Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YAL030W (SNC1)1171165145e-69
CAGL0G06358g1131164019e-52
ADR355C109953741e-47
YOR327C (SNC2)1151163689e-47
Scas_663.25112953644e-46
KLLA0A03883g1101163522e-44
CAGL0E05258g1081163272e-40
Kwal_26.705474512521e-29
Kwal_56.23743162601199e-09
YLR093C (NYV1)253571183e-08
Scas_564.4*237651165e-08
KLLA0F19448g231781122e-07
CAGL0C00429g234611113e-07
AGR054C248581113e-07
Kwal_47.1712120049884e-04
CAGL0D03498g20550850.001
Sklu_2258.720050840.001
Scas_571.120049840.001
AER109W20049840.001
YKL196C (YKT6)20050840.001
KLLA0D02684g20049770.009
ADL007C13589620.85
YPL249C (GYP5)89437602.6
CAGL0M02233g76759567.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YAL030W
         (116 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YAL030W (SNC1) [38] chr1 (87289..87390,87504..87755) Synaptobrev...   202   5e-69
CAGL0G06358g complement(612827..613168) no similarity, hypotheti...   159   9e-52
ADR355C [2096] [Homologous to ScYOR327C (SNC2) - SH; ScYAL030W (...   148   1e-47
YOR327C (SNC2) [5108] chr15 complement(930729..931076) Synaptobr...   146   9e-47
Scas_663.25                                                           144   4e-46
KLLA0A03883g join(344642..344725,344850..345098) similar to sp|P...   140   2e-44
CAGL0E05258g complement(511027..511353) highly similar to sp|P33...   130   2e-40
Kwal_26.7054                                                          101   1e-29
Kwal_56.23743                                                          50   9e-09
YLR093C (NYV1) [3508] chr12 complement(326514..327259,327401..32...    50   3e-08
Scas_564.4*                                                            49   5e-08
KLLA0F19448g complement(1799571..1800266) similar to sgd|S000408...    48   2e-07
CAGL0C00429g 43086..43790 similar to tr|Q12255 Saccharomyces cer...    47   3e-07
AGR054C [4364] [Homologous to ScYLR093C (NYV1) - SH] (815110..81...    47   3e-07
Kwal_47.17121                                                          39   4e-04
CAGL0D03498g complement(357058..357675) highly similar to sp|P36...    37   0.001
Sklu_2258.7 YKL196C, Contig c2258 11983-12585 reverse complement       37   0.001
Scas_571.1                                                             37   0.001
AER109W [2614] [Homologous to ScYKL196C (YKT6) - SH] complement(...    37   0.001
YKL196C (YKT6) [3076] chr11 complement(74937..75539) Synaptobrev...    37   0.001
KLLA0D02684g complement(228564..229166) highly similar to sp|P36...    34   0.009
ADL007C [1735] [Homologous to ScYIL004C (BET1) - SH] (696699..69...    28   0.85 
YPL249C (GYP5) [5201] chr16 complement(76669..79353) Protein con...    28   2.6  
CAGL0M02233g complement(267332..269635) highly similar to sp|P22...    26   7.5  

>YAL030W (SNC1) [38] chr1 (87289..87390,87504..87755) Synaptobrevin
           (v-SNARE) homolog present on post-Golgi vesicles [354
           bp, 117 aa]
          Length = 117

 Score =  202 bits (514), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 98/116 (84%), Positives = 98/116 (84%)

Query: 1   MSSSTPFDPYALSEHDEERPQNVQSKSRTAELQAEIDDTVGIMRDNINKVAERGERLTSI 60
           MSSSTPFDPYALSEHDEERPQNVQSKSRTAELQAEIDDTVGIMRDNINKVAERGERLTSI
Sbjct: 1   MSSSTPFDPYALSEHDEERPQNVQSKSRTAELQAEIDDTVGIMRDNINKVAERGERLTSI 60

Query: 61  EDKADNLAVSAQGFKRGANRVRKAMWYKDLKMKMCXXXXXXXXXXXXXXXXXXHFS 116
           EDKADNLAVSAQGFKRGANRVRKAMWYKDLKMKMC                  HFS
Sbjct: 61  EDKADNLAVSAQGFKRGANRVRKAMWYKDLKMKMCLALVIIILLVVIIVPIAVHFS 116

>CAGL0G06358g complement(612827..613168) no similarity, hypothetical
           start
          Length = 113

 Score =  159 bits (401), Expect = 9e-52,   Method: Compositional matrix adjust.
 Identities = 79/116 (68%), Positives = 84/116 (72%), Gaps = 3/116 (2%)

Query: 1   MSSSTPFDPYALSEHDEERPQNVQSKSRTAELQAEIDDTVGIMRDNINKVAERGERLTSI 60
           MSSS P+DPY   E DE    N QS+S+ A L+AEIDDTVGIMRDNINKVAERGERLTSI
Sbjct: 1   MSSSVPYDPYVTPEQDE---TNEQSQSKAAALKAEIDDTVGIMRDNINKVAERGERLTSI 57

Query: 61  EDKADNLAVSAQGFKRGANRVRKAMWYKDLKMKMCXXXXXXXXXXXXXXXXXXHFS 116
           EDKADNLA+SAQGFKRGANRVRK MWYKDLKMK C                  HFS
Sbjct: 58  EDKADNLAISAQGFKRGANRVRKQMWYKDLKMKFCLFVVIICLLVAIVVPIAVHFS 113

>ADR355C [2096] [Homologous to ScYOR327C (SNC2) - SH; ScYAL030W
          (SNC1) - SH] (1333349..1333597,1333672..1333752) [330
          bp, 109 aa]
          Length = 109

 Score =  148 bits (374), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 71/95 (74%), Positives = 80/95 (84%), Gaps = 7/95 (7%)

Query: 1  MSSSTPFDPYALSEHDEERPQNVQSKSRTAELQAEIDDTVGIMRDNINKVAERGERLTSI 60
          MSSS P+DPY         P+  QS+S+ A L+AEIDDTVGIMRDNINKVAERGERLTSI
Sbjct: 1  MSSSVPYDPYV-------PPEGAQSQSKAAALKAEIDDTVGIMRDNINKVAERGERLTSI 53

Query: 61 EDKADNLAVSAQGFKRGANRVRKAMWYKDLKMKMC 95
          +DKADNLAVSAQGFKRGANRVRK MW+KDLKM++C
Sbjct: 54 QDKADNLAVSAQGFKRGANRVRKQMWWKDLKMRLC 88

>YOR327C (SNC2) [5108] chr15 complement(930729..931076)
           Synaptobrevin (v-SNARE) homolog present on post-Golgi
           vesicles [348 bp, 115 aa]
          Length = 115

 Score =  146 bits (368), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 74/116 (63%), Positives = 83/116 (71%), Gaps = 1/116 (0%)

Query: 1   MSSSTPFDPYALSEHDEERPQNVQSKSRTAELQAEIDDTVGIMRDNINKVAERGERLTSI 60
           MSSS P+DPY   E +     N  S+++TA L+ EIDDTVGIMRDNINKVAERGERLTSI
Sbjct: 1   MSSSVPYDPYVPPE-ESNSGANPNSQNKTAALRQEIDDTVGIMRDNINKVAERGERLTSI 59

Query: 61  EDKADNLAVSAQGFKRGANRVRKAMWYKDLKMKMCXXXXXXXXXXXXXXXXXXHFS 116
           EDKADNLA+SAQGFKRGANRVRK MW+KDLKM+MC                  HFS
Sbjct: 60  EDKADNLAISAQGFKRGANRVRKQMWWKDLKMRMCLFLVVIILLVVIIVPIVVHFS 115

>Scas_663.25
          Length = 112

 Score =  144 bits (364), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 71/95 (74%), Positives = 78/95 (82%), Gaps = 4/95 (4%)

Query: 1  MSSSTPFDPYALSEHDEERPQNVQSKSRTAELQAEIDDTVGIMRDNINKVAERGERLTSI 60
          MSSS P+DPY   E         +S+S+ A L+AEIDDTVGIMRDNINKVAERGERLTSI
Sbjct: 1  MSSSVPYDPYVPPEET----NGPESQSKAAALKAEIDDTVGIMRDNINKVAERGERLTSI 56

Query: 61 EDKADNLAVSAQGFKRGANRVRKAMWYKDLKMKMC 95
          EDKADNLAVSAQGFKRGANRVRK MW+KDLKM+ C
Sbjct: 57 EDKADNLAVSAQGFKRGANRVRKQMWWKDLKMRAC 91

>KLLA0A03883g join(344642..344725,344850..345098) similar to
           sp|P33328 Saccharomyces cerevisiae YOR327c SNC2
           synaptobrevin (v-SNARE) homolog present on post-Golgi
           vesicles or sp|P31109 Saccharomyces cerevisiae YAL030w
           SNC1 synaptic vesicle-associated membrane protein, start
           by similarity
          Length = 110

 Score =  140 bits (352), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 71/116 (61%), Positives = 80/116 (68%), Gaps = 6/116 (5%)

Query: 1   MSSSTPFDPYALSEHDEERPQNVQSKSRTAELQAEIDDTVGIMRDNINKVAERGERLTSI 60
           MSSS P+DPY  +       +     S+TA L++EIDDTV IMRDNINKVAERGERLTSI
Sbjct: 1   MSSSVPYDPYVPAT------EETAGDSKTAALKSEIDDTVDIMRDNINKVAERGERLTSI 54

Query: 61  EDKADNLAVSAQGFKRGANRVRKAMWYKDLKMKMCXXXXXXXXXXXXXXXXXXHFS 116
           +DKADNLAVSAQGFKRGANRVRK MW+KDLKM+MC                  HFS
Sbjct: 55  QDKADNLAVSAQGFKRGANRVRKQMWWKDLKMRMCLVLVVIILLIVIIVPIAVHFS 110

>CAGL0E05258g complement(511027..511353) highly similar to sp|P33328
           Saccharomyces cerevisiae YOR327c SNC2, start by
           similarity
          Length = 108

 Score =  130 bits (327), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 67/116 (57%), Positives = 79/116 (68%), Gaps = 8/116 (6%)

Query: 1   MSSSTPFDPYALSEHDEERPQNVQSKSRTAELQAEIDDTVGIMRDNINKVAERGERLTSI 60
           M+S+  +DPY LSE           +S+ A L++EIDDTV IMR+NINKVAERGE LTSI
Sbjct: 1   MASNDNYDPYLLSED--------GGQSKAAALKSEIDDTVDIMRNNINKVAERGEMLTSI 52

Query: 61  EDKADNLAVSAQGFKRGANRVRKAMWYKDLKMKMCXXXXXXXXXXXXXXXXXXHFS 116
           +DKADNLA+SAQGFKRGANRVR+ MWYKDLKM+MC                  HFS
Sbjct: 53  DDKADNLAMSAQGFKRGANRVRRQMWYKDLKMRMCLFLVIVILLVVIIVPIVVHFS 108

>Kwal_26.7054
          Length = 74

 Score =  101 bits (252), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 48/51 (94%), Positives = 50/51 (98%)

Query: 43 MRDNINKVAERGERLTSIEDKADNLAVSAQGFKRGANRVRKAMWYKDLKMK 93
          MRDNINKVAERGERLTSIEDKADNLAVSAQGFKRGANRVRK MW+KDLKM+
Sbjct: 1  MRDNINKVAERGERLTSIEDKADNLAVSAQGFKRGANRVRKQMWWKDLKMR 51

>Kwal_56.23743
          Length = 162

 Score = 50.4 bits (119), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 39/60 (65%)

Query: 33  QAEIDDTVGIMRDNINKVAERGERLTSIEDKADNLAVSAQGFKRGANRVRKAMWYKDLKM 92
           + ++ D + +M DNI+K  +R ER++ + D+   L  S+  FKR A R++  MW++++K+
Sbjct: 81  EQDLQDIIHLMNDNIDKFLQRQERVSLLVDRTSKLNQSSYNFKRKAVRIKTKMWWQNVKL 140

>YLR093C (NYV1) [3508] chr12
           complement(326514..327259,327401..327416) Synaptobrevin
           (v-SNARE) homolog involved in vacuolar vesicle fusion
           [762 bp, 253 aa]
          Length = 253

 Score = 50.1 bits (118), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 36/57 (63%)

Query: 35  EIDDTVGIMRDNINKVAERGERLTSIEDKADNLAVSAQGFKRGANRVRKAMWYKDLK 91
           +I D + IM DNI+K  ER ER++ + DK   L  S+  F+R A  +++ MW++ +K
Sbjct: 174 QIKDVIQIMNDNIDKFLERQERVSLLVDKTSQLNSSSNKFRRKAVNIKEIMWWQKVK 230

>Scas_564.4*
          Length = 237

 Score = 49.3 bits (116), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 40/65 (61%)

Query: 27  SRTAELQAEIDDTVGIMRDNINKVAERGERLTSIEDKADNLAVSAQGFKRGANRVRKAMW 86
           S  A  + ++ D V IM +NI+K  ER ER++ + DK   L  ++  FK+ A R+++ MW
Sbjct: 150 SEGASTENDLQDVVNIMNNNIDKFLERQERISLLVDKTSQLNDNSHNFKKKAVRIKERMW 209

Query: 87  YKDLK 91
           ++ +K
Sbjct: 210 WQRMK 214

>KLLA0F19448g complement(1799571..1800266) similar to sgd|S0004083
           Saccharomyces cerevisiae YLR093c NYV1 v-SNARE, vacuolar,
           start by similarity
          Length = 231

 Score = 47.8 bits (112), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 20/78 (25%), Positives = 44/78 (56%)

Query: 15  HDEERPQNVQSKSRTAELQAEIDDTVGIMRDNINKVAERGERLTSIEDKADNLAVSAQGF 74
           H+E      + +   A  + E+ + + IM DNI+K  +R ER++ + D  + L  ++  F
Sbjct: 133 HEELLSYRTEGQQTAASTEEELQNIIAIMNDNIDKFLQRQERISLLVDNTNQLNENSFKF 192

Query: 75  KRGANRVRKAMWYKDLKM 92
           +R ++++ + MW+ ++K 
Sbjct: 193 QRKSSKIMRKMWWNNVKF 210

>CAGL0C00429g 43086..43790 similar to tr|Q12255 Saccharomyces
           cerevisiae YLR093c, hypothetical start
          Length = 234

 Score = 47.4 bits (111), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 41/61 (67%)

Query: 31  ELQAEIDDTVGIMRDNINKVAERGERLTSIEDKADNLAVSAQGFKRGANRVRKAMWYKDL 90
           E + ++ + + IM DNI+K  ER ER++ + DK  +L  +++ FKR A ++++ MW++ +
Sbjct: 151 EAEDDMQEVIQIMNDNIDKFLERQERVSLLVDKTSHLNSNSRSFKRKAIKLKERMWWRRM 210

Query: 91  K 91
           K
Sbjct: 211 K 211

>AGR054C [4364] [Homologous to ScYLR093C (NYV1) - SH]
           (815110..815795,815928..815988) [747 bp, 248 aa]
          Length = 248

 Score = 47.4 bits (111), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 36/58 (62%)

Query: 35  EIDDTVGIMRDNINKVAERGERLTSIEDKADNLAVSAQGFKRGANRVRKAMWYKDLKM 92
           ++   V +M DNI+K  +R ER++ + D+   L  S+  F+R A R+++ MW+ ++K 
Sbjct: 170 DLQTIVSVMNDNIDKFLQRQERISLLVDQTSQLNQSSFNFQRKAVRIKRKMWWNNIKF 227

>Kwal_47.17121
          Length = 200

 Score = 38.5 bits (88), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 33/49 (67%)

Query: 32  LQAEIDDTVGIMRDNINKVAERGERLTSIEDKADNLAVSAQGFKRGANR 80
           +Q E+D+T  ++   I  V +RGERL ++ DK+++L+ S++ F + A +
Sbjct: 144 VQQELDETKIVLHKTIESVLQRGERLDNLVDKSESLSASSRMFYKQAKK 192

>CAGL0D03498g complement(357058..357675) highly similar to sp|P36015
           Saccharomyces cerevisiae YKL196c YKT6, start by
           similarity
          Length = 205

 Score = 37.4 bits (85), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 33/50 (66%)

Query: 31  ELQAEIDDTVGIMRDNINKVAERGERLTSIEDKADNLAVSAQGFKRGANR 80
           ++Q E+D+T  ++   I  V +RGE+L ++ DK+++L  S++ F + A +
Sbjct: 148 KVQQELDETKIVLHKTIENVLQRGEKLDNLVDKSESLTASSKMFYKQAKK 197

>Sklu_2258.7 YKL196C, Contig c2258 11983-12585 reverse complement
          Length = 200

 Score = 37.0 bits (84), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 34/50 (68%)

Query: 31  ELQAEIDDTVGIMRDNINKVAERGERLTSIEDKADNLAVSAQGFKRGANR 80
           ++Q E+D+T  ++   I  V +RGE+L ++ DK+++L+ S++ F + A +
Sbjct: 143 KVQQELDETKIVLHKTIESVLQRGEKLDNLVDKSESLSASSRMFYKQAKK 192

>Scas_571.1
          Length = 200

 Score = 37.0 bits (84), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 32/49 (65%)

Query: 32  LQAEIDDTVGIMRDNINKVAERGERLTSIEDKADNLAVSAQGFKRGANR 80
           +Q E+D+T  ++   I  V +RGE+L ++ DK+++L  S++ F + A +
Sbjct: 144 VQQELDETKIVLHKTIENVLQRGEKLDNLVDKSESLTASSKMFYKQAKK 192

>AER109W [2614] [Homologous to ScYKL196C (YKT6) - SH]
           complement(841793..842395) [603 bp, 200 aa]
          Length = 200

 Score = 37.0 bits (84), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 33/49 (67%)

Query: 32  LQAEIDDTVGIMRDNINKVAERGERLTSIEDKADNLAVSAQGFKRGANR 80
           +Q E+D+T  ++   I  V +RGE+L ++ DK+++L+ S++ F + A +
Sbjct: 144 VQQELDETKIVLHKTIESVLQRGEKLDNLVDKSESLSASSRMFYKQAKK 192

>YKL196C (YKT6) [3076] chr11 complement(74937..75539) Synaptobrevin
           (v-SNARE) homolog with similarity to Sec22p, Snc1p, and
           Snc2p, essential for endoplasmic reticulum-Golgi
           transport [603 bp, 200 aa]
          Length = 200

 Score = 37.0 bits (84), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 33/50 (66%)

Query: 31  ELQAEIDDTVGIMRDNINKVAERGERLTSIEDKADNLAVSAQGFKRGANR 80
           ++Q E+D+T  ++   I  V +RGE+L ++ DK+++L  S++ F + A +
Sbjct: 143 KVQQELDETKIVLHKTIENVLQRGEKLDNLVDKSESLTASSKMFYKQAKK 192

>KLLA0D02684g complement(228564..229166) highly similar to sp|P36015
           Saccharomyces cerevisiae YKL196c YKT6 SNARE protein for
           Endoplasmic Reticulum-Golgi transport singleton, start
           by similarity
          Length = 200

 Score = 34.3 bits (77), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 32/49 (65%)

Query: 32  LQAEIDDTVGIMRDNINKVAERGERLTSIEDKADNLAVSAQGFKRGANR 80
           +Q E+D+T   +   I  V +RGE+L ++ DK+++L+ +++ F + A +
Sbjct: 144 VQQELDETKITLHKTIENVLQRGEKLDNLVDKSESLSAASRMFYKQAKK 192

>ADL007C [1735] [Homologous to ScYIL004C (BET1) - SH]
           (696699..697106) [408 bp, 135 aa]
          Length = 135

 Score = 28.5 bits (62), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 40/89 (44%), Gaps = 13/89 (14%)

Query: 3   SSTPFDPYALSEHDEERPQNVQSKSRTAELQAEIDDTVGIMRDNINKVAERGERLT-SIE 61
           SS+PF            P    S+S  A+L+++ D  VG+MR+ I  +    ER+   I 
Sbjct: 28  SSSPFS----------NPSIDYSQSTLAQLESQSDADVGVMREKIMALKTLSERMGEEIR 77

Query: 62  DKADNLAVSAQGFKRGANRVRKAMWYKDL 90
             +  L      F   AN++++   YK +
Sbjct: 78  GSSKTLDSLGSTFDATANKLKRT--YKKM 104

>YPL249C (GYP5) [5201] chr16 complement(76669..79353) Protein
           containing a TBC domain, which may be GTPase activators
           of Rab-like small GTPases, has a region of low
           similarity to a region of the microtubule nucleation
           protein RAB6 GTPase activating protein (GAP and
           centrosome-associated, human GAPCENA) [2685 bp, 894 aa]
          Length = 894

 Score = 27.7 bits (60), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 23/37 (62%)

Query: 11  ALSEHDEERPQNVQSKSRTAELQAEIDDTVGIMRDNI 47
            +S ++E   +N Q + R  ELQAEID+ + I ++ +
Sbjct: 832 TISRNNEVMRENGQLEERITELQAEIDELININKEQV 868

>CAGL0M02233g complement(267332..269635) highly similar to sp|P22216
           Saccharomyces cerevisiae YPL153c SPK1 ser/thr/tyr
           protein kinase, hypothetical start
          Length = 767

 Score = 26.2 bits (56), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 25/59 (42%)

Query: 5   TPFDPYALSEHDEERPQNVQSKSRTAELQAEIDDTVGIMRDNINKVAERGERLTSIEDK 63
           TP   Y L E DE +    + K      Q E++DT G+  + +    E     +  ED+
Sbjct: 640 TPGKKYLLQEGDEIKIIKDKQKDFVIGFQVELNDTTGLFNNGLGIPNEERSVTSQTEDE 698

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.313    0.126    0.354 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 2,882,107
Number of extensions: 94949
Number of successful extensions: 407
Number of sequences better than 10.0: 39
Number of HSP's gapped: 401
Number of HSP's successfully gapped: 39
Length of query: 116
Length of database: 16,596,109
Length adjustment: 86
Effective length of query: 30
Effective length of database: 13,618,961
Effective search space: 408568830
Effective search space used: 408568830
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 54 (25.4 bits)