Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YBR057C (MUM2)36636016650.0
ABL103W3171745169e-63
Kwal_56.230803141614942e-59
KLLA0F18722g2701634683e-56
CAGL0H10164g4841684242e-47
Scas_718.502361632938e-31
Scas_661.252251572734e-28
Scas_720.6561765750.30
Kwal_56.23638492275673.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YBR057C
         (360 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YBR057C (MUM2) [247] chr2 complement(352153..353253) Protein req...   645   0.0  
ABL103W [489] [Homologous to ScYBR057C (MUM2) - SH] complement(2...   203   9e-63
Kwal_56.23080                                                         194   2e-59
KLLA0F18722g 1721734..1722546 weakly similar to sp|P38236 Saccha...   184   3e-56
CAGL0H10164g complement(991125..992579) weakly similar to sp|P38...   167   2e-47
Scas_718.50                                                           117   8e-31
Scas_661.25                                                           109   4e-28
Scas_720.65                                                            33   0.30 
Kwal_56.23638                                                          30   3.2  

>YBR057C (MUM2) [247] chr2 complement(352153..353253) Protein
           required for premeiotic DNA synthesis and sporulation
           [1101 bp, 366 aa]
          Length = 366

 Score =  645 bits (1665), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/360 (89%), Positives = 321/360 (89%)

Query: 1   MNYMAYDYDPQHSLETSFNNLAFHPHQQSQQQALYESGERNDARPGLMNTLGQASKMNNS 60
           MNYMAYDYDPQHSLETSFNNLAFHPHQQSQQQALYESGERNDARPGLMNTLGQASKMNNS
Sbjct: 1   MNYMAYDYDPQHSLETSFNNLAFHPHQQSQQQALYESGERNDARPGLMNTLGQASKMNNS 60

Query: 61  MLPQGSSASPLTGQHSLNSTTNFNMPPSMNTYNYQNVPQASMRNTLNHNNIMNGATANDY 120
           MLPQGSSASPLTGQHSLNSTTNFNMPPSMNTYNYQNVPQASMRNTLNHNNIMNGATANDY
Sbjct: 61  MLPQGSSASPLTGQHSLNSTTNFNMPPSMNTYNYQNVPQASMRNTLNHNNIMNGATANDY 120

Query: 121 WLXXXXXXXXXXXXXXXXXXXXXXXXXXTAKTSINSTAFKNSFVPFNHVTALXXXXXXXX 180
           WL                          TAKTSINSTAFKNSFVPFNHVTAL        
Sbjct: 121 WLDPMNNMTNNKDTNGNPNDSMSSMSNMTAKTSINSTAFKNSFVPFNHVTALSMNNVNSN 180

Query: 181 XXXXXKDDRMEALEVELQIKESQIESLENEIQRLKKIFNEGLNYKQNEHKYEKENCHIPQ 240
                KDDRMEALEVELQIKESQIESLENEIQRLKKIFNEGLNYKQNEHKYEKENCHIPQ
Sbjct: 181 EMNSNKDDRMEALEVELQIKESQIESLENEIQRLKKIFNEGLNYKQNEHKYEKENCHIPQ 240

Query: 241 TFELPASLEVIFRKLSSSLHAKEKELAETKENLESILTALALNPTNSVTKYGRYDAESIA 300
           TFELPASLEVIFRKLSSSLHAKEKELAETKENLESILTALALNPTNSVTKYGRYDAESIA
Sbjct: 241 TFELPASLEVIFRKLSSSLHAKEKELAETKENLESILTALALNPTNSVTKYGRYDAESIA 300

Query: 301 HKMVVRLENLTNENKEMAKMLAYGRSKETQIELQLAKKENLELREKIASLEAHLASKESS 360
           HKMVVRLENLTNENKEMAKMLAYGRSKETQIELQLAKKENLELREKIASLEAHLASKESS
Sbjct: 301 HKMVVRLENLTNENKEMAKMLAYGRSKETQIELQLAKKENLELREKIASLEAHLASKESS 360

>ABL103W [489] [Homologous to ScYBR057C (MUM2) - SH]
           complement(205068..206021) [954 bp, 317 aa]
          Length = 317

 Score =  203 bits (516), Expect = 9e-63,   Method: Compositional matrix adjust.
 Identities = 100/174 (57%), Positives = 136/174 (78%), Gaps = 10/174 (5%)

Query: 190 MEALEVELQIKESQIESLENEIQRLKKIFNEGLNYKQNEHKYEKENCH--------IPQT 241
           ME+L +ELQ+KE+QIESLE+EI +LK IFN+GL +KQ E + +K   H        +P  
Sbjct: 140 MESLRLELQLKETQIESLEDEITKLKSIFNQGLTFKQQEQQLQKRKLHQHALDLDHMP-- 197

Query: 242 FELPASLEVIFRKLSSSLHAKEKELAETKENLESILTALALNPTNSVTKYGRYDAESIAH 301
            E+PA+LE+IF KL++SL  K++EL +T++ LESI+TA+ALNP+NSVT++GRYD E++AH
Sbjct: 198 VEIPANLEIIFNKLATSLKRKDEELEDTRKRLESIMTAIALNPSNSVTRFGRYDEEALAH 257

Query: 302 KMVVRLENLTNENKEMAKMLAYGRSKETQIELQLAKKENLELREKIASLEAHLA 355
           KM+VRLE LT EN+EMAK+L+YGRSKET IEL+L KK N +L+ K+  LE  LA
Sbjct: 258 KMIVRLEMLTKENQEMAKLLSYGRSKETHIELELLKKVNRDLQRKVEQLEKQLA 311

>Kwal_56.23080
          Length = 314

 Score =  194 bits (494), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 99/161 (61%), Positives = 127/161 (78%)

Query: 191 EALEVELQIKESQIESLENEIQRLKKIFNEGLNYKQNEHKYEKENCHIPQTFELPASLEV 250
           E++++ELQ+KE+QIESLE EIQ LK IFN+GL  +Q           I  + E+PASLE 
Sbjct: 148 ESMQLELQLKETQIESLEVEIQSLKLIFNDGLRLRQEHDLRALSGPAINASVEVPASLEA 207

Query: 251 IFRKLSSSLHAKEKELAETKENLESILTALALNPTNSVTKYGRYDAESIAHKMVVRLENL 310
           IF+KLSS+L  K+KEL ETK+ LESI+TA+ALNP+N+VTK GRYD E++AHKMVVRLE L
Sbjct: 208 IFQKLSSTLATKDKELDETKKRLESIVTAVALNPSNTVTKLGRYDEEALAHKMVVRLETL 267

Query: 311 TNENKEMAKMLAYGRSKETQIELQLAKKENLELREKIASLE 351
           T EN++MAKML YGRSKE  IE++L KKEN EL++K++ LE
Sbjct: 268 TKENQDMAKMLGYGRSKENHIEIELLKKENQELKKKLSQLE 308

>KLLA0F18722g 1721734..1722546 weakly similar to sp|P38236
           Saccharomyces cerevisiae YBR057c MUM2 meiotic protein
           singleton, hypothetical start
          Length = 270

 Score =  184 bits (468), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 95/163 (58%), Positives = 128/163 (78%), Gaps = 6/163 (3%)

Query: 193 LEVELQIKESQIESLENEIQRLKKIFNEGLNYKQNEHKYEKENCHIPQTFE----LPASL 248
            ++ELQ+KE+QIESLE EI++LK++FN+GL +KQ E +  K++  +  TF+    +PASL
Sbjct: 107 FKLELQLKETQIESLEIEIKKLKEVFNQGLTFKQQEEQKMKKSKAL--TFDSEIQIPASL 164

Query: 249 EVIFRKLSSSLHAKEKELAETKENLESILTALALNPTNSVTKYGRYDAESIAHKMVVRLE 308
           E+IF KLS SL  K++EL ETK  LE I+TA+ALNP+NS TK+GRYD E++AHKMV RLE
Sbjct: 165 EIIFCKLSDSLKRKDQELQETKRRLEGIVTAVALNPSNSTTKFGRYDEEALAHKMVTRLE 224

Query: 309 NLTNENKEMAKMLAYGRSKETQIELQLAKKENLELREKIASLE 351
            L  EN+EMAKML+YGR KET IEL+L +KEN EL+E++  L+
Sbjct: 225 TLMKENEEMAKMLSYGRVKETSIELELLRKENQELKERLRILQ 267

>CAGL0H10164g complement(991125..992579) weakly similar to sp|P38236
           Saccharomyces cerevisiae YBR057c MUM2 meiotic protein,
           hypothetical start
          Length = 484

 Score =  167 bits (424), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 84/168 (50%), Positives = 122/168 (72%), Gaps = 2/168 (1%)

Query: 190 MEALEVELQIKESQIESLENEIQRLKKIFNEGL-NYKQNEHKYEKENCHIP-QTFELPAS 247
           ++ L+ ++Q+K++Q++SL+ E+ RLK   +  + N K    K   +  HI  +  ++P S
Sbjct: 313 IDTLKYDIQVKDAQLQSLQRELTRLKSAISVAVDNTKDISSKTADKEEHITTKEIDVPNS 372

Query: 248 LEVIFRKLSSSLHAKEKELAETKENLESILTALALNPTNSVTKYGRYDAESIAHKMVVRL 307
           L++IFRKLSS+L  +EKEL ETK NLES+L A+ALNP+NS TK+GRYD E++AHK VVRL
Sbjct: 373 LDIIFRKLSSALQKREKELDETKTNLESVLAAMALNPSNSSTKFGRYDPENLAHKTVVRL 432

Query: 308 ENLTNENKEMAKMLAYGRSKETQIELQLAKKENLELREKIASLEAHLA 355
           E LT EN+EMA+ML++GR+KE  I L+L KKEN +L+ +I  L+  L 
Sbjct: 433 ETLTKENQEMARMLSFGRAKEKHIALELLKKENKDLKTQIIQLKEKLG 480

>Scas_718.50
          Length = 236

 Score =  117 bits (293), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 76/163 (46%), Positives = 98/163 (60%), Gaps = 17/163 (10%)

Query: 193 LEVELQIKESQIESLENEIQRLKKIF--NEGLNYKQNEHKYEKENCHIPQTFELPASLEV 250
           L+ +L +K+ QIESLENEIQ LKKI   N     K ++ K  K   + P           
Sbjct: 84  LQEKLNVKDIQIESLENEIQNLKKILQLNPNGTRKGDDDKISKH--YGP----------- 130

Query: 251 IFRKLSSSLHAKEKELAETKENLESILTALALN--PTNSVTKYGRYDAESIAHKMVVRLE 308
           IF  L SSL  + +E    K + E +   +A+N   +NS+TK GRYD E+IAHKM++R E
Sbjct: 131 IFTNLVSSLLERNEEYESLKRDYEELYLKVAMNLDGSNSITKDGRYDTETIAHKMLIRFE 190

Query: 309 NLTNENKEMAKMLAYGRSKETQIELQLAKKENLELREKIASLE 351
            LT EN  MAKML+YGR  ET IELQL + EN EL+E+I  LE
Sbjct: 191 MLTKENSRMAKMLSYGRPMETDIELQLVEMENQELKERIKQLE 233

 Score = 37.7 bits (86), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 21/30 (70%)

Query: 1  MNYMAYDYDPQHSLETSFNNLAFHPHQQSQ 30
          MNY  Y +DP  S+ETSF+ ++F+  QQ Q
Sbjct: 1  MNYTNYSFDPNRSMETSFSQMSFNQGQQQQ 30

>Scas_661.25
          Length = 225

 Score =  109 bits (273), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 66/157 (42%), Positives = 98/157 (62%), Gaps = 9/157 (5%)

Query: 197 LQIKESQIESLENEIQRLKKIFNEGLNYKQNEHKYEKENCHIPQTFEL--PASLEVIFRK 254
           L IKE+Q+ SL+ E+  LK I  E +  +Q       ++   P + EL    + E++F +
Sbjct: 69  LSIKETQLSSLQIEMDHLKSILKERVQEQQ-------KSVDDPNSHELLNVTNHELLFTR 121

Query: 255 LSSSLHAKEKELAETKENLESILTALALNPTNSVTKYGRYDAESIAHKMVVRLENLTNEN 314
           L+S L  KE+E+ + +   ES+LTALAL+P N +  YG+ D E I+ KMV +LE LT EN
Sbjct: 122 LNSLLQDKEREIKDIRFKYESMLTALALDPANPMKSYGQLDVEMISQKMVTQLETLTKEN 181

Query: 315 KEMAKMLAYGRSKETQIELQLAKKENLELREKIASLE 351
           +EM+K+L +  SK   IEL L +KEN ELR+++  LE
Sbjct: 182 QEMSKLLNFEVSKSKNIELNLVRKENDELRKRLNQLE 218

>Scas_720.65
          Length = 617

 Score = 33.5 bits (75), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 35/65 (53%), Gaps = 9/65 (13%)

Query: 192 ALEVELQIKESQIESLENEIQRLKKIFNE----GLNYKQN----EHKYEKENCHIPQTFE 243
           ALE ++   E  IESLENEI +++K+  E     +  + N     HKY +E C I +  E
Sbjct: 265 ALESDIADNEEHIESLENEISKVEKLITETNKLNITLRHNVTTFSHKYNRE-CDITKKVE 323

Query: 244 LPASL 248
             AS+
Sbjct: 324 DKASI 328

>Kwal_56.23638
          Length = 4922

 Score = 30.4 bits (67), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 39/75 (52%), Gaps = 4/75 (5%)

Query: 198  QIKESQIESLENEIQRLKKIFNEGLNYKQNEHKYEKENCHIPQTFELPASLEVIFRKLSS 257
            Q+ +S +E    E   + K   E LN    EH++  E  +I +  E   S++  FRK++ 
Sbjct: 3874 QLSKSLLEDCCAETLFISKTVVEWLN----EHRFSPETVNIDERSEDIESIDNAFRKVAI 3929

Query: 258  SLHAKEKELAETKEN 272
            S+    ++L++ K+N
Sbjct: 3930 SIMVSVQKLSDDKDN 3944

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.309    0.123    0.333 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 10,342,721
Number of extensions: 408690
Number of successful extensions: 2274
Number of sequences better than 10.0: 185
Number of HSP's gapped: 2246
Number of HSP's successfully gapped: 221
Length of query: 360
Length of database: 16,596,109
Length adjustment: 103
Effective length of query: 257
Effective length of database: 13,030,455
Effective search space: 3348826935
Effective search space used: 3348826935
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 62 (28.5 bits)