDGPQMGHYVALCK---TEKYGWLFYDDETV 602

 Score = 35.8 bits (81), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 32/64 (50%), Gaps = 10/64 (15%)

Query: 324 GLINLGNSCYLNSVIQSLVNGGVPNWSLDFLGSKFPLDVVYPDNNLKCQWIKLLNAMKCE 383
           G  N GN+CY NSV+Q L N  +P + L+ L         YP+ NL  Q ++ L     +
Sbjct: 127 GYENFGNTCYCNSVLQCLYN--LPEFRLNILQ--------YPERNLMDQRVRKLEMPGYK 176

Query: 384 PELY 387
           P  +
Sbjct: 177 PRCF 180

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 22/95 (23%), Positives = 45/95 (47%), Gaps = 7/95 (7%)

Query: 442 NDLVRFMMEDRLQCNICGKVKYSYEPTEAIQIPLEENDEPQDMLERIKAYFEGQTI---- 497
           N++ +  + ++++C  C  V    E    + I ++EN +    ++R+  Y+  + +    
Sbjct: 438 NEIFQGTLTNKVRCLTCDNVTSREEAFLDLPIEVKENGDTD--IQRVLKYYSQREMLNGS 495

Query: 498 -EFKCANCKEKVTANKKPGFKSLPQTLILNPIRIR 531
            +F C+ C     A +    K LP TLIL+  R +
Sbjct: 496 NKFNCSQCCALQEAERAVELKKLPDTLILHLKRFK 530

>AGR370W [4681] [Homologous to ScYER098W (UBP9) - SH; ScYBL067C
           (UBP13) - SH] complement(1416093..1418315) [2223 bp, 740
           aa]
          Length = 740

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 28/55 (50%), Gaps = 5/55 (9%)

Query: 714 YSTAKPYALTAVICHKGNSVHSGHYVVFIRKLVADKWKWVLYNDEKL--VAADSI 766
           ++  K Y L  ++ H G     GHYV   +  +   + W+LY+DE +  V  D++
Sbjct: 586 HAVCKDYELNGIVIHMGGGPQHGHYVAICKHEL---FGWLLYDDETVESVGEDAV 637

 Score = 30.4 bits (67), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 13/20 (65%), Positives = 15/20 (75%)

Query: 324 GLINLGNSCYLNSVIQSLVN 343
           GL N GN+CY NSV+Q L N
Sbjct: 100 GLENYGNTCYCNSVLQCLYN 119

>YER144C (UBP5) [1573] chr5 complement(457801..460218)
           Ubiquitin-specific protease (ubiquitin C-terminal
           hydrolase), homologous to Doa4p and human Tre-2 [2418
           bp, 805 aa]
          Length = 805

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 53/255 (20%), Positives = 96/255 (37%), Gaps = 52/255 (20%)

Query: 324 GLINLGNSCYLNSVIQSLVNGGVPNWSLDFLGSKFPLDVVYPDNN------LKCQWIKLL 377
           GL N+GN CY+N ++Q LV  G  +    FL + + L+ +  D++      L   +  L+
Sbjct: 447 GLENIGNCCYMNCILQCLV--GTHDLVRMFLDNTY-LNFINFDSSRGSKGLLAKNFAILV 503

Query: 378 NAMKCEPELYPNGIK-----PTTFKKCIGQNHQEFSSNRQQDAME--------------- 417
           N M       P  ++        FKK  G  +  +S + QQD  E               
Sbjct: 504 NNMHRHGAFTPPNVRTIPVQTIQFKKICGHINPMYSDSMQQDCQEFCQFLLDGLHEDLNQ 563

Query: 418 --XXXXXXXXXXXXXXXXXXXGIPNPNDL--VRFMMED--------------RLQCNICG 459
                                 I   + L   RF++ D              RLQC +C 
Sbjct: 564 NGSKKHLKQLSDEEERMREKMSIRKASALEWERFLLTDFSAIIDLFQGQYASRLQCQVCE 623

Query: 460 KVKYSYEPTEAIQIPLEENDEPQDMLERIKAYFEGQTI----EFKCANCKEKVTANKKPG 515
               +Y+    + +P+    +  ++L+  + + + + +    ++ C  C +K  + K+  
Sbjct: 624 HTSTTYQTFSVLSVPVPR-VKTCNILDCFREFTKCERLGVDEQWSCPKCLKKQPSTKQLK 682

Query: 516 FKSLPQTLILNPIRI 530
              LP+ LI+N  R 
Sbjct: 683 ITRLPKKLIINLKRF 697

>Kwal_27.11444
          Length = 757

 Score = 35.4 bits (80), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 19/23 (82%)

Query: 321 YGCGLINLGNSCYLNSVIQSLVN 343
           Y  GLIN GN+C++NSVIQSL +
Sbjct: 96  YVGGLINDGNTCFMNSVIQSLAS 118

>CAGL0L01639g 176107..179550 similar to sp|P39538 Saccharomyces
           cerevisiae YJL197w UBP12 ubiquitin C-terminal hydrolase,
           hypothetical start
          Length = 1147

 Score = 35.4 bits (80), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 31/104 (29%), Positives = 46/104 (44%), Gaps = 13/104 (12%)

Query: 323 CGLINLGNSCYLNSVIQSLVNGGVPNWSLDFLGSKFPLDVVYPDNNLKC---------QW 373
            GL NLGN+CY+NS +Q LV+  +P     F    +  ++   DN L             
Sbjct: 289 VGLSNLGNTCYMNSGLQCLVH--IPKLRDYFFYGGYEQEINL-DNPLGYNGTVATAFGNL 345

Query: 374 IKLLNAMKCEPELYPNGIKPTTFKKCIGQNHQEFSSNRQQDAME 417
           I+ L +     + Y     P  FK  +GQ +  F+   QQD+ E
Sbjct: 346 IQNLYSYHWNQQQY-QSYSPNRFKMTLGQANSMFAGYMQQDSQE 388

>Sklu_2079.3 YDL122W, Contig c2079 1528-3903 reverse complement
          Length = 791

 Score = 35.4 bits (80), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 22/31 (70%)

Query: 313 EKLSASKNYGCGLINLGNSCYLNSVIQSLVN 343
           E++     Y  GL+N GN+C++NSV+QSL +
Sbjct: 90  ERVLKKGGYVGGLVNDGNTCFMNSVLQSLAS 120

>CAGL0J11352g complement(1101349..1103664) similar to sp|P53874
           Saccharomyces cerevisiae YNL186w UBP10, start by
           similarity
          Length = 771

 Score = 35.0 bits (79), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 22/39 (56%), Gaps = 3/39 (7%)

Query: 720 YALTAVICHKGNSVHSGHYVVFIRKLVADKWKWVLYNDE 758
           Y L +V+ H+G S+ SGHY+   ++       W  Y+DE
Sbjct: 662 YELLSVVVHEGRSLSSGHYIAHCKQPDGS---WATYDDE 697

>KLLA0D08459g complement(718046..720298) some similarities with
           sp|P53874 Saccharomyces cerevisiae YNL186w UBP10
           derepression of telomeric silencing, hypothetical start
          Length = 750

 Score = 34.7 bits (78), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 22/39 (56%), Gaps = 3/39 (7%)

Query: 720 YALTAVICHKGNSVHSGHYVVFIRKLVADKWKWVLYNDE 758
           Y L +V+ H+G S+ SGHY+   ++       W  Y+DE
Sbjct: 639 YQLISVVVHEGRSLSSGHYIAHCKQ---PDGSWATYDDE 674

>ABL145W [447] [Homologous to ScYNL186W (UBP10) - SH]
           complement(124841..127090) [2250 bp, 749 aa]
          Length = 749

 Score = 34.7 bits (78), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 22/39 (56%), Gaps = 3/39 (7%)

Query: 720 YALTAVICHKGNSVHSGHYVVFIRKLVADKWKWVLYNDE 758
           Y L +V+ H+G S+ SGHY+   ++       W  Y+DE
Sbjct: 638 YQLISVVVHEGRSLSSGHYIAHCKQ---PDGTWATYDDE 673

>Scas_692.39
          Length = 466

 Score = 34.7 bits (78), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 39/174 (22%), Positives = 73/174 (41%), Gaps = 44/174 (25%)

Query: 179 IPSKPENTVNLNQCSSCDLTQNLWLCLHCGNIGCGREQIGIDGHSHALDHYRSNNNHPLA 238
           I  K  +T+  +QC   +   + ++CL C  +GC          SH + H +    H   
Sbjct: 37  IKEKLLHTMKCSQCQEIN-AGSTFMCLQCDFVGCWNG-------SHFITHMK-RFGHVFG 87

Query: 239 IKLGSLSSSTYDLYCYACDDETRFPDNVNLGSALQIYGINIQEKIADEKTLVQLQVEQNE 298
           I     +SS   L+C+ C D     + +N  S L  Y  +I  K         +  ++  
Sbjct: 88  I-----NSSNGLLFCFKCMDYIGHLETINY-SMLNKYWDDISTKTT-------IPSQERR 134

Query: 299 NWQFRMVDSSGKEFEKLSASKNYGCGLINLGNSCYLNSVIQSLV-NGGVPNWSL 351
           +  F                     GL+N+G++C+++S++Q+L+ N  + N+S+
Sbjct: 135 DGLF---------------------GLVNMGSTCFMSSILQALIHNPYIVNYSM 167

>Kwal_33.14430
          Length = 511

 Score = 34.3 bits (77), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 26/46 (56%), Gaps = 5/46 (10%)

Query: 715 STAKP--YALTAVICHKGNSVHSGHYVVFIRKLVADKWKWVLYNDE 758
           +TA P  Y L +V+ H+G S+ SGHY+   ++       W  Y+DE
Sbjct: 388 ATALPVKYQLISVVVHEGRSLSSGHYIAHCKQ---PDGSWSTYDDE 430

>YNL186W (UBP10) [4415] chr14 (289498..291876) Ubiquitin C-terminal
           hydrolase, involved in telomeric silencing [2379 bp, 792
           aa]
          Length = 792

 Score = 34.7 bits (78), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 22/39 (56%), Gaps = 3/39 (7%)

Query: 720 YALTAVICHKGNSVHSGHYVVFIRKLVADKWKWVLYNDE 758
           Y L +V+ H+G S+ SGHY+   ++       W  Y+DE
Sbjct: 674 YQLLSVVVHEGRSLSSGHYIAHCKQ---PDGSWATYDDE 709

>Sklu_1544.2 YMR223W, Contig c1544 592-1956 reverse complement
          Length = 454

 Score = 33.9 bits (76), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 41/161 (25%), Positives = 67/161 (41%), Gaps = 53/161 (32%)

Query: 202 WLCLHCGNIGCGREQIGIDGHSHALDHYRSNNNHPL--AIKLG---SLSSSTYDLYCYAC 256
           ++C+ CG  GC                   NNNH +  + K+G    L+SS   L+C+ C
Sbjct: 57  FMCVQCGFCGCW------------------NNNHFMIHSKKVGHIFGLNSSNGLLFCFKC 98

Query: 257 DDETRFPDNVNLGSALQIYGINIQEKIADEKTLVQLQVEQNENWQFRMVDSSGKEFEKLS 316
            D                        I D + +    +  N+ W      SS    EK  
Sbjct: 99  SDY-----------------------IGDNELVACAPL--NKVWDGVSTKSSIPSVEK-- 131

Query: 317 ASKNYGCGLINLGNSCYLNSVIQSLV-NGGVPNWSLDFLGS 356
             +N   GL+N+G++C+++S+IQ+L+ N  +   S+D L S
Sbjct: 132 --RNGLAGLVNMGSTCFMSSIIQTLIHNPYILKHSMDQLHS 170

>CAGL0K10252g complement(997315..1001118) similar to sp|Q01476
            Saccharomyces cerevisiae YOR124c UBP2 ubiquitin-specific
            proteinase, hypothetical start
          Length = 1267

 Score = 33.9 bits (76), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 23/42 (54%), Gaps = 3/42 (7%)

Query: 716  TAKPYALTAVICHKGNSVHSGHYVVFIRKLVADKWKWVLYND 757
            T   Y L AV  H+G + + GHY V+I+  V   W+   YND
Sbjct: 1183 TEHGYTLFAVFIHRGEASY-GHYWVYIKDFVNSIWRK--YND 1221

 Score = 33.9 bits (76), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 31/52 (59%), Gaps = 1/52 (1%)

Query: 288 TLVQLQVEQNENWQFRMVDSSGKEFEKLSASKNYGCGLINLGNSCYLNSVIQ 339
            L ++ +E+N N     +++       L A +N+  G+ N+GN+CYLNS++Q
Sbjct: 688 ALTKIALERNSNLLLNFLETGNINPNSLPA-ENWPTGINNIGNTCYLNSLLQ 738

>CAGL0H05335g complement(512683..514134) weakly similar to sp|Q02863
           Saccharomyces cerevisiae YPL072w UBP16, hypothetical
           start
          Length = 483

 Score = 33.5 bits (75), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 14/21 (66%), Positives = 16/21 (76%)

Query: 321 YGCGLINLGNSCYLNSVIQSL 341
           Y  GL+N GN CY NSVIQ+L
Sbjct: 70  YTTGLVNKGNYCYANSVIQAL 90

>AGR389C [4700] [Homologous to ScYDL122W (UBP1) - SH]
           (1443891..1446218) [2328 bp, 775 aa]
          Length = 775

 Score = 33.9 bits (76), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 13/20 (65%), Positives = 18/20 (90%)

Query: 324 GLINLGNSCYLNSVIQSLVN 343
           GL+N GN+C++NSVIQSL +
Sbjct: 89  GLVNDGNTCFINSVIQSLAS 108

>CAGL0H10582g complement(1029876..1032248) similar to sp|P25037
           Saccharomyces cerevisiae YDL122w UBP1 ubiquitin-specific
           protease, hypothetical start
          Length = 790

 Score = 33.5 bits (75), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 21/31 (67%)

Query: 313 EKLSASKNYGCGLINLGNSCYLNSVIQSLVN 343
           E++     Y  GL+N GN C++NSVIQSL +
Sbjct: 86  EQILQRGGYVGGLLNDGNFCFMNSVIQSLAS 116

>YDL122W (UBP1) [748] chr4 (242552..244981) Ubiquitin-specific
           protease (ubiquitin C-terminal hydrolase), cleaves at
           the C-terminus of ubiquitin [2430 bp, 809 aa]
          Length = 809

 Score = 33.5 bits (75), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 21/30 (70%)

Query: 313 EKLSASKNYGCGLINLGNSCYLNSVIQSLV 342
           E++     +  GL+N GN+C++NSV+QSL 
Sbjct: 91  EEILKRGGFIAGLVNDGNTCFMNSVLQSLA 120

>Kwal_55.21267
          Length = 604

 Score = 33.5 bits (75), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 25/39 (64%)

Query: 650 VDEVSLTSMLSMGLNPNLCRKALILNNGDVNRSVEWVFN 688
           + E ++ S+L MG+  ++  +AL   NGDV  SV ++F+
Sbjct: 1   MSESAIKSLLDMGITRDVAIEALSKTNGDVENSVNYIFS 39

>Scas_695.7
          Length = 482

 Score = 33.1 bits (74), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 13/20 (65%), Positives = 18/20 (90%)

Query: 324 GLINLGNSCYLNSVIQSLVN 343
           GLIN GNSC++NSV+Q+L +
Sbjct: 28  GLINNGNSCFMNSVLQALAS 47

>Kwal_55.21393
          Length = 1233

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 12/22 (54%), Positives = 19/22 (86%)

Query: 318 SKNYGCGLINLGNSCYLNSVIQ 339
           ++N+  GL N+GN+CYLNS++Q
Sbjct: 698 ARNWPTGLNNIGNTCYLNSLLQ 719

>Sklu_2425.8 YER098W, Contig c2425 12113-14377 reverse complement
          Length = 754

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 35/152 (23%), Positives = 60/152 (39%), Gaps = 13/152 (8%)

Query: 391 IKPTTFKKCIGQNHQEFSSNRQQDAME-XXXXXXXXXXXXXXXXXXXGIPNPND-----L 444
           + PT+F + + + +  FS+   QDA E                     I  PND     L
Sbjct: 421 VSPTSFVEILKRENVLFSTMMHQDAHEFLNFLLNELSDSLQRQISDDSIITPNDNFIDRL 480

Query: 445 VRFMMEDRLQCNICGKVKYSYEPTEAIQIPLEENDEPQ-DMLERIKAYFEGQTI----EF 499
            +  M ++ +C  C  +    EP   +  P+E N   + D+ E +  + + + +    +F
Sbjct: 481 FKGTMTNQTKCLTCDNITSRDEP--FLDFPIEVNGNCETDIQEMLSDFHQKEMLNGSNKF 538

Query: 500 KCANCKEKVTANKKPGFKSLPQTLILNPIRIR 531
            C  C     A +  G K LP  L L+  R +
Sbjct: 539 YCDKCCGLQEAERIVGLKQLPHILALHLKRFK 570

>CAGL0I06765g 655806..658469 similar to sp|P32571 Saccharomyces
           cerevisiae YDR069c DOA4 ubiquitin-specific protease,
           hypothetical start
          Length = 887

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 20/92 (21%), Positives = 44/92 (47%), Gaps = 5/92 (5%)

Query: 443 DLVRFMMEDRLQCNICGKVKYSYEPTEAIQIPLEENDEPQDMLERIKAYFEGQTIEFK-- 500
           DL +     +L+C +C +   +Y+    + +P+  + +   +L+    + + + +E    
Sbjct: 686 DLFQGQYASQLRCKVCNRTSTTYQAFSVLSVPVP-SGKSCGLLDCFIEFTKTENLEVDEQ 744

Query: 501 --CANCKEKVTANKKPGFKSLPQTLILNPIRI 530
             C +CK+K  + KK     LP+ LI++  R 
Sbjct: 745 WFCPSCKKKQPSTKKLTITRLPRNLIIHLKRF 776

 Score = 30.8 bits (68), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 11/20 (55%), Positives = 16/20 (80%)

Query: 320 NYGCGLINLGNSCYLNSVIQ 339
           ++  GL N+GNSCY+N +IQ
Sbjct: 522 SFTVGLENMGNSCYINCIIQ 541

>KLLA0E01848g complement(175162..176991) some similarities with
           sp|P50875 Saccharomyces cerevisiae YOL148c SPT20 member
           of the TBP class of SPT proteins that alter
           transcription site selection singleton, hypothetical
           start
          Length = 609

 Score = 32.3 bits (72), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 33/70 (47%), Gaps = 20/70 (28%)

Query: 249 YDLYCYACDDETRFPD----------------NVNLGSALQIYGINIQEKIADEKTLVQL 292
           YD+  YA  D TRFPD                N+NL + L  Y    +E ++DE+ L  +
Sbjct: 308 YDMLSYA--DHTRFPDSMYQQLESEILTLTKRNLNLDTPLNPY--THKEYVSDEEFLEPV 363

Query: 293 QVEQNENWQF 302
             E+ + W+F
Sbjct: 364 YEEEKQKWEF 373

>Scas_555.6
          Length = 917

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 23/52 (44%), Gaps = 7/52 (13%)

Query: 720 YALTAVICHKGNSVHSGHYVVFIRKLVADKWKWV-------LYNDEKLVAAD 764
           Y LT VI H G+S   GHY   +     +KW  +       L ND  L A D
Sbjct: 849 YKLTGVIYHHGSSPDGGHYTADVFHQQTNKWYRIDDVNISELKNDHVLDADD 900

>CAGL0G02563g complement(235498..237393) weakly similar to sp|P36026
           Saccharomyces cerevisiae YKR098c UBP11 ubiquitin
           C-terminal hydrolase, hypothetical start
          Length = 631

 Score = 32.3 bits (72), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 23/37 (62%), Gaps = 2/37 (5%)

Query: 324 GLINLGNSCYLNSVIQSLVNGGVPNWSLDFLGSKFPL 360
           G+ N+GN+CY+NS++Q L   G   +   FL  KF +
Sbjct: 214 GIRNMGNTCYMNSMLQCLF--GSTQFRDLFLTDKFEM 248

>Scas_698.7
          Length = 1030

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 23/44 (52%), Gaps = 7/44 (15%)

Query: 323 CGLINLGNSCYLNSVIQSLVNGG-------VPNWSLDFLGSKFP 359
            GL NLGN+CY+NS++Q L              +S    GSKFP
Sbjct: 608 TGLRNLGNTCYINSMLQCLFATRRFRDLFLTSKYSSFLNGSKFP 651

>KLLA0E08767g 784991..787306 similar to sp|P25037 Saccharomyces
           cerevisiae YDL122w UBP1 ubiquitin-specific protease
           singleton, start by similarity
          Length = 771

 Score = 32.0 bits (71), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 24/41 (58%)

Query: 303 RMVDSSGKEFEKLSASKNYGCGLINLGNSCYLNSVIQSLVN 343
           R    + ++ E +     Y  GL+N GN+C++NSV+Q L +
Sbjct: 64  RWAPRNAEQEETIVRRGGYVGGLVNDGNTCFMNSVLQCLAS 104

>KLLA0E00979g 104991..107315 some similarities with sp|Q01477
           Saccharomyces cerevisiae YER151c UBP3 ubiquitin-specific
           proteinase singleton, hypothetical start
          Length = 774

 Score = 32.0 bits (71), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 24/100 (24%), Positives = 50/100 (50%), Gaps = 11/100 (11%)

Query: 121 NGENVPRTVLSKSTDSDISSTALEKI-EKILKAKSQDFEDKKNSWVLEISTCPHTENFQI 179
           NGE +P+T ++ S + +  S + EK+ EK+L  KS +++   +       T P   N   
Sbjct: 193 NGEPIPKTEVNSSKEVESISASEEKVEEKVL--KSTEYQTSSD------PTAPPRSNTAS 244

Query: 180 PSKPENTVNLNQCSSCDLTQNLWLCLHCGNIGCGREQIGI 219
           P+  +++V+     +  +    W  L  G++G  ++Q+ +
Sbjct: 245 PTPTKSSVSPKPAQTLPVKS--WSKLAAGSLGKPKQQLAV 282

>AGR139C [4450] [Homologous to ScYER151C (UBP3) - SH]
           (1010466..1012835) [2370 bp, 789 aa]
          Length = 789

 Score = 31.6 bits (70), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 15/31 (48%)

Query: 720 YALTAVICHKGNSVHSGHYVVFIRKLVADKW 750
           Y LT V+ H G S   GHY   +     DKW
Sbjct: 723 YRLTGVVYHHGLSPSGGHYTADVLHQTQDKW 753

>KLLA0E08679g 777005..778795 some similarities with sp|P53968
           Saccharomyces cerevisiae YNL027w CRZ1 calcineurin
           responsive zinc-finger, hypothetical start
          Length = 596

 Score = 31.6 bits (70), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 26/68 (38%), Gaps = 5/68 (7%)

Query: 12  PAVVSKDECIYCFESPYNEPLALNASPKHSLNICLNCFQATC-----NRHVPLHIRVTEY 66
           PAV + D C   F  PYN    L +       +C  C +A       NRH  LH     Y
Sbjct: 466 PAVYACDICDKKFTRPYNLKSHLRSHTDERPYVCSVCGKAFARMHDKNRHEDLHTGKRRY 525

Query: 67  ACDTIHSN 74
            C  I  N
Sbjct: 526 VCGGILKN 533

>Kwal_55.19645
          Length = 970

 Score = 31.6 bits (70), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 24/37 (64%), Gaps = 5/37 (13%)

Query: 305 VDSSGKEFEKLSASKNYGCGLINLGNSCYLNSVIQSL 341
           ++ S  E+  LS +     GL N+GN+CY+NS++Q L
Sbjct: 543 IEQSSNEYVALSIT-----GLRNMGNTCYINSMLQCL 574

>Scas_721.100
          Length = 1137

 Score = 31.6 bits (70), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 20/28 (71%), Gaps = 3/28 (10%)

Query: 488 IKAYFE---GQTIEFKCANCKEKVTANK 512
           I+ YFE   G+ +E KC NC+E++ +N+
Sbjct: 911 IEEYFEFQAGKNLELKCPNCREQINSNR 938

>Sklu_2418.6 YBL047C, Contig c2418 10006-13899 reverse complement
          Length = 1297

 Score = 31.2 bits (69), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 23/40 (57%), Gaps = 1/40 (2%)

Query: 585  TPNQCSISQLIEMGFTQNASVRALFNTGNQDAESAMNWLF 624
            TP   ++ +L  MGFTQ  + +AL    N D E+A N+L 
Sbjct: 1256 TPKSLAVEELSSMGFTQEEATKAL-EQCNWDLEAATNYLL 1294

>CAGL0H06721g complement(667816..671061) similar to sp|P40453
           Saccharomyces cerevisiae YIL156w UBP7, hypothetical
           start
          Length = 1081

 Score = 31.2 bits (69), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 16/19 (84%)

Query: 323 CGLINLGNSCYLNSVIQSL 341
            GL NLGN+CY+N ++QSL
Sbjct: 648 TGLRNLGNTCYINCMLQSL 666

>Scas_714.11
          Length = 1269

 Score = 31.2 bits (69), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 11/21 (52%), Positives = 18/21 (85%)

Query: 319 KNYGCGLINLGNSCYLNSVIQ 339
           K++  G+ N+GN+CYLNS++Q
Sbjct: 709 KDWPAGINNIGNTCYLNSLLQ 729

>KLLA0E20449g 1810593..1812686 weakly similar to sp|P39967
           Saccharomyces cerevisiae YER098w UBP9 ubiquitin
           carboxyl-terminal hydrolase, start by similarity
          Length = 697

 Score = 30.8 bits (68), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 42/93 (45%), Gaps = 5/93 (5%)

Query: 443 DLVRFMMEDRLQCNICGKVKYSYEPTEAIQIPLEENDEP--QDMLERIK--AYFEGQTIE 498
           DL +  + +  +C  C  +    EP     I ++E++E   QD+L   K      G   +
Sbjct: 438 DLFKGSLCNSTKCFTCDTITARDEPFLDFPIEIQEDEEIKIQDILNNYKHRELLTGAN-K 496

Query: 499 FKCANCKEKVTANKKPGFKSLPQTLILNPIRIR 531
           F C  C     A +  G KSLP+TL ++  R +
Sbjct: 497 FYCDKCCGLQEAERTVGLKSLPKTLAIHLKRFK 529

>YOR124C (UBP2) [4926] chr15 complement(554824..558642)
           Ubiquitin-specific protease (ubiquitin C-terminal
           hydrolase), cleaves at the C-terminus of ubiquitin [3819
           bp, 1272 aa]
          Length = 1272

 Score = 30.8 bits (68), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 11/21 (52%), Positives = 18/21 (85%)

Query: 319 KNYGCGLINLGNSCYLNSVIQ 339
           +N+  G+ N+GN+CYLNS++Q
Sbjct: 732 ENWPTGINNIGNTCYLNSLLQ 752

>Scas_664.17
          Length = 494

 Score = 30.4 bits (67), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 12/22 (54%), Positives = 17/22 (77%)

Query: 321 YGCGLINLGNSCYLNSVIQSLV 342
           +  GL+N GN C++NS IQ+LV
Sbjct: 74  FTTGLVNPGNDCFINSSIQALV 95

>ACL164C [885] [Homologous to ScYOR124C (UBP2) - SH] (67792..71961)
           [4170 bp, 1389 aa]
          Length = 1389

 Score = 30.8 bits (68), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 11/22 (50%), Positives = 18/22 (81%)

Query: 318 SKNYGCGLINLGNSCYLNSVIQ 339
           + N+  G+ N+GN+CYLNS++Q
Sbjct: 672 AGNWPTGINNIGNTCYLNSLLQ 693

>Kwal_27.12129
          Length = 2333

 Score = 30.8 bits (68), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 43/89 (48%), Gaps = 10/89 (11%)

Query: 222  HSHALDHYRSNNNHPLAIKLGSLS-----SSTYDLYCYACDDETRFPDNVNLGSALQIYG 276
            H HALD   S  ++ LA+ LGSL      S   D+Y +   +E + P++ N   ++ +  
Sbjct: 1258 HLHALDFALSQGDYALALILGSLLGKEKWSEVVDIYLH---EEFQSPNDGNSSFSVNMLA 1314

Query: 277  INIQEKIADEKTLVQ--LQVEQNENWQFR 303
            +  Q  + + K +++  +     ENW  +
Sbjct: 1315 LIFQVSVGNSKRVIKGLISDPSKENWAMQ 1343

>CAGL0F04609g 463702..467637 similar to sp|P34216 Saccharomyces
            cerevisiae YBL047c, start by similarity
          Length = 1311

 Score = 30.4 bits (67), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 24/40 (60%), Gaps = 1/40 (2%)

Query: 585  TPNQCSISQLIEMGFTQNASVRALFNTGNQDAESAMNWLF 624
            TP   ++ +L+ MGF ++ +V+AL    N D E+A N L 
Sbjct: 1270 TPKSLAVEELMGMGFKEDEAVKAL-EKSNWDLETATNLLL 1308

>Scas_623.2*
          Length = 795

 Score = 30.0 bits (66), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 30/105 (28%), Positives = 47/105 (44%), Gaps = 14/105 (13%)

Query: 324 GLINLGNSCYLNSVIQSLVNGGVPNWSLDFLGSKFPLDVVYPDNNLKCQWI------KLL 377
           GL N+ NSCY+N +IQ L++  VP      L + F L  +  ++ L  + +      KL+
Sbjct: 430 GLENMSNSCYMNCIIQCLLS--VPELIQICLNNSF-LKHINMESKLGSKGVIMKHFAKLI 486

Query: 378 NAM-----KCEPELYPNGIKPTTFKKCIGQNHQEFSSNRQQDAME 417
             M     K    L+   +K   FK         +S ++QQD  E
Sbjct: 487 QDMHSQQVKTGRSLFSYPVKTIDFKNACASVSSIYSGSQQQDCQE 531

>Sklu_1489.1 YGR218W, Contig c1489 219-3473 reverse complement
          Length = 1084

 Score = 30.0 bits (66), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 34/68 (50%), Gaps = 11/68 (16%)

Query: 437 GIPNPNDLVRFMMEDRLQCNICGKVKY-----SYEPTEAIQIPLEENDEPQDMLERIKAY 491
           G PNP  L RF ++  +  NIC ++++        P E + +   ENDE + + E +K  
Sbjct: 403 GAPNPEFLRRFPLKKHIYDNICSQLRWVIIESMVRPEEVLIV---ENDEGEIVREFVK-- 457

Query: 492 FEGQTIEF 499
            E  TI+ 
Sbjct: 458 -ESDTIQL 464

>CAGL0M11198g 1101217..1102602 similar to sp|P50102 Saccharomyces
           cerevisiae YMR223w UBP8, start by similarity
          Length = 461

 Score = 30.0 bits (66), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 8/20 (40%), Positives = 19/20 (95%)

Query: 324 GLINLGNSCYLNSVIQSLVN 343
           GL+N+G++CY++S++Q +++
Sbjct: 138 GLVNMGSTCYMSSIMQCIIH 157

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.133    0.407 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 26,289,552
Number of extensions: 1170131
Number of successful extensions: 3555
Number of sequences better than 10.0: 92
Number of HSP's gapped: 3562
Number of HSP's successfully gapped: 126
Length of query: 767
Length of database: 16,596,109
Length adjustment: 109
Effective length of query: 658
Effective length of database: 12,822,747
Effective search space: 8437367526
Effective search space used: 8437367526
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 66 (30.0 bits)