Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YAL029C (MYO4)1471144576730.0
YOR326W (MYO2)1574151136030.0
Scas_663.261567151735840.0
CAGL0F00671g1566150635380.0
ADR354W1558149935020.0
Kwal_26.70551555149934930.0
Scas_592.13*1419145233960.0
KLLA0A03905g1550149033540.0
Sklu_2164.51350130233360.0
CAGL0G06336g1418143429980.0
Scas_688.22187678913221e-154
YHR023W (MYO1)192883413081e-152
ACR068W180580212941e-151
Kwal_23.5534190775912801e-148
KLLA0E11572g184875712771e-148
CAGL0J00693g188481612131e-139
Scas_721.119123273611401e-133
KLLA0B12562g126076111341e-132
CAGL0K03487g121775111051e-128
Kwal_26.7587125075910991e-127
YMR109W (MYO5)121976610951e-127
YKL129C (MYO3)127176510851e-125
CAGL0K07590g125275710741e-124
AEL306C129277210601e-122
Scas_584.6*104988706.0
Kwal_56.2250540350696.1
YOL031C (SIL1)42162696.7
CAGL0I06380g119645697.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YAL029C
         (1445 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YAL029C (MYO4) [39] chr1 complement(87858..92273) Myosin heavy c...  2960   0.0  
YOR326W (MYO2) [5107] chr15 (925716..930440) Myosin heavy chain,...  1392   0.0  
Scas_663.26                                                          1385   0.0  
CAGL0F00671g complement(73893..78593) highly similar to sp|P1952...  1367   0.0  
ADR354W [2095] [Homologous to ScYOR326W (MYO2) - SH; ScYAL029C (...  1353   0.0  
Kwal_26.7055                                                         1350   0.0  
Scas_592.13*                                                         1312   0.0  
KLLA0A03905g complement(345818..350470) similar to sp|P19524 Sac...  1296   0.0  
Sklu_2164.5 YOR326W, Contig c2164 5497-9549                          1289   0.0  
CAGL0G06336g 607817..612073 similar to sp|P32492 Saccharomyces c...  1159   0.0  
Scas_688.22                                                           513   e-154
YHR023W (MYO1) [2310] chr8 (151658..157444) Myosin heavy chain (...   508   e-152
ACR068W [1115] [Homologous to ScYHR023W (MYO1) - SH] complement(...   503   e-151
Kwal_23.5534                                                          497   e-148
KLLA0E11572g complement(1018972..1024518) similar to sp|P08964 S...   496   e-148
CAGL0J00693g complement(61246..66900) similar to sp|P08964 Sacch...   471   e-139
Scas_721.119                                                          443   e-133
KLLA0B12562g complement(1095953..1099735) similar to sp|Q04439 S...   441   e-132
CAGL0K03487g 322030..325683 highly similar to sp|Q04439 Saccharo...   430   e-128
Kwal_26.7587                                                          427   e-127
YMR109W (MYO5) [4066] chr13 (486586..490245) Myosin type I, may ...   426   e-127
YKL129C (MYO3) [3137] chr11 complement(196350..200165) Myosin ty...   422   e-125
CAGL0K07590g 748352..752110 highly similar to sp|P36006 Saccharo...   418   e-124
AEL306C [2199] [Homologous to ScYMR109W (MYO5) - SH; ScYKL129C (...   412   e-122
Scas_584.6*                                                            32   6.0  
Kwal_56.22505                                                          31   6.1  
YOL031C (SIL1) [4785] chr15 complement(266264..267529) Protein i...    31   6.7  
CAGL0I06380g complement(615944..619534) tr|Q9C1F3 Candida glabra...    31   7.4  

>YAL029C (MYO4) [39] chr1 complement(87858..92273) Myosin heavy chain,
            class V [4416 bp, 1471 aa]
          Length = 1471

 Score = 2960 bits (7673), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1432/1445 (99%), Positives = 1432/1445 (99%)

Query: 1    MSFEVGTKCWYPHKEQGWIGGEVTKNDFFEGTFHLELKLEDGETVSIETNSFENDDDHPT 60
            MSFEVGTKCWYPHKEQGWIGGEVTKNDFFEGTFHLELKLEDGETVSIETNSFENDDDHPT
Sbjct: 1    MSFEVGTKCWYPHKEQGWIGGEVTKNDFFEGTFHLELKLEDGETVSIETNSFENDDDHPT 60

Query: 61   LPVLRNPPILESTDDLTTLSYLNEPAVLHAIKKRYMNGQIYTYSGIVLIAANPFDKVDHL 120
            LPVLRNPPILESTDDLTTLSYLNEPAVLHAIKKRYMNGQIYTYSGIVLIAANPFDKVDHL
Sbjct: 61   LPVLRNPPILESTDDLTTLSYLNEPAVLHAIKKRYMNGQIYTYSGIVLIAANPFDKVDHL 120

Query: 121  YSREMIQNYSSKRKDELEPHLFAIAEEAYRFMVHEKANQTVVVSGESGAGKTVSAKYIMR 180
            YSREMIQNYSSKRKDELEPHLFAIAEEAYRFMVHEKANQTVVVSGESGAGKTVSAKYIMR
Sbjct: 121  YSREMIQNYSSKRKDELEPHLFAIAEEAYRFMVHEKANQTVVVSGESGAGKTVSAKYIMR 180

Query: 181  YFASVQESNNREGEVEMSQIESQILATNPIMEAFGNAKTTRNDNSSRFGKYLQILFDENT 240
            YFASVQESNNREGEVEMSQIESQILATNPIMEAFGNAKTTRNDNSSRFGKYLQILFDENT
Sbjct: 181  YFASVQESNNREGEVEMSQIESQILATNPIMEAFGNAKTTRNDNSSRFGKYLQILFDENT 240

Query: 241  TIRGSKIRTYLLEKSRLVYQPETERNYHIFYQILEGLPEPVKQELHLSSPKDYHYTNQGG 300
            TIRGSKIRTYLLEKSRLVYQPETERNYHIFYQILEGLPEPVKQELHLSSPKDYHYTNQGG
Sbjct: 241  TIRGSKIRTYLLEKSRLVYQPETERNYHIFYQILEGLPEPVKQELHLSSPKDYHYTNQGG 300

Query: 301  QPNIAGIDEAREYKITTDALSLVGINHETQLGIFKILAGLLHIGNIEMKMTRNDASLSSE 360
            QPNIAGIDEAREYKITTDALSLVGINHETQLGIFKILAGLLHIGNIEMKMTRNDASLSSE
Sbjct: 301  QPNIAGIDEAREYKITTDALSLVGINHETQLGIFKILAGLLHIGNIEMKMTRNDASLSSE 360

Query: 361  EQNLQIACELLGIDPFNFAKWIVKKQIVTRSEKIVTNLNYNQALIARDSVAKFIYSTLFD 420
            EQNLQIACELLGIDPFNFAKWIVKKQIVTRSEKIVTNLNYNQALIARDSVAKFIYSTLFD
Sbjct: 361  EQNLQIACELLGIDPFNFAKWIVKKQIVTRSEKIVTNLNYNQALIARDSVAKFIYSTLFD 420

Query: 421  WLVDNINKTLYDPELDQQDHVFSFIGILDIYGFEHFEKNSFEQFCINYANEKLQQEFNQH 480
            WLVDNINKTLYDPELDQQDHVFSFIGILDIYGFEHFEKNSFEQFCINYANEKLQQEFNQH
Sbjct: 421  WLVDNINKTLYDPELDQQDHVFSFIGILDIYGFEHFEKNSFEQFCINYANEKLQQEFNQH 480

Query: 481  VFKLEQEEYVKEEIEWSFIEFSDNQPCIDLIENKLGILSLLDEESRLPSGSDESWASKLY 540
            VFKLEQEEYVKEEIEWSFIEFSDNQPCIDLIENKLGILSLLDEESRLPSGSDESWASKLY
Sbjct: 481  VFKLEQEEYVKEEIEWSFIEFSDNQPCIDLIENKLGILSLLDEESRLPSGSDESWASKLY 540

Query: 541  SAFNKPPSNEVFSKPRFGQTKFIVSHYAVDVEYEVEGFIEKNRDSVSLGHLDVFKATTNP 600
            SAFNKPPSNEVFSKPRFGQTKFIVSHYAVDVEYEVEGFIEKNRDSVSLGHLDVFKATTNP
Sbjct: 541  SAFNKPPSNEVFSKPRFGQTKFIVSHYAVDVEYEVEGFIEKNRDSVSLGHLDVFKATTNP 600

Query: 601  IFKQILDNRELRSDDAPEEQNTEKKIMIPARLSQKKPTLGSMFKKSLGELMAIINSTNVH 660
            IFKQILDNRELRSDDAPEEQNTEKKIMIPARLSQKKPTLGSMFKKSLGELMAIINSTNVH
Sbjct: 601  IFKQILDNRELRSDDAPEEQNTEKKIMIPARLSQKKPTLGSMFKKSLGELMAIINSTNVH 660

Query: 661  YIRCIKPNSEKKPWEFDNLMVLSQLRACGVLETIRISCAGFPSRWTFDEFVQRYFLLTDY 720
            YIRCIKPNSEKKPWEFDNLMVLSQLRACGVLETIRISCAGFPSRWTFDEFVQRYFLLTDY
Sbjct: 661  YIRCIKPNSEKKPWEFDNLMVLSQLRACGVLETIRISCAGFPSRWTFDEFVQRYFLLTDY 720

Query: 721  SLWSGILYNPDLPKEAIVNFCQSILDATISDSAKYQIGNTKIFFKAGMLAFLEKLRTNKM 780
            SLWSGILYNPDLPKEAIVNFCQSILDATISDSAKYQIGNTKIFFKAGMLAFLEKLRTNKM
Sbjct: 721  SLWSGILYNPDLPKEAIVNFCQSILDATISDSAKYQIGNTKIFFKAGMLAFLEKLRTNKM 780

Query: 781  NEICIIIQKKIRARYYRLQYLQTMESIKKCQSQIRSLLVRTRVDHELKTRAAILLQTNIR 840
            NEICIIIQKKIRARYYRLQYLQTMESIKKCQSQIRSLLVRTRVDHELKTRAAILLQTNIR
Sbjct: 781  NEICIIIQKKIRARYYRLQYLQTMESIKKCQSQIRSLLVRTRVDHELKTRAAILLQTNIR 840

Query: 841  ALWKREYYRAAIGQIIKLQCTCKRKLILDSVNRKFMLMAAVIIQSYIRSYGHKTDYRTLK 900
            ALWKREYYRAAIGQIIKLQCTCKRKLILDSVNRKFMLMAAVIIQSYIRSYGHKTDYRTLK
Sbjct: 841  ALWKREYYRAAIGQIIKLQCTCKRKLILDSVNRKFMLMAAVIIQSYIRSYGHKTDYRTLK 900

Query: 901  RSSILVQSAMRMQLARRRYIVLQKEVEERNIRASYGIGLLEEAIEFKNSFILNLEMLNDS 960
            RSSILVQSAMRMQLARRRYIVLQKEVEERNIRASYGIGLLEEAIEFKNSFILNLEMLNDS
Sbjct: 901  RSSILVQSAMRMQLARRRYIVLQKEVEERNIRASYGIGLLEEAIEFKNSFILNLEMLNDS 960

Query: 961  YTRLTQLLQGDLSNIPSKQRQEYETIVNGYNDKISKLKTLQVEIMNTXXXXXXXXXXXXX 1020
            YTRLTQLLQGDLSNIPSKQRQEYETIVNGYNDKISKLKTLQVEIMNT             
Sbjct: 961  YTRLTQLLQGDLSNIPSKQRQEYETIVNGYNDKISKLKTLQVEIMNTLNKKNALKERKKK 1020

Query: 1021 QSSLIQSHMQSLAAIKGNKPSRLSDEVKSMKQELAFIENVIAQDFTTTYSANKNDKVKGL 1080
            QSSLIQSHMQSLAAIKGNKPSRLSDEVKSMKQELAFIENVIAQDFTTTYSANKNDKVKGL
Sbjct: 1021 QSSLIQSHMQSLAAIKGNKPSRLSDEVKSMKQELAFIENVIAQDFTTTYSANKNDKVKGL 1080

Query: 1081 GIAGQQVKPKLVNVIRRESGNPDLLELLMDLNCYTLEVTEGYLKKVNVTEVNGDNVLGPI 1140
            GIAGQQVKPKLVNVIRRESGNPDLLELLMDLNCYTLEVTEGYLKKVNVTEVNGDNVLGPI
Sbjct: 1081 GIAGQQVKPKLVNVIRRESGNPDLLELLMDLNCYTLEVTEGYLKKVNVTEVNGDNVLGPI 1140

Query: 1141 HVITTVVSSLVRNGLLIQSSKFISKVLLTVESIVMSLPKDETMLGGIFWLSNLSRLPAFA 1200
            HVITTVVSSLVRNGLLIQSSKFISKVLLTVESIVMSLPKDETMLGGIFWLSNLSRLPAFA
Sbjct: 1141 HVITTVVSSLVRNGLLIQSSKFISKVLLTVESIVMSLPKDETMLGGIFWLSNLSRLPAFA 1200

Query: 1201 ANQKTLYEANGGDEKDKLTLIYLNDLENETLKVFDKIYSTWLVKFMKHASAHIEIFDMVL 1260
            ANQKTLYEANGGDEKDKLTLIYLNDLENETLKVFDKIYSTWLVKFMKHASAHIEIFDMVL
Sbjct: 1201 ANQKTLYEANGGDEKDKLTLIYLNDLENETLKVFDKIYSTWLVKFMKHASAHIEIFDMVL 1260

Query: 1261 NEKLFKNSGDEKFAKLFTFLNEFDAVLCKFQVVDSMHTKIFNDTLKYLNVMLFNDLITKC 1320
            NEKLFKNSGDEKFAKLFTFLNEFDAVLCKFQVVDSMHTKIFNDTLKYLNVMLFNDLITKC
Sbjct: 1261 NEKLFKNSGDEKFAKLFTFLNEFDAVLCKFQVVDSMHTKIFNDTLKYLNVMLFNDLITKC 1320

Query: 1321 PALNWKYGYEVDRNIERLVSWFEPRIEDVRPNLIQIIQAVKILQLKISNLNEFKLLFDFW 1380
            PALNWKYGYEVDRNIERLVSWFEPRIEDVRPNLIQIIQAVKILQLKISNLNEFKLLFDFW
Sbjct: 1321 PALNWKYGYEVDRNIERLVSWFEPRIEDVRPNLIQIIQAVKILQLKISNLNEFKLLFDFW 1380

Query: 1381 YALNPAQIQAILLKYKPANKGEAGVPNEILNYLANVIKRENLSLPGKMEIMLSAQFDSAK 1440
            YALNPAQIQAILLKYKPANKGEAGVPNEILNYLANVIKRENLSLPGKMEIMLSAQFDSAK
Sbjct: 1381 YALNPAQIQAILLKYKPANKGEAGVPNEILNYLANVIKRENLSLPGKMEIMLSAQFDSAK 1440

Query: 1441 NHLRY 1445
            NHLRY
Sbjct: 1441 NHLRY 1445

>YOR326W (MYO2) [5107] chr15 (925716..930440) Myosin heavy chain,
            class V, involved in polarized growth, secretion and
            cytokinesis, required for mitochondrial distribution into
            growing bud [4725 bp, 1574 aa]
          Length = 1574

 Score = 1392 bits (3603), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 752/1511 (49%), Positives = 995/1511 (65%), Gaps = 100/1511 (6%)

Query: 1    MSFEVGTKCWYPHKEQGWIGGEVTKNDFFEGTFHLELKLEDGETVSIETNSFENDDDHPT 60
            MSFEVGT+CWYPHKE GWIG EV KN+F +G +HLEL+LED E VS++T    ND D  +
Sbjct: 1    MSFEVGTRCWYPHKELGWIGAEVIKNEFNDGKYHLELQLEDDEIVSVDTKDLNNDKDQ-S 59

Query: 61   LPVLRNPPILESTDDLTTLSYLNEPAVLHAIKKRYMNGQIYTYSGIVLIAANPFDKVDHL 120
            LP+LRNPPILE+T+DLT+LSYLNEPAVLHAIK+RY    IYTYSGIVLIA NPFD+VD L
Sbjct: 60   LPLLRNPPILEATEDLTSLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRVDQL 119

Query: 121  YSREMIQNYSSKRKDELEPHLFAIAEEAYRFMVHEKANQTVVVSGESGAGKTVSAKYIMR 180
            Y+++MIQ Y+ KR+ ELEPHLFAIAEEAYR M ++K NQT+VVSGESGAGKTVSAKYIMR
Sbjct: 120  YTQDMIQAYAGKRRGELEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMR 179

Query: 181  YFASVQESNNR--EGEVEMSQIESQILATNPIMEAFGNAKTTRNDNSSRFGKYLQILFDE 238
            YFASV+E N+   + +VEMS+ E +ILATNPIMEAFGNAKTTRNDNSSRFGKYL+ILFD+
Sbjct: 180  YFASVEEENSATVQHQVEMSETEQKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDK 239

Query: 239  NTTIRGSKIRTYLLEKSRLVYQPETERNYHIFYQILEGLPEPVKQELHLSSPKDYHYTNQ 298
            +T+I G++IRTYLLE+SRLVYQP  ERNYHIFYQ++ GLP   K+ELHL+   DY Y NQ
Sbjct: 240  DTSIIGARIRTYLLERSRLVYQPPIERNYHIFYQLMAGLPAQTKEELHLTDASDYFYMNQ 299

Query: 299  GGQPNIAGIDEAREYKITTDALSLVGINHETQLGIFKILAGLLHIGNIEMKMTRNDASLS 358
            GG   I GID+A+EYKIT DAL+LVGI  ETQ  IFKILA LLHIGNIE+K TRNDASLS
Sbjct: 300  GGDTKINGIDDAKEYKITVDALTLVGITKETQHQIFKILAALLHIGNIEIKKTRNDASLS 359

Query: 359  SEEQNLQIACELLGIDPFNFAKWIVKKQIVTRSEKIVTNLNYNQALIARDSVAKFIYSTL 418
            ++E NL++ACELLGID +NFAKW+ KKQI+TRSEKIV+NLNY+QAL+A+DSVAKFIYS L
Sbjct: 360  ADEPNLKLACELLGIDAYNFAKWVTKKQIITRSEKIVSNLNYSQALVAKDSVAKFIYSAL 419

Query: 419  FDWLVDNINKTLYDPELDQQDHVFSFIGILDIYGFEHFEKNSFEQFCINYANEKLQQEFN 478
            FDWLV+NIN  L +P ++  D + SFIG+LDIYGFEHFEKNSFEQFCINYANEKLQQEFN
Sbjct: 420  FDWLVENINTVLCNPAVN--DQISSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFN 477

Query: 479  QHVFKLEQEEYVKEEIEWSFIEFSDNQPCIDLIENKLGILSLLDEESRLPSGSDESWASK 538
            QHVFKLEQEEYVKEEIEWSFIEF+DNQPCIDLIENKLGILSLLDEESRLP+GSDESW  K
Sbjct: 478  QHVFKLEQEEYVKEEIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDESWTQK 537

Query: 539  LYSAFNKPPSNEVFSKPRFGQTKFIVSHYAVDVEYEVEGFIEKNRDSVSLGHLDVFKATT 598
            LY   +K P+N+VFSKPRFGQTKFIVSHYA+DV Y+VEGFIEKNRD+VS GHL+V KA+T
Sbjct: 538  LYQTLDKSPTNKVFSKPRFGQTKFIVSHYALDVAYDVEGFIEKNRDTVSDGHLEVLKAST 597

Query: 599  NPIFKQILDNRELRSDDAPEEQNTE-----KKIMIPARLSQKKPTLGSMFKKSLGELMAI 653
            N     IL+  E  +    E +  E      K   P R   +KPTLGSMFK+SL ELM  
Sbjct: 598  NETLINILEGLEKAAKKLEEAKKLELEQAGSKKPGPIRTVNRKPTLGSMFKQSLIELMNT 657

Query: 654  INSTNVHYIRCIKPNSEKKPWEFDNLMVLSQLRACGVLETIRISCAGFPSRWTFDEFVQR 713
            INSTNVHYIRCIKPN++K+ W+FDNLMVLSQLRACGVLETIRISCAGFPSRWTF+EFV R
Sbjct: 658  INSTNVHYIRCIKPNADKEAWQFDNLMVLSQLRACGVLETIRISCAGFPSRWTFEEFVLR 717

Query: 714  YFLLTDYSLWSGILYNPDLPKEAIVNFCQSILDATISDSAKYQIGNTKIFFKAGMLAFLE 773
            Y++L  +  W  I    +  +E I++  + ILDAT+ D +KYQIGNTKIFFKAGMLA+LE
Sbjct: 718  YYILIPHEQWDLIFKKKETTEEDIISVVKMILDATVKDKSKYQIGNTKIFFKAGMLAYLE 777

Query: 774  KLRTNKMNEICIIIQKKIRARYYRLQYLQTMESIKKCQSQIRSLLVRTRVDHELKTRAAI 833
            KLR+NKM+   ++IQKKIRA+YYR QYLQ  ++IK  Q+ I+  ++R RV+ E+K   A 
Sbjct: 778  KLRSNKMHNSIVMIQKKIRAKYYRKQYLQISQAIKYLQNNIKGFIIRQRVNDEMKVNCAT 837

Query: 834  LLQTNIRALWKREYYRAAIGQIIKLQCTCKRKLILDSVNRKFMLMAAVIIQSYIRSYGHK 893
            LLQ   R    R    + +  I  LQ   +++L    + ++    AAV IQS +R++  +
Sbjct: 838  LLQAAYRGHSIRANVFSVLRTITNLQKKIRKELKQRQLKQEHEYNAAVTIQSKVRTFEPR 897

Query: 894  TDYRTLKRSSILVQSAMRMQLARRRYIVLQKEVEERNIRASYGIGLLEEAIEFKNSF--- 950
            + +   K+ +++VQS +R + A+R+   L+ + +  N        L  + IE   +    
Sbjct: 898  SRFLRTKKDTVVVQSLIRRRAAQRKLKQLKADAKSVNHLKEVSYKLENKVIELTQNLASK 957

Query: 951  ----------ILNLEMLNDSYTRLTQLLQG-------DLSNIPSKQRQEYETIVNGYNDK 993
                      I  L++  +   +L + L+        D+ N  SK  +  +TI N     
Sbjct: 958  VKENKEMTERIKELQVQVEESAKLQETLENMKKEHLIDIDNQKSKDMELQKTIENNLQST 1017

Query: 994  ISKLKTLQVEIMNTXXXXXXXXXXXXXQSSLIQSHMQSLA---AIKGNKPSRLSDEVKSM 1050
               LK  Q+E+ +              Q   ++   ++L     + G+    L +EVKS+
Sbjct: 1018 EQTLKDAQLELEDMVKQHDELKEESKKQLEELEQTKKTLVEYQTLNGD----LQNEVKSL 1073

Query: 1051 KQELAFIENVIAQDFTTTYSANKN--DKVKGLG--------IAGQQVKPKLVNV------ 1094
            K+E+A ++  ++    TT    +     V G G        +    + P  +N+      
Sbjct: 1074 KEEIARLQTAMSLGTVTTSVLPQTPLKDVMGGGASNFNNMMLENSDLSPNDLNLKSRSTP 1133

Query: 1095 -----------IRRESG------NPDLLELLMDLNCYTLEVTEGYLKKVNV------TEV 1131
                       + RE+G      N +L  LL D      E+TEG LK   V       ++
Sbjct: 1134 SSGNNHIDSLSVDRENGVNATQINEELYRLLEDTEILNQEITEGLLKGFEVPDAGVAIQL 1193

Query: 1132 NGDNVLGPIHVITTVVSSLVRNGLLIQSSKFISKVLLTVESIVMSLPKDETMLGGIFWLS 1191
            +  +V+ P  ++  V+S + R GL  QS  F+++VL T++ +V  L  ++ +  G+FWL+
Sbjct: 1194 SKRDVVYPARILIIVLSEMWRFGLTKQSESFLAQVLTTIQKVVTQLKGNDLIPSGVFWLA 1253

Query: 1192 NLSRLPAFA--ANQKTLYE---ANG-GDEKDKLTLIYLNDLENETLKVFDKIYSTWLVKF 1245
            N+  L +F   A    L E    NG  DE+ K  +  + +L+++   +   IY+ WL K 
Sbjct: 1254 NVRELYSFVVFALNSILTEETFKNGMTDEEYKEYVSLVTELKDDFEALSYNIYNIWLKK- 1312

Query: 1246 MKHASAHIEIFDMVLNE---------------KLFKNSGDEKFAKLFTFLNEFDAVLCKF 1290
            ++       I  +V++E               K+F N+ +     + TF N     +  F
Sbjct: 1313 LQKQLQKKAINAVVISESLPGFSAGETSGFLNKIFANTEEYTMDDILTFFNSIYWCMKSF 1372

Query: 1291 QVVDSMHTKIFNDTLKYLNVMLFNDLITKCPALNWKYGYEVDRNIERLVSWFEPR-IEDV 1349
             + + +   +    L Y++ + FN+LI K   L+WK G +++ N+ RL  W +   + D 
Sbjct: 1373 HIENEVFHAVVTTLLNYVDAICFNELIMKRNFLSWKRGLQLNYNVTRLEEWCKTHGLTDG 1432

Query: 1350 RPNLIQIIQAVKILQLKISNLNEFKLLFDFWYALNPAQIQAILLKYKPANKGEAGVPNEI 1409
               L  +IQ  K+LQ++   + +  +L    Y+L PAQ+Q ++ +Y+ A+  E+ +P EI
Sbjct: 1433 TECLQHLIQTAKLLQVRKYTIEDIDILRGICYSLTPAQLQKLISQYQVADY-ESPIPQEI 1491

Query: 1410 LNYLANVIKRE 1420
            L Y+A+++K+E
Sbjct: 1492 LRYVADIVKKE 1502

>Scas_663.26
          Length = 1567

 Score = 1385 bits (3584), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 753/1517 (49%), Positives = 990/1517 (65%), Gaps = 102/1517 (6%)

Query: 1    MSFEVGTKCWYPHKEQGWIGGEVTKNDFFEGTFHLELKLEDGETVSIETNSFENDDDHPT 60
            MSFEVGT+CWYP KEQGWIG EVTKND  +GT+ +EL LED E V++ET    N+ D P+
Sbjct: 1    MSFEVGTRCWYPSKEQGWIGAEVTKNDLKDGTYFMELTLEDNEVVNVETKDLTNEKD-PS 59

Query: 61   LPVLRNPPILESTDDLTTLSYLNEPAVLHAIKKRYMNGQIYTYSGIVLIAANPFDKVDHL 120
            LP+LRNPPILEST+DLTTLSYLNEPAVLHAIK+RY    IYTYSGIVLIA NPFD++D L
Sbjct: 60   LPLLRNPPILESTEDLTTLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRMDQL 119

Query: 121  YSREMIQNYSSKRKDELEPHLFAIAEEAYRFMVHEKANQTVVVSGESGAGKTVSAKYIMR 180
            YS++MIQ YS KR+ E+EPHLFAIAEEAYR M ++K NQT+VVSGESGAGKTVSAKYIMR
Sbjct: 120  YSQDMIQAYSGKRRGEIEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMR 179

Query: 181  YFASVQESN-----NREGEVEMSQIESQILATNPIMEAFGNAKTTRNDNSSRFGKYLQIL 235
            YFAS  E N     N +   EMS+ E +ILATNPIMEAFGNAKTTRNDNSSRFGKYL+IL
Sbjct: 180  YFASCDEENSSNMGNLQHTAEMSETEERILATNPIMEAFGNAKTTRNDNSSRFGKYLEIL 239

Query: 236  FDENTTIRGSKIRTYLLEKSRLVYQPETERNYHIFYQILEGLPEPVKQELHLSSPKDYHY 295
            FD+ T I G+K+RTYLLE+SRLVYQP+TERNYHIFYQIL GLPE VKQELHL+   DY Y
Sbjct: 240  FDKETAIIGAKMRTYLLERSRLVYQPKTERNYHIFYQILAGLPEDVKQELHLTKADDYFY 299

Query: 296  TNQGGQPNIAGIDEAREYKITTDALSLVGINHETQLGIFKILAGLLHIGNIEMKMTRNDA 355
             NQGG+P IAGID+  EY IT  AL+LVG+  ETQ  IFKILA LLHIGNIE+K TRND+
Sbjct: 300  MNQGGEPEIAGIDDVSEYGITIKALTLVGVAPETQQHIFKILAALLHIGNIEIKKTRNDS 359

Query: 356  SLSSEEQNLQIACELLGIDPFNFAKWIVKKQIVTRSEKIVTNLNYNQALIARDSVAKFIY 415
            SLSS+E NL+IACELLG+DP NFAKWI KKQIVTRSEKIV+NLNY+QAL+ARDSVAKFIY
Sbjct: 360  SLSSDEPNLKIACELLGVDPSNFAKWITKKQIVTRSEKIVSNLNYSQALVARDSVAKFIY 419

Query: 416  STLFDWLVDNINKTLYDPELDQQDHVFSFIGILDIYGFEHFEKNSFEQFCINYANEKLQQ 475
            S LFDWLV NIN  L +P +   D + SFIG+LDIYGFEHFEKNSFEQFCINYANEKLQQ
Sbjct: 420  SALFDWLVTNINTVLCNPAV--LDQIHSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQ 477

Query: 476  EFNQHVFKLEQEEYVKEEIEWSFIEFSDNQPCIDLIENKLGILSLLDEESRLPSGSDESW 535
            EFNQHVFKLEQEEY+KEEIEWSFIEF+DNQPCIDLIENKLGILSLLDEESRLP+GSDESW
Sbjct: 478  EFNQHVFKLEQEEYIKEEIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDESW 537

Query: 536  ASKLYSAFNKPPSNEVFSKPRFGQTKFIVSHYAVDVEYEVEGFIEKNRDSVSLGHLDVFK 595
              KLY   +KPP+N+VFSKPRFGQTKF+VSHYA+DV Y+VEGFIEKNRD+VS GHL+V K
Sbjct: 538  TQKLYQTLDKPPTNKVFSKPRFGQTKFVVSHYALDVAYDVEGFIEKNRDTVSDGHLEVLK 597

Query: 596  ATTNPIFKQILDN--------RELRSDDAPEEQNTEKKIMIPARLSQKKPTLGSMFKKSL 647
            ATTN     IL++         E + + A ++Q   KK   P R  Q+KPTLGSMFK SL
Sbjct: 598  ATTNDTLSTILESVEESARKVEEAKKNAASQDQKQLKK-PTPIRQVQRKPTLGSMFKLSL 656

Query: 648  GELMAIINSTNVHYIRCIKPNSEKKPWEFDNLMVLSQLRACGVLETIRISCAGFPSRWTF 707
             ELM  INSTNVHYIRCIKPN EK+ W+FDNLMVLSQLRACGVLETIRISCAGFPSRWTF
Sbjct: 657  IELMQTINSTNVHYIRCIKPNGEKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTF 716

Query: 708  DEFVQRYFLLTDYSLWSGILYNPDLPKEAIVNFCQSILDATISDSAKYQIGNTKIFFKAG 767
            +EF+ RY++L     W+ I    DL ++ ++N C+ IL AT+ D  KYQIGNTKIFFKAG
Sbjct: 717  NEFILRYYILIPPVEWAPIFQKNDLTEQDVINLCKKILAATVQDKEKYQIGNTKIFFKAG 776

Query: 768  MLAFLEKLRTNKMNEICIIIQKKIRARYYRLQYLQTMESIKKCQSQIRSLLVRTRVDHEL 827
            MLA+ EKLR+ KMN   ++IQK IR++YYR QY+    S+    +  +  ++R RV++EL
Sbjct: 777  MLAYFEKLRSTKMNSAIVLIQKHIRSKYYRKQYMLMKASLSLLGAYSKGTVIRQRVEYEL 836

Query: 828  KTRAAILLQTNIRALWKREYYRAAIGQIIKLQCTCKRKLILDSVNRKFMLMAAVIIQSYI 887
            +  AA L+QT  R   KR Y    I  I+KLQ   + +L    +  K+   AA+ IQS I
Sbjct: 837  EQHAATLIQTMYRGYSKRSYISGVISSIVKLQSRIREELEQREMQSKYESNAAISIQSRI 896

Query: 888  RSYGHKTDYRTLKRSSILVQSAMRMQLARRRYIVLQKEVEERNIRASYGIGLLEEAIEFK 947
            R++  +  Y + +R +I+VQS +R ++A+R +  L+ + +  +        L  + I+  
Sbjct: 897  RAFVPRKAYESKRRDTIVVQSLIRRRIAQRDFKKLKADAKSVHHLKEVSYKLENKVIQLT 956

Query: 948  NSFILNLEMLNDSYTRLTQLLQGDLSNIPSKQRQ-EYETIVN---------GY------- 990
             +    ++  N   ++  + LQ  +  +   Q Q E + + N         G+       
Sbjct: 957  QNLAAKVKE-NRQLSKRLEELQATMVTVSELQDQLEAQKMENQKALADQKDGFVLDSKSL 1015

Query: 991  NDKISK----LKTLQVEIMNTXXXXXXXXXXXXXQSSLIQSHMQSLAAIKGNKPSRLSDE 1046
             D++ K    +++++ E+                Q   ++   ++L      + S L  E
Sbjct: 1016 KDQLIKANKDVESVKFELATLTAKYTEMEAESKNQLDELE-RTKTLLTESKTQNSDLYSE 1074

Query: 1047 VKSMKQELAFIENVIAQDFTTT------YSANKNDKVKG--LGIAGQQVKPKLVNVIRRE 1098
            +KS+K+ELA ++  IA    TT      ++ ++ +++    +  A + + P  +  I  +
Sbjct: 1075 IKSLKEELAHLQTSIALGTVTTNTNIVPHTPSRENRMPSGHMRAAEENISPNQLKSIPSD 1134

Query: 1099 SG------------------------NPDLLELLMDLNCYTLEVTEGYLKKVNV------ 1128
            +                         N +L  LL   +    E+TEG LK   V      
Sbjct: 1135 TAADHVSVNGYGMDDDIINTNTLTQINEELYRLLEGTDVLNNEITEGLLKGFQVPDAGVA 1194

Query: 1129 TEVNGDNVLGPIHVITTVVSSLVRNGLLIQSSKFISKVLLTVESIVMSLPKDETMLGGIF 1188
             +++  +V+ P  ++  V+S + R GL  QS  F+++VL T++ +V +L   + +  G F
Sbjct: 1195 IQLSRRDVVYPARILIIVLSEMWRFGLTKQSESFLAQVLTTIQKVVTTLKGIDLIPSGAF 1254

Query: 1189 WLSNLSRLPAFA--ANQKTLYEAN----GGDEKDKLTLIYLNDLENETLKVFDKIYSTWL 1242
            WL+N+  L +F   A    L E +      DE+    +  + +L+ +   +   IY+ WL
Sbjct: 1255 WLANVRELYSFVVFAQHSILTEESFKKGMNDEEYNEYVSLVTELKEDFESLSYNIYNIWL 1314

Query: 1243 VKFMKHASAHIEIFDMVLNEKL--------------FKNSGDE-KFAKLFTFLNEFDAVL 1287
             K ++       I  +V++E L                NSG+E     + TF N     +
Sbjct: 1315 KK-LQKDLQKKAINAVVVSESLPGFNASESNGFLNKIFNSGEEYTMDDILTFFNNIFWCM 1373

Query: 1288 CKFQVVDSMHTKIFNDTLKYLNVMLFNDLITKCPALNWKYGYEVDRNIERLVSWFEPR-I 1346
              F + + +   +    L Y++ + FNDLI K   L+WK G +++ N+ RL  W +   +
Sbjct: 1374 KSFHIENEVFRTVIITLLNYVDTICFNDLIMKRNFLSWKRGLQLNYNVTRLEEWCKTHGL 1433

Query: 1347 EDVRPNLIQIIQAVKILQLKISNLNEFKLLFDFWYALNPAQIQAILLKYKPANKGEAGVP 1406
             D    L  +IQ  K+LQL+   + +  ++     +L+PAQ+Q ++ +Y  A+  E+ +P
Sbjct: 1434 PDGAQYLQHLIQTAKLLQLRKYTIEDIDMVRGICSSLSPAQLQKLISQYHVADY-ESPIP 1492

Query: 1407 NEILNYLANVIKRENLS 1423
             +IL Y+A+++K+E+ S
Sbjct: 1493 QDILKYVADIVKKESTS 1509

>CAGL0F00671g complement(73893..78593) highly similar to sp|P19524
            Saccharomyces cerevisiae YOR326w MYO2 or sp|P32492
            Saccharomyces cerevisiae YAL029c MYO4, start by
            similarity
          Length = 1566

 Score = 1367 bits (3538), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 737/1506 (48%), Positives = 988/1506 (65%), Gaps = 96/1506 (6%)

Query: 1    MSFEVGTKCWYPHKEQGWIGGEVTKNDFFEGTFHLELKLEDGETVSIETNSFENDDDHPT 60
            MSFEVGT+CWYP KE GWIG EVTKND  +GT+H+EL LEDG++V+IET    ++ D  +
Sbjct: 1    MSFEVGTRCWYPSKELGWIGAEVTKNDLKDGTYHMELALEDGKSVNIETKDLTDESDE-S 59

Query: 61   LPVLRNPPILESTDDLTTLSYLNEPAVLHAIKKRYMNGQIYTYSGIVLIAANPFDKVDHL 120
            LP+LRNPPILE+T+DLT+LSYLNEPAVLHAIK+RY    IYTYSGIVLIA NPFD+VD L
Sbjct: 60   LPLLRNPPILEATEDLTSLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRVDQL 119

Query: 121  YSREMIQNYSSKRKDELEPHLFAIAEEAYRFMVHEKANQTVVVSGESGAGKTVSAKYIMR 180
            YS++MIQ Y+ K++ E+EPHLFAIAEEAYR M   K NQT+VVSGESGAGKTVSAKYIMR
Sbjct: 120  YSQDMIQAYAGKQRGEMEPHLFAIAEEAYRLMKDNKENQTIVVSGESGAGKTVSAKYIMR 179

Query: 181  YFASVQESNNR--EGEVEMSQIESQILATNPIMEAFGNAKTTRNDNSSRFGKYLQILFDE 238
            YFASV+E N+   + +VEMS+ E +ILATNPIMEAFGNAKTTRNDNSSRFGKYL+ILFD+
Sbjct: 180  YFASVEEENSMTVQHQVEMSETEQKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDK 239

Query: 239  NTTIRGSKIRTYLLEKSRLVYQPETERNYHIFYQILEGLPEPVKQELHLSSPKDYHYTNQ 298
            +T+I G+KIRTYLLE+SRLVYQPETERNYHIFYQ++ GL    K ELHL   +DY+Y NQ
Sbjct: 240  DTSIIGAKIRTYLLERSRLVYQPETERNYHIFYQMMAGLSPKEKAELHLKGAEDYYYMNQ 299

Query: 299  GGQPNIAGIDEAREYKITTDALSLVGINHETQLGIFKILAGLLHIGNIEMKMTRNDASLS 358
            GG   I G+D+ +EY  T DAL+LVGI++ETQ  IFKILA LLHIGNIE+K TRNDASLS
Sbjct: 300  GGDVKIEGVDDKQEYNTTVDALTLVGISNETQQHIFKILAALLHIGNIEIKKTRNDASLS 359

Query: 359  SEEQNLQIACELLGIDPFNFAKWIVKKQIVTRSEKIVTNLNYNQALIARDSVAKFIYSTL 418
            S+E+NL+IACELLGID FNFAKWI KKQI+TRSEKIV+NLNY+QAL+ARDSVAKFIYS L
Sbjct: 360  SDEENLKIACELLGIDSFNFAKWITKKQIITRSEKIVSNLNYSQALVARDSVAKFIYSAL 419

Query: 419  FDWLVDNINKTLYDPELDQQDHVFSFIGILDIYGFEHFEKNSFEQFCINYANEKLQQEFN 478
            FDWLV+NIN  L +P +   D V SFIG+LDIYGFEHFEKNSFEQFCINYANEKLQQEFN
Sbjct: 420  FDWLVENINTVLCNPAV--VDKVASFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFN 477

Query: 479  QHVFKLEQEEYVKEEIEWSFIEFSDNQPCIDLIENKLGILSLLDEESRLPSGSDESWASK 538
            QHVFKLEQEEYVKE+IEWSFIEF+DNQPCIDLIENKLGILSLLDEESRLP+GSDESW  K
Sbjct: 478  QHVFKLEQEEYVKEQIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDESWTQK 537

Query: 539  LYSAFNKPPSNEVFSKPRFGQTKFIVSHYAVDVEYEVEGFIEKNRDSVSLGHLDVFKATT 598
            LY   +KPP+N+VFSKPRFGQTKF+VSHYA+DV Y+VEGFIEKNRD+VS GHL+V KA+T
Sbjct: 538  LYQTLDKPPTNKVFSKPRFGQTKFVVSHYALDVAYDVEGFIEKNRDTVSDGHLEVLKAST 597

Query: 599  NPIFKQILDNRELRS----DDAPEEQNTEKKIMIPARLSQKKPTLGSMFKKSLGELMAII 654
            N     ILD  E  +    D    EQ ++     P R  Q+KPTLGSMFK+SL ELM  I
Sbjct: 598  NETLINILDTLERNANKLEDAKKAEQESKPAKPGPMRTVQRKPTLGSMFKQSLIELMTTI 657

Query: 655  NSTNVHYIRCIKPNSEKKPWEFDNLMVLSQLRACGVLETIRISCAGFPSRWTFDEFVQRY 714
             STN HYIRCIKPN++K+ W+FDNLMVLSQLRACGVLETIRISCAGFPSRWTF+EF+ RY
Sbjct: 658  RSTNAHYIRCIKPNNDKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTFNEFILRY 717

Query: 715  FLLTDYSLWSGILYNPDLPKEAIVNFCQSILDATISDSAKYQIGNTKIFFKAGMLAFLEK 774
            ++L   S WS I    D+ ++ ++  C  IL  T+ +  KYQIGNTKIFFKAGMLAFLEK
Sbjct: 718  YILLPASEWSFIFTKKDMTEDDVIGLCNKILAVTVKEKEKYQIGNTKIFFKAGMLAFLEK 777

Query: 775  LRTNKMNEICIIIQKKIRARYYRLQYLQTMESIKKCQSQIRSLLVRTRVDHELKTRAAIL 834
            LR++KM+   ++IQK IRA+YYR ++L+ M +I   Q +++  + R+ +D E K +AA  
Sbjct: 778  LRSDKMHISSVLIQKNIRAKYYRREFLRIMSAITSLQQRVKGEVRRSIIDREFKNKAATE 837

Query: 835  LQTNIRALWKREYYRAAIGQIIKLQCTCKRKLILDSVNRKFMLMAAVIIQSYIRSYGHKT 894
            +Q+ +R   +R    + I  I  +Q   +++L       +    AAV IQS +RS+  + 
Sbjct: 838  IQSLLRGYRRRSQILSIISSIRCIQLKVRKELNRKHAQVQHETDAAVAIQSKVRSFKPRK 897

Query: 895  DYRTLKRSSILVQSAMRMQLARRRYIVLQKEVEERNIRASYGIGLLEEAIEFKNSFILNL 954
             +   +R +++VQS +R + A+++   L+ + +  N        L  + +E   +    +
Sbjct: 898  AFLEDRRKTVVVQSLIRRRFAQKKLKQLKADAKSVNHLKEVSYKLENKVVELTQNLAAKV 957

Query: 955  EMLNDSYTRLTQ---------LLQGDLSNIPSKQRQEYETIVNGYNDKISKLK------T 999
            +       R+ +         LLQ +L  I SK   E     + + +K  +++       
Sbjct: 958  KENKSLSARVVELQTSLEESALLQEELKQIKSKHDAELLEQKDVFAEKGKQIEEELNAAN 1017

Query: 1000 LQVEIMNTXXXXXXXXXXXXXQSSLIQSHMQSLAAIKGNK------PSRLSDEVKSMKQE 1053
            LQVE   +              ++  +S+++ L   K          S L +EV S+K+E
Sbjct: 1018 LQVEEYKSKLLDLTQEYEEHKATT--KSYLEELEKTKAELIEVQTFNSDLQNEVNSLKEE 1075

Query: 1054 LAFIE----------NVIAQDFTTTYSANKNDKVKGLGIA-GQQVKPKLVNVIRRESG-- 1100
            L+ ++          NV+ Q  +      +N    G  I  G ++  + VN   +++G  
Sbjct: 1076 LSRLQTQISLGTVTANVLPQTPSKDIHMQRN-VTNGTDIGPGSELNVRPVN--SKDAGSV 1132

Query: 1101 ------------------NPDLLELLMDLNCYTLEVTEGYLKKVNV------TEVNGDNV 1136
                              N +L  LL D+     E+T+G LK   V       +++  +V
Sbjct: 1133 SNMGMDSYASDSNALTQINEELFRLLEDIEVLNNEITDGLLKDFEVPAAGVGMQLSRRDV 1192

Query: 1137 LGPIHVITTVVSSLVRNGLLIQSSKFISKVLLTVESIVMSLPKDETMLGGIFWLSNLSRL 1196
            + P  ++  ++S + R GL  QS  F+++VL T++ +V +L  ++ +  G FWL+N+  L
Sbjct: 1193 VYPARILIIILSEMWRFGLTKQSEGFLAQVLTTIQKVVTTLKGNDLIPAGAFWLANVREL 1252

Query: 1197 PAFA--ANQKTL----YEANGGDEKDKLTLIYLNDLENETLKVFDKIYSTWLVKFMKHAS 1250
             +F   A    L    +++   D++ K  +  + +L+ +   +   IY+ WL K  +   
Sbjct: 1253 YSFVVFAQHSILTEESFKSGMTDDEYKEYVSLVTELKEDFESLSYNIYNIWLKKLQRELQ 1312

Query: 1251 AHIEIFDMVLNE---------------KLFKNSGDEKFAKLFTFLNEFDAVLCKFQVVDS 1295
                +  +VL+E               K+F +  +     + TF N     +  FQ+ + 
Sbjct: 1313 KKA-VNAVVLSEALPGFSAGQSGGLLNKIFSSGEEYTMDDILTFFNSIYWSMKSFQIENE 1371

Query: 1296 MHTKIFNDTLKYLNVMLFNDLITKCPALNWKYGYEVDRNIERLVSWFEPR-IEDVRPNLI 1354
            +  K+    L Y++ + FNDLI K   L+WK G +++ N+ RL  W +   + D    L 
Sbjct: 1372 VFHKVVTTLLNYVDAICFNDLIMKRNFLSWKRGLQLNYNVTRLEEWCKTHGVPDGTDCLQ 1431

Query: 1355 QIIQAVKILQLKISNLNEFKLLFDFWYALNPAQIQAILLKYKPANKGEAGVPNEILNYLA 1414
             +IQ  K+LQ++  ++ +  +L     +L PAQ+Q ++ +Y+ A+  E+ +P EIL Y+A
Sbjct: 1432 HLIQTSKLLQVRKYSIEDIDILRGICSSLTPAQLQKLITQYQVADY-ESPIPQEILKYVA 1490

Query: 1415 NVIKRE 1420
            +++K E
Sbjct: 1491 DIVKSE 1496

>ADR354W [2095] [Homologous to ScYOR326W (MYO2) - SH; ScYAL029C (MYO4)
            - SH] complement(1328357..1333033) [4677 bp, 1558 aa]
          Length = 1558

 Score = 1353 bits (3502), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 729/1499 (48%), Positives = 974/1499 (64%), Gaps = 80/1499 (5%)

Query: 1    MSFEVGTKCWYPHKEQGWIGGEVTKNDFFEGTFHLELKLEDGETVSIETNSFENDDDHPT 60
            MS+EVGT+CWYP KEQGWIGGE+TK+      + L+L LE+GE V I   S E +     
Sbjct: 1    MSYEVGTRCWYPDKEQGWIGGEITKHRLVGDKYQLDLTLENGEVVEITAPSVE-EGSCEE 59

Query: 61   LPVLRNPPILESTDDLTTLSYLNEPAVLHAIKKRYMNGQIYTYSGIVLIAANPFDKVDHL 120
            LP+LRNPPILE+T+DLT+LSYLNEPAVLHAIK RY    IYTYSGIVLIA NPFD+VD L
Sbjct: 60   LPLLRNPPILEATEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDRVDQL 119

Query: 121  YSREMIQNYSSKRKDELEPHLFAIAEEAYRFMVHEKANQTVVVSGESGAGKTVSAKYIMR 180
            YS++MIQ Y+ +R+ ELEPHLFAIAEEAY  M + K NQT+VVSGESGAGKTVSAKYIMR
Sbjct: 120  YSQDMIQAYAGRRRGELEPHLFAIAEEAYSLMKNSKQNQTIVVSGESGAGKTVSAKYIMR 179

Query: 181  YFASVQESN-----NREGEVEMSQIESQILATNPIMEAFGNAKTTRNDNSSRFGKYLQIL 235
            YFA+V++SN          +EMS+ E +ILATNPIMEAFGNAKTTRNDNSSRFGKYL+IL
Sbjct: 180  YFATVEQSNLVGSGGSMHHIEMSETEKKILATNPIMEAFGNAKTTRNDNSSRFGKYLEIL 239

Query: 236  FDENTTIRGSKIRTYLLEKSRLVYQPETERNYHIFYQILEGLPEPVKQELHLSSPKDYHY 295
            FD++ +I G++IRTYLLE+SRLV+QP +ERNYHIFYQ+L GLPE  K+EL L   ++YHY
Sbjct: 240  FDKDISIIGARIRTYLLERSRLVFQPPSERNYHIFYQLLAGLPEETKKELKLGGVEEYHY 299

Query: 296  TNQGGQPNIAGIDEAREYKITTDALSLVGINHETQLGIFKILAGLLHIGNIEMKMTRNDA 355
             NQGG   I G+D+  EY ITT ALSLV I   TQ  +FK+LA LLHIGNI++K TRNDA
Sbjct: 300  MNQGGASEIQGVDDREEYAITTKALSLVDITERTQTALFKVLAALLHIGNIDVKKTRNDA 359

Query: 356  SLSSEEQNLQIACELLGIDPFNFAKWIVKKQIVTRSEKIVTNLNYNQALIARDSVAKFIY 415
            S+S+ + +L+IACELLGID +NFAKWI KKQI TRSEKIV+NLNY QA++ARDSVAKFIY
Sbjct: 360  SVSATDPSLEIACELLGIDAYNFAKWITKKQITTRSEKIVSNLNYGQAVVARDSVAKFIY 419

Query: 416  STLFDWLVDNINKTLYDPELDQQDHVFSFIGILDIYGFEHFEKNSFEQFCINYANEKLQQ 475
            S LFDWLV+NIN  L +P +   + + SFIG+LDIYGFEHFEKNSFEQFCINYANEKLQQ
Sbjct: 420  SALFDWLVENINNVLCNPAV--INEIASFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQ 477

Query: 476  EFNQHVFKLEQEEYVKEEIEWSFIEFSDNQPCIDLIENKLGILSLLDEESRLPSGSDESW 535
            EFNQHVFKLEQEEYVKEEI+WSFIEF+DNQPCIDLIENKLGILSLLDEESRLP+GSDE+W
Sbjct: 478  EFNQHVFKLEQEEYVKEEIQWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDETW 537

Query: 536  ASKLYSAFNKPPSNEVFSKPRFGQTKFIVSHYAVDVEYEVEGFIEKNRDSVSLGHLDVFK 595
              KLY   +KPP+N VFSKPRFGQTKF+VSHYA DV Y+VEGFIEKNRD+VS GHL+V K
Sbjct: 538  TQKLYQTLDKPPTNTVFSKPRFGQTKFVVSHYAHDVAYDVEGFIEKNRDTVSDGHLEVLK 597

Query: 596  ATTNPIFKQILDNRELRSDDAPEEQNTEKKIMIPARLSQKKPTLGSMFKKSLGELMAIIN 655
             +TN     IL+  +  +    E+  ++KK     R   +KPTLGS+FK+SL ELM+ IN
Sbjct: 598  GSTNETLLAILETIDRNAAKLAEKLESQKKPGPTTRTVNRKPTLGSLFKQSLVELMSTIN 657

Query: 656  STNVHYIRCIKPNSEKKPWEFDNLMVLSQLRACGVLETIRISCAGFPSRWTFDEFVQRYF 715
            STNVHYIRCIKPN EK+ W+FDNLMVLSQLRACGVLETIRISCAGFP+RWT+DEF  RY 
Sbjct: 658  STNVHYIRCIKPNEEKEAWKFDNLMVLSQLRACGVLETIRISCAGFPTRWTYDEFALRYH 717

Query: 716  LLTDYSLWSGILYNPDLPKEAIVNFCQSILDATISDSAKYQIGNTKIFFKAGMLAFLEKL 775
            +L   + W+ I +     +E I   C++ILD T++D  KYQ+GNTKIFFKAGMLAFLEK 
Sbjct: 718  ILVPSTNWTKI-FATGTTEEEINQLCKNILDTTVTDKEKYQLGNTKIFFKAGMLAFLEKK 776

Query: 776  RTNKMNEICIIIQKKIRARYYRLQYLQTMESIKKCQSQIRSLLVRTRVDHELKTRAAILL 835
            RT+K+N    +IQKKI+  YYR +YL+   +IK+  S  +  L+R R+D E KT AAI +
Sbjct: 777  RTDKLNSSSTMIQKKIKGIYYRRRYLEITNAIKRTHSVAKGNLLRARIDLEFKTWAAITI 836

Query: 836  QTNIRALWKREYYRAAIGQIIKLQCTCKRKLILDSVNRKFMLMAAVIIQSYIRSYGHKTD 895
            Q+  R    R      +  II+ Q   +R L    +  +    AA+ IQ  IR++  +T 
Sbjct: 837  QSLYRGSLIRRDTIHLLDSIIRTQSLLRRSLARKELRARLETDAAITIQKNIRAFKPRTS 896

Query: 896  YRTLKRSSILVQSAMRMQLARRRYIVLQKEVEERNIRASYGIGLLEEAIEFKNSFILNLE 955
            Y T +RS+I+VQS +R + A+R+   L++E +  +        L  + IE   S    ++
Sbjct: 897  YITNRRSTIVVQSLVRRRFAKRKLETLKQEAKSVSHLKEVSYKLENKVIELTESLAAKVK 956

Query: 956  MLNDSYTRLT--QLLQGDLSNI----PSKQR-------QEYETIVNGYNDKISKLKTLQV 1002
               D  +R+   QL   + +NI     +KQ        Q+ +T    Y +   +L     
Sbjct: 957  ENKDLNSRIKELQLSLNESANIRELLKTKQEEYRKSIDQQKDTHAAAYEEVTGRLTLAMK 1016

Query: 1003 EIMNTXXXXXXXXXXXXXQSSLIQSHMQSLAAIKGN------KPSRLSDEVKSMKQELAF 1056
            E+ +                  +++ ++ L+ ++ +      + S LS+EV S+K+E+A 
Sbjct: 1017 EVDDARQEIDQLKSKQEDLKLEVKAKIEELSKVRQDLSDSRTQNSDLSNEVSSLKEEIAR 1076

Query: 1057 IENVIAQ-DFTTTYSANKNDKVKGLGIAGQQVKPKLVNVIRRESG--------------- 1100
            + N I     T T S  ++ ++           PK  NV+   +G               
Sbjct: 1077 LHNAIRNAPATGTLSPTRSKRISSYSGLDNIGSPKQWNVVSLNNGLMEEETRSIMSQLSQ 1136

Query: 1101 -NPDLLELLMDLNCYTLEVTEGYLKKVNVTE------VNGDNVLGPIHVITTVVSSLVRN 1153
             N +L +LL D    T E+ EG LK   + +      +    VL P  V+  ++S + R 
Sbjct: 1137 INDELYKLLNDDRPLTSEIVEGLLKSGKIPQPGFAANLTRKEVLYPARVLIIILSDMWRL 1196

Query: 1154 GLLIQSSKFISKVLLTVESIVMSLPKDETMLGGIFWLSNLSRLPAFAA--------NQKT 1205
            GL  QS +F+++VL T++++V +L  D  ++ G FWL+N+  L +FA         +   
Sbjct: 1197 GLTEQSERFLAEVLSTIQTLVTNLKGDNVIINGAFWLTNVRELYSFAIYAHDSILNDNAY 1256

Query: 1206 LYEANGGDEKDKLTLIYLNDLENETLKVFDKIYSTWLVKFMKHASAHIEIFDMVLNE--- 1262
            + + N  + K  +TL+ +   + E+L     IY+ WL K  K       +  +V+++   
Sbjct: 1257 IKDLNEDEYKQYVTLVSVLKDDFESLSY--NIYNIWLKKLQKELEKRA-VSAVVMSQSLP 1313

Query: 1263 ------------KLFKNSGDEKFAKLFTFLNEFDAVLCKFQVVDSMHTKIFNDTLKYLNV 1310
                        K+F +S   K   + TF N     +  + V   ++ ++    L+Y++ 
Sbjct: 1314 GFIVPESSAFLPKIFSSSSSYKMDDILTFFNTIYWSMKAYHVETEVYREVIMSLLRYVDA 1373

Query: 1311 MLFNDLITKCPALNWKYGYEVDRNIERLVSWFE-PRIEDVRPNLIQIIQAVKILQLKISN 1369
            + FNDLI K   L+WK G +++ N+ RL  W +   I +    L  ++QA K+LQLK +N
Sbjct: 1374 ICFNDLIMKRNFLSWKRGLQLNYNVTRLEEWCKVHHIPEGSDCLEHMLQASKLLQLKKAN 1433

Query: 1370 LNEFKLLFDFWYALNPAQIQAILLKYKPANKGEAGVPNEILNYLANVIKREN-LSLPGK 1427
            + +  ++++   +L PAQIQ ++ +Y  A+  E  +P EIL+++A+ +K+E+ LS  GK
Sbjct: 1434 MEDINIIWEICSSLKPAQIQKLISQYSAADY-EVPIPQEILSFVADRVKKESALSNDGK 1491

>Kwal_26.7055
          Length = 1555

 Score = 1350 bits (3493), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 741/1499 (49%), Positives = 982/1499 (65%), Gaps = 81/1499 (5%)

Query: 1    MSFEVGTKCWYPHKEQGWIGGEVTK-NDFFEGTFHLELKLEDGETVSIETNSFENDDDHP 59
            MSFEVGT+CWYP K++GW+G EVTK +   EG F LELKLE+GETV IET +  N+  + 
Sbjct: 1    MSFEVGTRCWYPDKKEGWVGSEVTKFSQPEEGKFLLELKLENGETVEIETETL-NESQNE 59

Query: 60   TLPVLRNPPILESTDDLTTLSYLNEPAVLHAIKKRYMNGQIYTYSGIVLIAANPFDKVDH 119
             LP+LRNPPILE+ +DLT+LSYLNEPAVLHAIK RY    IYTYSGIVLIA NPFD+V+ 
Sbjct: 60   KLPLLRNPPILEAIEDLTSLSYLNEPAVLHAIKARYGQLNIYTYSGIVLIATNPFDRVEQ 119

Query: 120  LYSREMIQNYSSKRKDELEPHLFAIAEEAYRFMVHEKANQTVVVSGESGAGKTVSAKYIM 179
            LYS++MIQ Y+ +R+ ELEPHLFAIA+EAYR M H+K NQT+VVSGESGAGKTVSAKYIM
Sbjct: 120  LYSQDMIQAYAGRRRGELEPHLFAIADEAYRLMKHDKQNQTIVVSGESGAGKTVSAKYIM 179

Query: 180  RYFASVQESN----NREGEVEMSQIESQILATNPIMEAFGNAKTTRNDNSSRFGKYLQIL 235
            RYFASV+++N    + +  ++MS+ E +ILATNPIMEAFGNAKT+RNDNSSRFGKYL+IL
Sbjct: 180  RYFASVEQANADNASSDHHLQMSETEERILATNPIMEAFGNAKTSRNDNSSRFGKYLEIL 239

Query: 236  FDENTTIRGSKIRTYLLEKSRLVYQPETERNYHIFYQILEGLPEPVKQELHLSSPKDYHY 295
            FDE+T+I G++IRTYLLE+SRLV+QP+ ERNYHIFYQ++EGL E  K+ELHL+  +DYHY
Sbjct: 240  FDESTSIIGARIRTYLLERSRLVFQPQVERNYHIFYQLVEGLSESEKEELHLTKVEDYHY 299

Query: 296  TNQGGQPNIAGIDEAREYKITTDALSLVGINHETQLGIFKILAGLLHIGNIEMKMTRNDA 355
              QGG   I G+D+A EY++T DAL +VG + +TQ  +FKILA LLHIGNIE+K TRNDA
Sbjct: 300  LRQGGDYRIKGVDDAAEYQVTVDALKMVGFSQDTQHQLFKILAALLHIGNIEVKKTRNDA 359

Query: 356  SLSSEEQNLQIACELLGIDPFNFAKWIVKKQIVTRSEKIVTNLNYNQALIARDSVAKFIY 415
            SLSS+E NL+IAC+LLGID   F+KWI KKQI TRSEKIV+NL++NQAL+ARDSVAKFI+
Sbjct: 360  SLSSDEPNLKIACDLLGIDASGFSKWITKKQITTRSEKIVSNLSFNQALVARDSVAKFIF 419

Query: 416  STLFDWLVDNINKTLYDPELDQQDHVFSFIGILDIYGFEHFEKNSFEQFCINYANEKLQQ 475
            S LFDWLV+NIN  L +P++   D + SFIG+LDIYGFEHFEKNSFEQFCINYANEKLQQ
Sbjct: 420  SALFDWLVENINTVLCNPQVS--DQISSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQ 477

Query: 476  EFNQHVFKLEQEEYVKEEIEWSFIEFSDNQPCIDLIENKLGILSLLDEESRLPSGSDESW 535
            EFNQHVFKLEQEEYV E+IEWSFIEF+DNQPCIDLIENKLGILSLLDEESRLP+GSDESW
Sbjct: 478  EFNQHVFKLEQEEYVNEQIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDESW 537

Query: 536  ASKLYSAFNKPPSNEVFSKPRFGQTKFIVSHYAVDVEYEVEGFIEKNRDSVSLGHLDVFK 595
              KLY   +KPP+N VFSKPRFGQTKF+VSHYA+DV Y+V GFIEKNRD+VS GHL+V K
Sbjct: 538  TQKLYQTLDKPPTNSVFSKPRFGQTKFVVSHYALDVAYDVGGFIEKNRDTVSDGHLEVLK 597

Query: 596  ATTNPIFKQILDNRELRSDDAPEEQNTEKKIMIPARLSQKKPTLGSMFKKSLGELMAIIN 655
            A+ N     ILD  +  +    E+Q+  KK   PAR+  KKPTLGSMFK+SL ELM  I+
Sbjct: 598  ASKNDTLLSILDTIDKNAAALAEKQDANKKPG-PARMV-KKPTLGSMFKQSLIELMNTID 655

Query: 656  STNVHYIRCIKPNSEKKPWEFDNLMVLSQLRACGVLETIRISCAGFPSRWTFDEFVQRYF 715
            STNVHYIRCIKPN EK+ W+FDNLMVLSQLRACGVLETIRISCAGFPSRWT++EFV RY 
Sbjct: 656  STNVHYIRCIKPNEEKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTYNEFVLRYH 715

Query: 716  LLTDYSLWSGILYNPDLPKEAIVNFCQSILDATISDSAKYQIGNTKIFFKAGMLAFLEKL 775
            +L     W+ I +  +  ++ I N C+ IL AT+ DS KYQ+GNTKIFFKAGMLA+LEKL
Sbjct: 716  ILIPSDNWTKI-FTSEASEDDIRNLCKQILGATVDDSNKYQLGNTKIFFKAGMLAYLEKL 774

Query: 776  RTNKMNEICIIIQKKIRARYYRLQYLQTMESIKKCQSQIRSLLVRTRVDHELKTRAAILL 835
            R+ KM+  C++IQKKI+  YYR QYL    +I   Q+ I     R  VDHE KT AAI L
Sbjct: 775  RSTKMHNSCVLIQKKIKGVYYRKQYLAIKNAIHNVQAVIAGNYCRQSVDHEFKTLAAISL 834

Query: 836  QTNIRALWKREYYRAAIGQIIKLQCTCKRKLILDSVNRKFMLMAAVIIQSYIRSYGHKTD 895
            QT  R + +R+    A+  I+++Q   ++++    V  K    AAV IQ  IR +  +  
Sbjct: 835  QTIFRGVRQRKNATIALASIVRVQSLVRKQIAQKEVLEKRQSEAAVTIQKKIRGFVPRQS 894

Query: 896  YRTLKRSSILVQSAMRMQLARRRYIVLQKEVEERNIRASYGIGLLEEAIEFKNSFILNLE 955
            Y   + SS+ +QS +R +LA+++   L+ + +  N        L  + I+   S    ++
Sbjct: 895  YNATRGSSVKIQSLVRRKLAQKQLKQLKADAKSVNHLQEVSYKLENKVIQLTQSLAEKVK 954

Query: 956  MLNDSYTRLTQLLQGDL---SNIP----------SKQRQEYETIVNG--YNDKISKLKTL 1000
              N   T   Q LQ  L   +NI           S+  QE +T  +    N KI +L   
Sbjct: 955  E-NRDMTAKIQDLQKSLNESANIKSLLDAQKDDHSRDLQEQKTSHDAELANKKI-ELDNA 1012

Query: 1001 QVEIMNTXXXXXXXXXXXXXQSSLIQSHMQSLAAIKG------NKPSRLSDEVKSMKQEL 1054
            + E+                  + +++ ++ L  ++        + S L +EVKS+K E+
Sbjct: 1013 KAEVEAAKKEIEDLLSQQEQLKADVRAKVEELNNVQQEFEDSRTQNSDLRNEVKSLKDEI 1072

Query: 1055 AFIENVIAQDF-TTTYSANKNDKVKGLGIAGQ--QVKPKLVNVIRRESG----------- 1100
              ++  I     + T  A+   K +            P+ +NVI   +G           
Sbjct: 1073 NRLQTSIRSGANSNTILAHTPTKSRRFSAHSSLTDASPRQLNVISMNNGMEDDARSTASA 1132

Query: 1101 ----NPDLLELLMDLNCYTLEVTEGYLKKVNV------TEVNGDNVLGPIHVITTVVSSL 1150
                N +L ++L D     +E+ EG LK   +       E+    VL P  ++  V+S +
Sbjct: 1133 LSQINDELYKILEDTKSLNIEIVEGLLKGFKIPETGVAAELTRKEVLYPARIMIIVLSDM 1192

Query: 1151 VRNGLLIQSSKFISKVLLTVESIVMSLPKDETMLGGIFWLSNLSRLPAFA--ANQKTL-- 1206
             R GL  QS  F+++ + T++ +V  L  D+ +  G FWL+N+  L +F   A +  L  
Sbjct: 1193 WRLGLTKQSESFLAEAMSTIQKLVSGLKGDDMICHGAFWLTNVRELYSFVVFAQESILND 1252

Query: 1207 --YEANGGDEKDKLTLIYLNDLENETLKVFDKIYSTWLVKFMKH-----ASAHI---EIF 1256
              Y +   +++ K  +  + +L+++   +   IY+ WL K  K       SA +    + 
Sbjct: 1253 DSYNSGLNEDEYKEYMTLVTELKDDFESLSYNIYNIWLKKLQKDLEKKAVSAVVMSQSLP 1312

Query: 1257 DMVLNE------KLFKNSGDEKFAKLFTFLNEFDAVLCKFQVVDSMHTKIFNDTLKYLNV 1310
              + NE      KLF  S   K   + TF N     +  + V   +  ++    L+Y++ 
Sbjct: 1313 GFIANESSQFLPKLFSQSNYYKMDDILTFFNNIYWSMKTYHVEQEVFREVIITLLRYVDS 1372

Query: 1311 MLFNDLITKCPALNWKYGYEVDRNIERLVSWFEP-RIEDVRPNLIQIIQAVKILQLKISN 1369
            + FNDLI +   L+WK G +++ N+ RL  W +   I +    L  ++QA K+LQLK +N
Sbjct: 1373 ICFNDLIMRRNFLSWKRGLQLNYNVTRLEEWCKSHHIPEGTDCLQHMLQASKLLQLKKAN 1432

Query: 1370 LNEFKLLFDFWYALNPAQIQAILLKYKPANKGEAGVPNEILNYLANVIKRE-NLSLPGK 1427
            L++  ++++   +L PAQIQ ++ +Y  A+  E  +P EIL ++AN +K E +LS  GK
Sbjct: 1433 LDDIDIIWEICSSLKPAQIQKLITQYAVADY-EVPIPQEILTFVANRVKSESSLSSNGK 1490

>Scas_592.13*
          Length = 1419

 Score = 1312 bits (3396), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 707/1452 (48%), Positives = 949/1452 (65%), Gaps = 100/1452 (6%)

Query: 1    MSFEVGTKCWYPHKEQGWIGGEVTKNDFFEGTFHLELKLEDGETVSIETNSFEN----DD 56
            MSFEVGT+CWYP+ E GWIG EVTKNDF +GT+H+EL  E G  + IET   E+    ++
Sbjct: 1    MSFEVGTRCWYPNSEAGWIGCEVTKNDFQDGTYHIELTSETGLVIPIETKHLESNNAMEN 60

Query: 57   DHPTLPVLRNPPILESTDDLTTLSYLNEPAVLHAIKKRYMNGQIYTYSGIVLIAANPFDK 116
            +H  LPVLRNPPILE+T DLTTLSYLNEPAVLHAIK+RY    IYTYSGIVLIA NPFDK
Sbjct: 61   NHEFLPVLRNPPILEATHDLTTLSYLNEPAVLHAIKERYNQRNIYTYSGIVLIATNPFDK 120

Query: 117  VDHLYSREMIQNYSSKRKDELEPHLFAIAEEAYRFMVHEKANQTVVVSGESGAGKTVSAK 176
            V+ LYS EMIQ Y+ K +DE+ PH+FAIAEEAYR M++   NQT++VSGESGAGKTVSAK
Sbjct: 121  VEELYSSEMIQAYARKNRDEMAPHIFAIAEEAYREMINNDQNQTIIVSGESGAGKTVSAK 180

Query: 177  YIMRYFASVQESN-NREGEV----EMSQIESQILATNPIMEAFGNAKTTRNDNSSRFGKY 231
            YIMR+FASV+E + N+EG+     EMS IE +ILATNP+MEAFGNAKTTRNDNSSRFGKY
Sbjct: 181  YIMRFFASVEEEHFNKEGDSKHQEEMSDIEVKILATNPVMEAFGNAKTTRNDNSSRFGKY 240

Query: 232  LQILFDENTTIRGSKIRTYLLEKSRLVYQPETERNYHIFYQILEGLPEPVKQELHLSSPK 291
            LQILFD N  I GS I+TYLLE+SRLV+QP +ERNYHIFYQ+L GL   +K++L+L++ +
Sbjct: 241  LQILFDSNKNIIGSSIKTYLLERSRLVFQPTSERNYHIFYQMLSGLSSDMKKQLYLTNAE 300

Query: 292  DYHYTNQGGQPNIAGIDEAREYKITTDALSLVGINHETQLGIFKILAGLLHIGNIEMKMT 351
            D+ Y NQGG+  I GID++ EY  T ++LS VGI+ E QL IFKILA LLHIGNIE+K T
Sbjct: 301  DFFYLNQGGESTINGIDDSLEYSTTIESLSTVGIDTEVQLQIFKILAALLHIGNIEIKKT 360

Query: 352  RNDASLSSEEQNLQIACELLGIDPFNFAKWIVKKQIVTRSEKIVTNLNYNQALIARDSVA 411
            R DA+LSS + +LQ ACELLG+DP  F+KWI KKQI TRSEKI++NL++NQAL+ARDSVA
Sbjct: 361  RTDATLSSTDPSLQKACELLGLDPLTFSKWITKKQINTRSEKIISNLSFNQALVARDSVA 420

Query: 412  KFIYSTLFDWLVDNINKTLYDPELDQQDHVFSFIGILDIYGFEHFEKNSFEQFCINYANE 471
            KFIYS+LFDWLV NIN  L   ++ +   + SFIG+LDIYGFEHFE+NSFEQFCINYANE
Sbjct: 421  KFIYSSLFDWLVGNINNVLCTSQVSET--INSFIGVLDIYGFEHFEQNSFEQFCINYANE 478

Query: 472  KLQQEFNQHVFKLEQEEYVKEEIEWSFIEFSDNQPCIDLIENKLGILSLLDEESRLPSGS 531
            KLQQEFN HVFKLEQEEYVKEEIEWSFIEFSDNQPCIDLIENKLGILSLLDEESRLP+GS
Sbjct: 479  KLQQEFNHHVFKLEQEEYVKEEIEWSFIEFSDNQPCIDLIENKLGILSLLDEESRLPAGS 538

Query: 532  DESWASKLYSAFNKPPSNEVFSKPRFGQTKFIVSHYAVDVEYEVEGFIEKNRDSVSLGHL 591
            DESW +KLY  FNKPPSN VF KPRFGQ KFI+SHYAVDV YEV+GFIEKN+D++S   L
Sbjct: 539  DESWTTKLYQTFNKPPSNTVFGKPRFGQNKFIISHYAVDVTYEVDGFIEKNKDTISESQL 598

Query: 592  DVFKATTNPIFKQILDNRELRSDDAPEEQN-TEKKIMIPARLSQKKPTLGSMFKKSLGEL 650
            +V KATTNP    I +  E     A  + N TE+   I  +   +KPTLGS+FK+SL EL
Sbjct: 599  EVLKATTNPTLATIFEFSE-----AENKTNITEQAGTIQRKTINRKPTLGSIFKRSLVEL 653

Query: 651  MAIINSTNVHYIRCIKPNSEKKPWEFDNLMVLSQLRACGVLETIRISCAGFPSRWTFDEF 710
            M  INSTNVHYIRCIKPN+EK+ W+FDNLMVLSQLRACGVLETI+ISCAGFPSRW F+EF
Sbjct: 654  METINSTNVHYIRCIKPNTEKEAWKFDNLMVLSQLRACGVLETIKISCAGFPSRWAFEEF 713

Query: 711  VQRYFLLTDYSLWSGILYNPDLPKEAIVNFCQSILDATISDSAKYQIGNTKIFFKAGMLA 770
            +QRY+LL     W  +  + ++  E +V FC  IL   I    KYQIG TKIFFKAG+LA
Sbjct: 714  IQRYYLLAPTDQWGRVTADMEMSLEDMVAFCDLILSEKIDSKDKYQIGKTKIFFKAGVLA 773

Query: 771  FLEKLRTNKMNEICIIIQKKIRARYYRLQYLQTMESIKKCQSQIRSLLVRTRVDHELKTR 830
            +LEK+R++K+ E+ ++IQK IRA+YYR  YLQ M SIK CQS IR +  R RVD E+KT 
Sbjct: 774  YLEKIRSDKVTELAVLIQKHIRAKYYRSLYLQAMLSIKNCQSLIRGVQSRQRVDFEMKTD 833

Query: 831  AAILLQTNIRALWKREYYRAAIGQIIKLQCTCKRKLILDSVNRKFMLMAAVIIQSYIRSY 890
            AA LLQT  R+   R      +  I+++Q   +R L+ + + R+F   +A++IQS IR+ 
Sbjct: 834  AATLLQTLHRSTRVRSQVFETLKNILEVQTAIRRVLVSNFIQREFESRSAIMIQSKIRAN 893

Query: 891  GHKTDYRTLKRSSILVQSAMRMQLARRRYIVLQKEVEERNIRASYGIGLLEEAIEFKNSF 950
              K  Y+TLK  +IL+Q+ +R + ++ +   L+ + E      +   G+ +E I F    
Sbjct: 894  SPKHRYQTLKTGTILIQALVRRKQSQEKLKQLKIQAESAASLKNSAAGIQKELIGFIEEL 953

Query: 951  ILNLEMLNDSYTRLTQLLQGDLSNIPSKQRQEYETIVNGYNDKISKLKTLQVEIMNTXXX 1010
            I N++  +   T    LL+   +++P         +V G N++ +   + + ++      
Sbjct: 954  ISNIKENDAKTTEYKSLLKH--TSLP---------VVTGTNERTAAYISTKNQVEEDKVT 1002

Query: 1011 XXXXXXXXXXQSSLIQSHMQSLAAI-KGNKPSRLSDEVKS----MKQELAFIE-NVIAQD 1064
                         L +  ++SL ++ KG    + +  ++S    +K++++ +  N I +D
Sbjct: 1003 IRTILTKYETLKDLCRKELKSLESLEKGVNDEKFASSLQSSLELIKRDISDLRINAIEKD 1062

Query: 1065 FTTTYSANKNDKVKGLGIAGQQVKPKLVNVIRRESGNPDLLELLMDLNCYTLEVTE-GYL 1123
               T ++++      L          +V ++ +  G  DL+  L+++     ++ + G  
Sbjct: 1063 NERTSTSSE------LKDGTDCTDNAVVQILTKRQG--DLINDLVNVVFLEFQIPQRGRT 1114

Query: 1124 KKVNVTEVNGDNVLGPIHVITTVVSSLVRNGLLIQSSKFISKVLLTVESIVMSLPKDETM 1183
            K              P+ ++ ++V+ + + GL   S   + + +  +   + S+   + +
Sbjct: 1115 KDCEH--------FYPVKLLISIVNLMNKFGLRKSSHSILKQTVQDLIGKISSMDAKKCV 1166

Query: 1184 LGGIFWLSNLSRLPAFAANQKTLYEANGGDEKDKLTLIYLNDLENETLKVFDKIYSTWLV 1243
              G++W+ +L +L +       L                         K+ DK Y TWL 
Sbjct: 1167 TFGLYWIISLHKLSSLPQEPAVLN------------------------KLQDKFYKTWL- 1201

Query: 1244 KFMKHASAHIEIFDMVLNEKLFKNSGDEKFAKLFTFLNEFDAVLCKFQVVDSMHTKIFND 1303
               K     ++  D +L               LF  ++EF      FQ    + T I   
Sbjct: 1202 ---KQCFNQMKTVDSIL--------------ILFDTISEFTLF---FQGTTELLTNIITA 1241

Query: 1304 TLKYLNVMLFNDLITKCPALNWKYGYEVDRNIERLVSWFEP-RIEDVRPNLIQIIQAVKI 1362
             L+++N   FNDL+ K   L+W +G E D  I++++ W    +I +    L  + QA K+
Sbjct: 1242 LLQHINAKWFNDLLIKQNTLSWTHGLEKDSEIKKVLDWCNSHKIRNSTEYLRNVNQACKL 1301

Query: 1363 LQLKISNLNEFKLLFDFWYALNPAQIQAILLKYKPANKGEAGVPNEILNYLANVIKRENL 1422
            LQL+ISN+++F+L+ +F Y L+  Q+ A+L KY+P  + E  +P ++LN+L+N  +RE  
Sbjct: 1302 LQLRISNISDFQLVCEFCYDLSSLQMHALLTKYRPT-QFEKPIPVDVLNHLSNTARRERT 1360

Query: 1423 SLPGKMEIMLSA 1434
            ++  K E+ L A
Sbjct: 1361 TM--KRELTLDA 1370

>KLLA0A03905g complement(345818..350470) similar to sp|P19524
            Saccharomyces cerevisiae YOR326w MYO2 myosin heavy chain,
            start by similarity
          Length = 1550

 Score = 1296 bits (3354), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 708/1490 (47%), Positives = 962/1490 (64%), Gaps = 76/1490 (5%)

Query: 1    MSFEVGTKCWYPHKEQGWIGGEVTKNDFFEGTFHLELKLEDGETVSIETNSFENDDDHPT 60
            M +EVGT+CWYP K+QGWIG EVTK+     +++LEL LEDG+ V +  +S + +   P+
Sbjct: 1    MPYEVGTRCWYPSKDQGWIGAEVTKHTLQGDSYNLELTLEDGQKVELLVSSLD-ETKEPS 59

Query: 61   LPVLRNPPILESTDDLTTLSYLNEPAVLHAIKKRYMNGQIYTYSGIVLIAANPFDKVDHL 120
            LP+LRNPPILE+T+DLT+LSYLNEPAVLHAIK RY    IYTYSGIVLIA NPFD+VD L
Sbjct: 60   LPLLRNPPILETTEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDRVDQL 119

Query: 121  YSREMIQNYSSKRKDELEPHLFAIAEEAYRFMVHEKANQTVVVSGESGAGKTVSAKYIMR 180
            YS+EMIQ Y+ K + ELEPHLFAIAEEAYR M     NQT++VSGESGAGKTVSAKYIMR
Sbjct: 120  YSQEMIQAYAGKLRGELEPHLFAIAEEAYRLMKTTDQNQTIIVSGESGAGKTVSAKYIMR 179

Query: 181  YFASVQESN--NREGEVEMSQIESQILATNPIMEAFGNAKTTRNDNSSRFGKYLQILFDE 238
            YFASV+E+N  N    +EMS+ E +ILATNPIMEAFGNAKT RNDNSSRFGKYL+ILFD+
Sbjct: 180  YFASVEENNEENAHHNLEMSETEKKILATNPIMEAFGNAKTIRNDNSSRFGKYLEILFDD 239

Query: 239  NTTIRGSKIRTYLLEKSRLVYQPETERNYHIFYQILEGLPEPVKQELHLSSPKDYHYTNQ 298
            +T+I G+++RTYLLE+SRLV+QP+TERNYHIFYQIL GL +  K +L L+  +DYHY NQ
Sbjct: 240  DTSIIGARVRTYLLERSRLVFQPKTERNYHIFYQILSGLSDDEKSQLKLTDIQDYHYMNQ 299

Query: 299  GGQPNIAGIDEAREYKITTDALSLVGINHETQLGIFKILAGLLHIGNIEMKMTRNDASLS 358
            GG  +I G+D+A EY  T +ALSLVGI+ +TQ  +FKILA LLHIGNIE+K  RNDASLS
Sbjct: 300  GGDSHIEGVDDASEYGDTVEALSLVGISKDTQFQLFKILAALLHIGNIEVKKVRNDASLS 359

Query: 359  SEEQNLQIACELLGIDPFNFAKWIVKKQIVTRSEKIVTNLNYNQALIARDSVAKFIYSTL 418
            S+E NLQIA +LLGID F+FAKW+ KKQIVTRSEKIV++L Y+QA+++RDSVAKFIYS L
Sbjct: 360  SDEPNLQIAADLLGIDAFDFAKWVTKKQIVTRSEKIVSSLPYHQAIVSRDSVAKFIYSAL 419

Query: 419  FDWLVDNINKTLYDPELDQQDHVFSFIGILDIYGFEHFEKNSFEQFCINYANEKLQQEFN 478
            FDWLVDNIN  L +PE+  +  +++FIG+LDIYGFEHF+KNSFEQFCINYANEKLQQEFN
Sbjct: 420  FDWLVDNINTVLCNPEVVSE--IYTFIGVLDIYGFEHFQKNSFEQFCINYANEKLQQEFN 477

Query: 479  QHVFKLEQEEYVKEEIEWSFIEFSDNQPCIDLIENKLGILSLLDEESRLPSGSDESWASK 538
            QHVFKLEQEEYVKE+IEWSFIEF+DNQPCIDLIENK+GILSLLDEESRLP+G+DE W  K
Sbjct: 478  QHVFKLEQEEYVKEQIEWSFIEFNDNQPCIDLIENKVGILSLLDEESRLPAGTDEGWTHK 537

Query: 539  LYSAFNKPPSNEVFSKPRFGQTKFIVSHYAVDVEYEVEGFIEKNRDSVSLGHLDVFKATT 598
            LY   NKPP+NEVFSKPRFGQT+FIVSHYA+DV Y+V+GFIEKNRD+VS GHL+V KA+ 
Sbjct: 538  LYETLNKPPTNEVFSKPRFGQTQFIVSHYALDVTYDVDGFIEKNRDTVSDGHLEVLKASN 597

Query: 599  NPIFKQILD----NRELRSDDAPEEQNTEKKIMIPARLSQKKPTLGSMFKKSLGELMAII 654
            N     IL+    N E  ++   ++Q ++KK    +R   +KPTLGSMFK+SL +LM  I
Sbjct: 598  NETLLSILETVDKNAEKLAEKQAQKQESQKKPGPASRKIVRKPTLGSMFKQSLIDLMETI 657

Query: 655  NSTNVHYIRCIKPNSEKKPWEFDNLMVLSQLRACGVLETIRISCAGFPSRWTFDEFVQRY 714
            NSTNVHYIRCIKPN +K+ W+FDNLMVLSQLRACGVLETIRISCAGFPSRWT+ EF  RY
Sbjct: 658  NSTNVHYIRCIKPNEDKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTYTEFALRY 717

Query: 715  FLLTDYSLWSGILYNPDLPKEAIVNFCQSILDATISDSAKYQIGNTKIFFKAGMLAFLEK 774
             +L    LWS IL + D  +E + N C+ IL  T+ D+AKYQ GNTKIFFKAGMLA LEK
Sbjct: 718  HILVPSELWSNILLS-DPSEEDVKNLCKEILKRTMDDTAKYQAGNTKIFFKAGMLAHLEK 776

Query: 775  LRTNKMNEICIIIQKKIRARYYRLQYLQTMESIKKCQSQIRSLLVRTRVDHELKTRAAIL 834
            LRT+K+    ++IQKKI+  +YR  YL+T+++IK+ Q+ +   ++R R ++E K  AA+L
Sbjct: 777  LRTDKLFSSSVMIQKKIKGLHYRKTYLRTVDAIKRLQANVSGKIIRLRTENEFKNNAALL 836

Query: 835  LQTNIRALWKREYYRAAIGQIIKLQCTCKRKLILDSVNRKFMLMAAVIIQSYIRSYGHKT 894
            +Q+  R +  R+   + I  II++Q   ++++    +  +    AAV IQ  +RS+  + 
Sbjct: 837  IQSAYRGISVRDNVSSIIISIIRIQSMARKQITCKELLERRRGDAAVTIQKSVRSFQPRK 896

Query: 895  DYRTLKRSSILVQSAMRMQLARRRYIVLQKEVEERNIRASYGIGLLEEAIEFKNSFILNL 954
             +   K+ ++++QS +R   A+R+   L+ E +  N        L  + IE   S    +
Sbjct: 897  SFLHEKKGTVVIQSFIRKHYAQRKLKQLKSEAKSVNHLQEVSYKLENKVIELTESLASKV 956

Query: 955  EMLNDSYTRLTQLLQG--DLSNIPSKQRQEYETIVNGYNDKIS-----------KLKTLQ 1001
            +   +  +RL  L +   +  NI S   +E E       D+ S           +L   +
Sbjct: 957  KENKELVSRLENLQKSLNESENIKSSLEEEKEGHTKALADQKSIHEEEYGKVNDQLIAAK 1016

Query: 1002 VEIMNTXXXXXXXXXXXXXQSSLIQSHMQSLAAIKG------NKPSRLSDEVKSMKQELA 1055
             EI++                  I S ++ L + +       ++ + L  EV S+K+E+A
Sbjct: 1017 EEIISAKAEVDELLNKQKNLKDEIASTLEELTSARDELLTSQSENADLKKEVFSLKEEVA 1076

Query: 1056 FIENVIAQDFTTTYSAN----KNDKVKGLGIAGQQVKPKLVNVIRRESG----------- 1100
             +++ +          N    KN +            PK +NV+   +            
Sbjct: 1077 RLQSSMRSGVYVGGGINATPVKNRRFSANSTLNDGSSPKQLNVVSINNNFNTEDVSALMS 1136

Query: 1101 --NPDLLELLMDLNCYTLEVTEGYLK--KVNVTEVNGD----NVLGPIHVITTVVSSLVR 1152
              N +L ++  D      E+ EG LK  KV  T V+ +     VL P  V+  ++S + R
Sbjct: 1137 QINDELYKMFEDSRSLNTEIIEGLLKGGKVPPTGVSVNLTRKEVLYPSRVLIIILSDMWR 1196

Query: 1153 NGLLIQSSKFISKVLLTVESIVMSLPKDETMLGGIFWLSNLSRLPAFAA------NQKTL 1206
             GL  QS  F+++VL  ++ I+ +L  D  +  G FW +N+  L +F             
Sbjct: 1197 LGLTSQSETFLAEVLDAIQKIISNLKPDVMIEHGAFWYTNVRELHSFVVYAYESITTDET 1256

Query: 1207 YEANGGDEKDKLTLIYLNDLENETLKVFDKIYSTWLVKFMKHASAHIEIFDMVLN----- 1261
            Y +   +E+    +  + +L+++   +   +Y+ W+ K  K+    I +  +V++     
Sbjct: 1257 YNSGMNEEEYNRYVNLVKELKDDFEALSFNVYNLWMKKLRKNLE-KIAVPAVVVSQSLPG 1315

Query: 1262 ----------EKLFKNSGDEKFAKLFTFLNEFDAVLCKFQVVDSMHTKIFNDTLKYLNVM 1311
                      +K  +NS   K   + TF N     +  + +   +   +  + LK L+ +
Sbjct: 1316 FVVPEPSQFLQKFLQNSSTYKMDDVLTFFNNIYWAMKSYDIEMEVFEDVITNLLKLLDAL 1375

Query: 1312 LFNDLITKCPALNWKYGYEVDRNIERLVSWFEP-RIEDVRPNLIQIIQAVKILQLKISNL 1370
             FNDLI +   L+WK G +++ N+ R+  W +   I +V   L  I+QA K+LQLK   +
Sbjct: 1376 CFNDLILRKNFLSWKRGLQLNYNVTRIEEWCKSHHISEVSVCLQHILQAAKLLQLKKRIV 1435

Query: 1371 NEFKLLFDFWYALNPAQIQAILLKYKPANKGEAGVPNEILNYLANVIKRE 1420
             +  +++D    L P Q++ ++ +Y  A+  E   P EIL Y+A  +K +
Sbjct: 1436 ADIDIIWDICNCLKPIQLKQLITQYSVADYEEPIAP-EILQYVAEKVKND 1484

>Sklu_2164.5 YOR326W, Contig c2164 5497-9549
          Length = 1350

 Score = 1289 bits (3336), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 680/1302 (52%), Positives = 886/1302 (68%), Gaps = 63/1302 (4%)

Query: 1    MSFEVGTKCWYPHKEQGWIGGEVTKNDFFEGTFHLELKLEDGETVSIETNSF-ENDDDHP 59
            MS+EVGT+CWYP K+QGWIGGE+TK+        LEL LED + V IE+ +  E  DD  
Sbjct: 1    MSYEVGTRCWYPDKQQGWIGGEITKHTNLSNKHQLELTLEDNQIVEIESETLDETKDDR- 59

Query: 60   TLPVLRNPPILESTDDLTTLSYLNEPAVLHAIKKRYMNGQIYTYSGIVLIAANPFDKVDH 119
             LP+LRNPPILE+T+DLT+LSYLNEPAVLHAIK RY    IYTYSGIVLIA NPFD+V+ 
Sbjct: 60   -LPLLRNPPILEATEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDRVEQ 118

Query: 120  LYSREMIQNYSSKRKDELEPHLFAIAEEAYRFMVHEKANQTVVVSGESGAGKTVSAKYIM 179
            LYS++MIQ Y+ KR+ ELEPHLFAIAEEAYR M ++K NQT+VVSGESGAGKTVSAKYIM
Sbjct: 119  LYSQDMIQAYAGKRRGELEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIM 178

Query: 180  RYFASVQESN--NREGEVEMSQIESQILATNPIMEAFGNAKTTRNDNSSRFGKYLQILFD 237
            RYFASV+++N  N    +EMS+ E +ILATNPIMEAFGNAKTTRNDNSSRFGKYL+ILFD
Sbjct: 179  RYFASVEQNNEENAHHNLEMSETEKKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFD 238

Query: 238  ENTTIRGSKIRTYLLEKSRLVYQPETERNYHIFYQILEGLPEPVKQELHLSSPKDYHYTN 297
            +  +I G++IRTYLLE+SRLV+QP++ERNYHIFYQ+L GL    K +L L+  +DYHY N
Sbjct: 239  KEISIIGARIRTYLLERSRLVFQPKSERNYHIFYQLLAGLTNEEKSQLKLTGVEDYHYMN 298

Query: 298  QGGQPNIAGIDEAREYKITTDALSLVGINHETQLGIFKILAGLLHIGNIEMKMTRNDASL 357
            QGG+  I GID+A EY+ T +ALSLVGI+ +TQ  +FKILA LLHIGN+E+K TRNDASL
Sbjct: 299  QGGEAQIKGIDDAEEYQTTVEALSLVGISKDTQYQLFKILAALLHIGNVEIKKTRNDASL 358

Query: 358  SSEEQNLQIACELLGIDPFNFAKWIVKKQIVTRSEKIVTNLNYNQALIARDSVAKFIYST 417
            SS+E NL IACELLGID FNFAKWI KKQI TRSEKIV+NLNYNQAL+ARDSVAKFIYS 
Sbjct: 359  SSDEPNLAIACELLGIDSFNFAKWITKKQINTRSEKIVSNLNYNQALVARDSVAKFIYSA 418

Query: 418  LFDWLVDNINKTLYDPELDQQDHVFSFIGILDIYGFEHFEKNSFEQFCINYANEKLQQEF 477
            LF+WLVDNIN  L +PE+  +  + SFIG+LDIYGFEHFEKNSFEQFCINYANEKLQQEF
Sbjct: 419  LFEWLVDNINTVLCNPEVASE--INSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEF 476

Query: 478  NQHVFKLEQEEYVKEEIEWSFIEFSDNQPCIDLIENKLGILSLLDEESRLPSGSDESWAS 537
            NQHVFKLEQEEYVKEEIEWSFIEF+DNQPCIDLIENKLGILSLLDEESRLP+GSDE+W  
Sbjct: 477  NQHVFKLEQEEYVKEEIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDETWTQ 536

Query: 538  KLYSAFNKPPSNEVFSKPRFGQTKFIVSHYAVDVEYEVEGFIEKNRDSVSLGHLDVFKAT 597
            KLY   +KPP+N VFSKPRFGQTKF+VSHYA+DV Y+VEGFIEKNRD+VS GHL+V KA+
Sbjct: 537  KLYQTLDKPPTNTVFSKPRFGQTKFVVSHYALDVSYDVEGFIEKNRDTVSDGHLEVLKAS 596

Query: 598  TNPIFKQILDNRELRSDDAPEEQNTEKKIMIPARLSQKKPTLGSMFKKSLGELMAIINST 657
            TN     IL+  +  +    E++   KK   PAR+  +KPTLGS+FK+SL ELM  INST
Sbjct: 597  TNETLLSILETLDKHAAKLAEKEQVNKKPG-PARMVNRKPTLGSIFKQSLIELMGTINST 655

Query: 658  NVHYIRCIKPNSEKKPWEFDNLMVLSQLRACGVLETIRISCAGFPSRWTFDEFVQRYFLL 717
            NVHYIRCIKPN  K+ W FDNLMVLSQLRACGVLETIRISCAGFPSRWT++EFV RY +L
Sbjct: 656  NVHYIRCIKPNEVKEAWVFDNLMVLSQLRACGVLETIRISCAGFPSRWTYNEFVLRYHIL 715

Query: 718  TDYSLWSGILYNPDLPKEAIVNFCQSILDATISDSAKYQIGNTKIFFKAGMLAFLEKLRT 777
                 WS  +++ D  +E I + C++IL A + D  KYQ+GNTKIFFKAGMLA+LEKLR+
Sbjct: 716  IPSEHWSK-MFSSDTTEEDIRDLCRTILGAIVEDKQKYQLGNTKIFFKAGMLAYLEKLRS 774

Query: 778  NKMNEICIIIQKKIRARYYRLQYLQTMESIKKCQSQIRSLLVRTRVDHELKTRAAILLQT 837
            ++++   ++IQKK++A YYR +YL  + SI+   S+    L R +VD E KT+AAIL+Q+
Sbjct: 775  DRLHNSSVLIQKKVKAVYYRKKYLAIISSIRNFHSRSEGFLTRQKVDLEFKTQAAILIQS 834

Query: 838  NIRALWKREYYRAAIGQIIKLQCTCKRKLILDSVNRKFMLMAAVIIQSYIRSYGHKTDYR 897
             +R+   R    + +  I +LQ   +++L    + ++    AAV IQ  IR++  +  + 
Sbjct: 835  MVRSTSTRNKTISLLSAITRLQSLVRKQLAQKELLQRRQRDAAVSIQKKIRAFEPRQSFN 894

Query: 898  TLKRSSILVQSAMRMQLARRRYIVLQKEVEERNIRASYGIGLLEEAIEFKNSFILNLEML 957
            T +RS+++VQS +R + A+++   L+ E +  N        L  + I+   S    ++  
Sbjct: 895  TTRRSTVVVQSLVRKKFAQKKLKDLKTEAKSVNHLKEVSYKLENKVIQLTESLAEKVKEN 954

Query: 958  NDSYTRLTQLLQ-----GDLSNIPSKQRQEYETIVNGYNDKIS-KLKTLQVEIMNTXXXX 1011
                 R+ +L Q      ++  + + Q+ E+  ++    D    +   +Q +++N     
Sbjct: 955  KGMTARIQELQQSLNESANIKELLNSQKDEHSKVLQQQKDAHDVQFNEVQEKLVNAKKEV 1014

Query: 1012 XXXXXXX----XXQSSL---IQSHMQSLAAIKG------NKPSRLSDEVKSMKQELAFIE 1058
                         Q  L   +++ ++ L   K        + S L +EVKS+K E+A ++
Sbjct: 1015 EEAKEEIEQLIAKQDELKAEVRTKIEELNKAKKTFTEFQTQNSDLKNEVKSLKDEIARLQ 1074

Query: 1059 NVIAQDFTTTYSANKNDKVKGLGI---AGQQVKPKLVNVIRRESG--------------- 1100
              +    T++   +     +             P+ +NVI   +G               
Sbjct: 1075 AAVRSGVTSSTITSTPTASRRFSAHSSVADGTSPRQLNVISMNNGGIEDDARSTASALSQ 1134

Query: 1101 -NPDLLELLMDLNCYTLEVTEGYLKKVNV------TEVNGDNVLGPIHVITTVVSSLVRN 1153
             N +L +LL D      E+ EG LK   +       E+    VL P  ++  V+S + R 
Sbjct: 1135 INDELYKLLEDTKSLNTEIVEGLLKGFKIPETGVAVELTRKEVLYPARILIIVLSDMWRL 1194

Query: 1154 GLLIQSSKFISKVLLTVESIVMSLPKDETMLGGIFWLSNLSRLPAFA--ANQKTLYEA-- 1209
            GL  QS  F+++VL T++ +V +L  D+ +L G FWL+N+  L +F   A +  L +   
Sbjct: 1195 GLTKQSESFLAEVLSTIQKLVTNLKGDDMILHGAFWLTNVRELYSFVVFAQESILNDDSY 1254

Query: 1210 -NGGDE---KDKLTLIYLNDLENETLKVFDKIYSTWLVKFMK 1247
             NG +E   K+ +TL+   +L+++   +   IY+ WL K  K
Sbjct: 1255 NNGLNEDEYKEYVTLV--TELKDDFESLSYNIYNIWLKKLQK 1294

>CAGL0G06336g 607817..612073 similar to sp|P32492 Saccharomyces
            cerevisiae YAL029c MYO4 or sp|P19524 Saccharomyces
            cerevisiae YOR326w MYO2, start by similarity
          Length = 1418

 Score = 1159 bits (2998), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 650/1434 (45%), Positives = 899/1434 (62%), Gaps = 109/1434 (7%)

Query: 1    MSFEVGTKCWYPHKEQGWIGGEVTKNDFFEGTFHLELKLEDGETVSIETNSFENDD---- 56
            M+FEVGT+CWYP  E GWI  EV+KN+  +G +HL+  LEDG  + ++T+S + +D    
Sbjct: 1    MTFEVGTRCWYP-SENGWIPCEVSKNEPRDGKYHLQFTLEDGSLIDLDTDSIDYNDSLSN 59

Query: 57   DHPTLPVLRNPPILESTDDLTTLSYLNEPAVLHAIKKRYMNGQIYTYSGIVLIAANPFDK 116
            +   +PVLRNP   EST DLTTLSYLNEPAVLHAIK RYMN +IYTYSGIVL+A NPF +
Sbjct: 60   EGSPMPVLRNPHSRESTQDLTTLSYLNEPAVLHAIKLRYMNKEIYTYSGIVLVATNPFAQ 119

Query: 117  VDHLYSREMIQNYSS-KRKDELEPHLFAIAEEAYRFMVHEKANQTVVVSGESGAGKTVSA 175
            ++ LYS +MI+ YS    ++EL+PHLFAIA +AY  M  +  NQT+VVSGESGAGKTVSA
Sbjct: 120  MEELYSNDMIKKYSRITSREELDPHLFAIAHDAYTTMDSQSRNQTIVVSGESGAGKTVSA 179

Query: 176  KYIMRYFASVQESNNREGEVEMSQIESQILATNPIMEAFGNAKTTRNDNSSRFGKYLQIL 235
            KYIMRYFAS+ + NN     EMS IE +ILATNPIMEAFGNAKT RNDNSSRFGKYLQI+
Sbjct: 180  KYIMRYFASL-DDNNAAVVSEMSDIEKKILATNPIMEAFGNAKTIRNDNSSRFGKYLQIM 238

Query: 236  FDENTTIRGSKIRTYLLEKSRLVYQPETERNYHIFYQILEGLPEPVKQELHLSSPKDYHY 295
            FD    I G++IRTYLLE+SRLV+Q ++ERNYHIFYQ+L GLP  +K+EL +S+P+ ++Y
Sbjct: 239  FDAKKNIIGAQIRTYLLERSRLVFQQQSERNYHIFYQLLAGLPAAIKEELCISNPEQFYY 298

Query: 296  TNQGGQPNIAGIDEAREYKITTDALSLVGINHETQLGIFKILAGLLHIGNIEMKMTRNDA 355
             NQG  P I G+D+A+E++ T  ALS++GIN   Q+ +FKILAGLLHIGNIE+K +   +
Sbjct: 299  LNQGSDPRIDGVDDAQEFQDTIAALSVIGINDSLQMEVFKILAGLLHIGNIEIKQSSTSS 358

Query: 356  SLSSEEQNLQIACELLGIDPFNFAKWIVKKQIVTRSEKIVTNLNYNQALIARDSVAKFIY 415
            S+S +E NL++ACELLG+DP+ F+KW+ KK+I TRSEKIVTNL   QAL+ RDSV+KFIY
Sbjct: 359  SISPDEPNLKLACELLGLDPYEFSKWLTKKEITTRSEKIVTNLKKEQALVVRDSVSKFIY 418

Query: 416  STLFDWLVDNINKTLYDPELDQQDHVFSFIGILDIYGFEHFEKNSFEQFCINYANEKLQQ 475
            S LFDWLV+ IN  L+  E+   D V SFIG+LDIYGFEHFE NSFEQFCINYANEKLQQ
Sbjct: 419  SLLFDWLVNQINTMLHGAEVS--DQVRSFIGVLDIYGFEHFEMNSFEQFCINYANEKLQQ 476

Query: 476  EFNQHVFKLEQEEYVKEEIEWSFIEFSDNQPCIDLIENKLGILSLLDEESRLPSGSDESW 535
            EFNQHVFKLEQEEYV+E+IEWSFIEF+DNQPCIDLIEN+LGILSLLDEESRLPSG+DESW
Sbjct: 477  EFNQHVFKLEQEEYVREKIEWSFIEFNDNQPCIDLIENRLGILSLLDEESRLPSGTDESW 536

Query: 536  ASKLYSAFNKPPSNEVFSKPRFGQTKFIVSHYAVDVEYEVEGFIEKNRDSVSLGHLDVFK 595
              KLY   +KPP N+VFSKP+FGQTKF++SHYA +VEY+VEGFIEKNRD+VS   ++V K
Sbjct: 537  TQKLYQTLDKPPMNQVFSKPKFGQTKFVISHYADNVEYDVEGFIEKNRDTVSESLMNVLK 596

Query: 596  ATTNPIFKQILDNRELRSDDAPEEQNTEKKIMIPARLSQKKPTLGSMFKKSLGELMAIIN 655
             + N     +    E  S   P+  +  +      +L  KKPTLG MFKKSLGELM IIN
Sbjct: 597  NSQNDTLISLTKPTEETSTPPPQTASISR-----PKLINKKPTLGFMFKKSLGELMEIIN 651

Query: 656  STNVHYIRCIKPNSEKKPWEFDNLMVLSQLRACGVLETIRISCAGFPSRWTFDEFVQRYF 715
            +TNVHYIRC+KPNS K  WEFD+ MVLSQLRACG+LETI+ISCAGFPSRW+F EF+ RY+
Sbjct: 652  NTNVHYIRCVKPNSSKVAWEFDDGMVLSQLRACGILETIKISCAGFPSRWSFQEFIDRYY 711

Query: 716  LLTDYSLWSGILYNPDLPKEAIVNFCQSILDATISDSAKYQIGNTKIFFKAGMLAFLEKL 775
            +L D +LWS +  +    + +I  FC+ IL AT     K QIG TKIFFK+G+LA LE L
Sbjct: 712  MLVDTTLWSDVASSESNAESSI-KFCKEILGATELSHEKCQIGQTKIFFKSGVLAELESL 770

Query: 776  RTNKMNEICIIIQKKIRARYYRLQYLQTMESIKKCQSQIRSLLVRTRVDHELKTRAAILL 835
            R  KM  I I IQKKIRA   R  YL+ +  ++  Q++IRS LVR  V+H+LKT+ A+++
Sbjct: 771  RLKKMKGIAITIQKKIRAYKIRTWYLEIVNCVRDLQNRIRSKLVRLDVEHQLKTKLALMM 830

Query: 836  QTNIRALWKREYYRAAIGQIIKLQCTCKRKLILDSVNRKFMLMAAVIIQSYIRSYGHKTD 895
            Q  +R+   R      +  II LQC  +  L    +       A+++IQSYIR Y HKT 
Sbjct: 831  QATLRSYRVRIRVAKELDDIILLQCKFRTVLAQRYLQELKRNKASIMIQSYIRGYKHKTQ 890

Query: 896  YRTLKRSSILVQSAMRMQLARRRYIVLQKEVEERNIRASYGIGLLEEAIEFKNSFILNLE 955
            YR  +++   +Q+  R  LAR   + L+ E E   I    G+   E     K+       
Sbjct: 891  YRYFRKNYQAIQALSRSMLARSLMLKLRSESEVTQIN---GVTYTELHSIVKD------- 940

Query: 956  MLNDSYTRLTQLLQGDLSNIPSKQRQEYETIVNGYNDKISKLKTLQVEIMNTXXXXXXXX 1015
             ++DS T   Q++         K+  E+  +++          + + E +N+        
Sbjct: 941  -IHDSMTSNNQII---------KELDEFNGVIDTQKSLTFTDLSAKAEQLNSDAQKIII- 989

Query: 1016 XXXXXQSSLIQSHMQSLAAIKGNKPSRLSDEVKSMKQELAFIENVIAQD--FTTTYSANK 1073
                 + S  +  ++ L   KG+  S L++ +K +   +  ++ ++ +D  F T  +   
Sbjct: 990  -----KHSNQEKQIKDLKESKGDVDSTLTN-IKKVHNNIKSLDKIMLEDAHFQTGRTI-- 1041

Query: 1074 NDKVKGLGIAGQQ-----------VKPKLVNVIRRESGNPDLLELLMDLNCYTLEVTEGY 1122
               + GLGI                +P   N+++    N  +++ +M     TLE     
Sbjct: 1042 ---ISGLGIEHSSQYENINDNENNCRPNDYNLLQIFRNNHLIVKEIMKEEFATLE----- 1093

Query: 1123 LKKVNVTEVNGDNVLGPIHVITTVVSSLVRNGLLIQSSKFISKVLLTVES-IVMSLPKDE 1181
                           G    I+ ++  +++    + + +FIS +  ++ S ++     D+
Sbjct: 1094 ---------------GSFGTISFILGEMIKLKQFLSAKQFISTLFESIHSNVIEESSYDK 1138

Query: 1182 TMLGGIFWLS-NLSRLPAFAANQKTLYEANGGDEKDKLTLIYLNDLENETLKVFDKIYST 1240
             +  G  W S   + L     ++ +L     G E  K     L D EN+      K+  +
Sbjct: 1139 KLKSGFQWFSVAFTNLSVLRNSEFSL-----GKETSKSLSKLLADYEND----LSKMLRS 1189

Query: 1241 WLVKFMKHASAHIEIFDMVL-NEKLFKNSGDEKFAKLFTF------LNEFDAVLCKFQVV 1293
            W++  +          DM   N+KLF +    + + + +F      +    + +    + 
Sbjct: 1190 WILSILN---------DMFRENDKLFNDFASVEISNVISFKILQQKIKYIQSKMGTSAIE 1240

Query: 1294 DSMHTKIFNDTLKYLNVMLFNDLITKCPALNWKYGYEVDRNIERLVSWFEP-RIEDVRPN 1352
             S+  K+    ++YLN+ + N ++ K P+++++ G  +++N++ L+ + E  ++ + R +
Sbjct: 1241 KSLFGKLIETLIQYLNLNVANHVLIKIPSVDFETGIILEKNLDTLLEYCEELKLSNCRNS 1300

Query: 1353 LIQIIQAVKILQLKISNLNEFKLLFDFWYALNPAQIQAILLKYKPANKGEAGVP 1406
              Q  Q  K+LQL IS++ E +++  + +ALN  QI A+L K K A+  E  +P
Sbjct: 1301 TRQTSQMSKLLQLSISSVEELRVVCQYCFALNLTQIHALLAKQK-ASSDEKPMP 1353

>Scas_688.22
          Length = 1876

 Score =  513 bits (1322), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 303/789 (38%), Positives = 464/789 (58%), Gaps = 92/789 (11%)

Query: 39  LEDGETVSIETNSFENDDDHPTLPVLRNPPILESTDDLTTLSYLNEPAVLHAIKKRYMNG 98
           +E GE + IE ++       P+     NP   +  D+++ L++LNE +VLH ++KRY + 
Sbjct: 45  METGEELQIEKSNL-----SPS-----NPTSFDKVDNMSELTHLNEASVLHNLEKRYKDD 94

Query: 99  QIYTYSGIVLIAANPFDKVDHLYSREMIQNYSSKRKDELEPHLFAIAEEAYRFMVHEKAN 158
            IYTYSG+ L+A NP+  +  +Y++E I  Y+   K++ +PH++AIAEEAY+ ++ EK +
Sbjct: 95  MIYTYSGLFLVAINPYCNI-KIYTQEYINLYNGSSKEDNKPHIYAIAEEAYQKLLTEKQD 153

Query: 159 QTVVVSGESGAGKTVSAKYIMRYFASVQESNNREGEV---------EMSQIES---QILA 206
           Q+V+V+GESGAGKT + K I++Y AS+  + ++  E          E++Q ES   +IL 
Sbjct: 154 QSVLVTGESGAGKTENTKKILQYLASITSNKSKYSEADLLVSQNDNEINQFESFEMKILQ 213

Query: 207 TNPIMEAFGNAKTTRNDNSSRFGKYLQILFDENTTIRGSKIRTYLLEKSRLVYQPETERN 266
           +NPI+E+FGNA+T RN+NSSRFGK+++I FDE   I G+ I  YLLEKSR++ Q   ERN
Sbjct: 214 SNPILESFGNAQTVRNNNSSRFGKFIKIEFDERGKINGAHIEWYLLEKSRVINQHPEERN 273

Query: 267 YHIFYQILEGLP--EPVKQELHLSSPKDYHYTNQGGQPNIAGIDEAREYKITTDALSLVG 324
           YHIFYQ+L GL   E  K EL   S  DY Y ++   P+I G+++A++++    A + VG
Sbjct: 274 YHIFYQLLAGLSLQELRKLELTSKSVSDYKYLSKSN-PSIPGVNDAQDFQDLLKAFTTVG 332

Query: 325 INHETQLGIFKILAGLLHIGNIEMKMTRNDASLSSEEQNLQIACELLGIDPFNFAKWIVK 384
             HE    I+++L+ +LHIGN++   T   +  ++ + +     +LLG+    F   ++ 
Sbjct: 333 FTHEEVNNIWQVLSIILHIGNVD--FTSEKSQQATFKNDPSTLAKLLGVTEKEFTTAVLT 390

Query: 385 KQIVTRSEKIVTNLNYNQALIARDSVAKFIYSTLFDWLVDNINKTLYDPELDQQDHVFSF 444
            +     E +  + N +QA    +S+++ +Y  LF ++V+ IN +     LD      ++
Sbjct: 391 PKTKAGKEWVTQSKNASQARFILNSLSRTLYEKLFSFIVERINNS-----LDHSSMTANY 445

Query: 445 IGILDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHVFKLEQEEYVKEEIEWSFIEFS-D 503
           IG+LDI GFE F+ NSFEQ CINY NEKLQQ FN H+F LEQ EY+KE I+W+F++F  D
Sbjct: 446 IGLLDIAGFEIFKHNSFEQLCINYTNEKLQQFFNHHMFVLEQNEYMKENIQWNFVDFGKD 505

Query: 504 NQPCIDLIENK---LGILSLLDEESRLPSGSDESWASKLYSAFNKPPSNEVFSKPRFGQT 560
            Q  IDLIENK    G+L LLDEES LP+ SD+S+ SKL S +++         P+F ++
Sbjct: 506 LQASIDLIENKSSPTGVLPLLDEESILPNSSDDSFFSKLISTWDQKS-------PKFIRS 558

Query: 561 K----FIVSHYAVDVEYEVEGFIEKNRDSVSLGHLDVFKATTNPIFKQILDNRELRSDDA 616
           K    F++ HYA +VEY +EG++ KN+D +S   + +  ++TN I     +         
Sbjct: 559 KLPQCFVLKHYAGEVEYNIEGWLSKNKDPLSECMISMLSSSTNEIVTSFFN--------- 609

Query: 617 PEEQNTEKKIMIPARLSQKKPTLGSMFKKSLGE-------LMAIINSTNVHYIRCIKPNS 669
             E N              K   GS F+ +          L+  + +T+ H++RCI PN+
Sbjct: 610 --ESN--------------KNVRGSSFRTASARHREQQMLLLKQLETTHPHFVRCIIPNN 653

Query: 670 EKKPWEFDNLMVLSQLRACGVLETIRISCAGFPSRWTFDEFVQRYFLLTDYSLW-SGILY 728
            KK  +FD  ++L QLR  GVLE IRI+  G+P+R  F EF QRY LL+D + + +G   
Sbjct: 654 RKKAKDFDRKLILDQLRCNGVLEGIRIAREGYPNRIFFKEFFQRYRLLSDENHFATGFKK 713

Query: 729 NPDLPKEAIVNFCQSILDATISDSAKYQIGNTKIFFKAGMLAFLEKLRTNKMNEICIIIQ 788
           N           C+ +L +   D + Y+IG +K+FFKAG+LA LE  +  ++  I I   
Sbjct: 714 N-----------CEILLSSLHLDPSLYKIGTSKLFFKAGVLAELETKKDQRIRSIVIRFN 762

Query: 789 KKIRARYYR 797
             +R R  R
Sbjct: 763 SHLRGRIIR 771

>YHR023W (MYO1) [2310] chr8 (151658..157444) Myosin heavy chain
           (myosin II), coiled-coil protein involved in septation
           and cell wall organization [5787 bp, 1928 aa]
          Length = 1928

 Score =  508 bits (1308), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 321/834 (38%), Positives = 480/834 (57%), Gaps = 52/834 (6%)

Query: 9   CWYPHKEQGWIGGEVTKNDFFEGTFHLELKLEDGETVSI-------ETNSFENDDDHPTL 61
            W P +++ ++ GE+   D  +  F  +      E + I       E ++          
Sbjct: 13  VWIPDEKEVFVKGELMSTDINKNKFTGQ-----EEQIGIVHPLDSTEVSNLVQVRISDVF 67

Query: 62  PVLRNPPILESTDDLTTLSYLNEPAVLHAIKKRYMNGQIYTYSGIVLIAANPFDKVDHLY 121
           PV  NP   +  ++++ L++LNEP+VL+ ++KRY    IYTYSG+ L+A NP+  ++ LY
Sbjct: 68  PV--NPSTFDKVENMSELTHLNEPSVLYNLEKRYDCDLIYTYSGLFLVAINPYHNLN-LY 124

Query: 122 SREMIQNYSSK-------RKDE-----LEPHLFAIAEEAYRFMVHEKANQTVVVSGESGA 169
           S + I  Y +K       R DE     L PH+FAIAEEAY  ++ E  +Q+++V+GESGA
Sbjct: 125 SEDHINLYHNKHNRLSKSRLDENSHEKLPPHIFAIAEEAYENLLSEGKDQSILVTGESGA 184

Query: 170 GKTVSAKYIMRYFASVQESNNR-----EGEVEMSQIESQILATNPIMEAFGNAKTTRNDN 224
           GKT + K I++Y AS+   +        G   +   E +IL +NPI+E+FGNA+T RN+N
Sbjct: 185 GKTENTKKILQYLASITSGSPSNIAPVSGSSIVESFEMKILQSNPILESFGNAQTVRNNN 244

Query: 225 SSRFGKYLQILFDENTTIRGSKIRTYLLEKSRLVYQPETERNYHIFYQILEGLPEPVKQE 284
           SSRFGK+++I F+E+  I G+ I  YLLEKSR+V+Q   ERNYHIFYQ+L GL +   + 
Sbjct: 245 SSRFGKFIKIEFNEHGMINGAHIEWYLLEKSRIVHQNSKERNYHIFYQLLSGLDDSELKN 304

Query: 285 LHLSSP--KDYHYTNQGGQPNIAGIDEAREYKITTDALSLVGINHETQLGIFKILAGLLH 342
           L L S   KDY   +   Q  I GI++   +K    AL+++G + +    IF+++A +L 
Sbjct: 305 LRLKSRNVKDYKILSNSNQDIIPGINDVENFKELLSALNIIGFSKDQIRWIFQVVAIILL 364

Query: 343 IGNIEMKMTRNDASLSSEEQNLQIACELLGIDPFNFAKWIVKKQIVTRSEKIVTNLNYNQ 402
           IGNIE    R  A  +S + ++   C  LG+D  +F   I++ +     E +  + N  Q
Sbjct: 365 IGNIEFVSDR--AEQASFKNDVSAICSNLGVDEKDFQTAILRPRSKAGKEWVSQSKNSQQ 422

Query: 403 ALIARDSVAKFIYSTLFDWLVDNINKTLYDPELDQQDHVFSFIGILDIYGFEHFEKNSFE 462
           A    +++++ +Y  LF ++VD INK      LD      ++IG+LDI GFE FE NSFE
Sbjct: 423 AKFILNALSRNLYERLFGYIVDMINKN-----LDHGSATLNYIGLLDIAGFEIFENNSFE 477

Query: 463 QFCINYANEKLQQEFNQHVFKLEQEEYVKEEIEWSFIEFS-DNQPCIDLIENK---LGIL 518
           Q CINY NEKLQQ FN H+F LEQ EY+KE I+W +I++  D Q  IDLIE+K    G+L
Sbjct: 478 QLCINYTNEKLQQFFNNHMFVLEQSEYLKENIQWDYIDYGKDLQLTIDLIESKGPPTGVL 537

Query: 519 SLLDEESRLPSGSDESWASKLYSAFNKPPSNEVFSKPRFGQTKFIVSHYAVDVEYEVEGF 578
            LLDEE+ LP  +DES+ SKL S +++  S   F + R  +  FI+ HYA DVEY VEG+
Sbjct: 538 PLLDEEAVLPKSTDESFYSKLISTWDQNSSK--FKRSRL-KNGFILKHYAGDVEYTVEGW 594

Query: 579 IEKNRDSVSLGHLDVFKATTNPIFKQILDNRELRSDDAPEEQN-TEKKIMIPARLSQKKP 637
           + KN+D ++   L +  ++ N I  ++      +S  A  E N + +++   AR S  K 
Sbjct: 595 LSKNKDPLNDNLLSLLSSSQNDIISKLFQPEGEKSSSAGVEANISNQEVKKSARTSTFKT 654

Query: 638 TLGSMFKKSLGELMAIINSTNVHYIRCIKPNSEKKPWEFDNLMVLSQLRACGVLETIRIS 697
           T  S  ++    L+  + ST+ H++RCI PN+ KK   F+  ++L QLR  GVLE IR++
Sbjct: 655 T-SSRHREQQITLLNQLASTHPHFVRCIIPNNVKKVKTFNRRLILDQLRCNGVLEGIRLA 713

Query: 698 CAGFPSRWTFDEFVQRYFLLTDYSLWSGILYNPDLPKEAIVNFCQSILDATISDSAKYQI 757
             G+P+R  F EF QRY +L  Y   S         K +    C+ +L +   D+  Y+I
Sbjct: 714 REGYPNRIAFQEFFQRYRIL--YPENSTTTTFSSKLKASTKQNCEFLLTSLQLDTKVYKI 771

Query: 758 GNTKIFFKAGMLAFLEKLRTNKMNEICIIIQKKIRARYYRLQYLQTMESIKKCQ 811
           GNTK+FFKAG+LA LEK +  K+N I I +   IR    R +    ++ +KK +
Sbjct: 772 GNTKLFFKAGVLADLEKQKDVKLNNIMIKLTATIRGYTVRKEITYHLQKLKKTR 825

>ACR068W [1115] [Homologous to ScYHR023W (MYO1) - SH]
           complement(480141..485558) [5418 bp, 1805 aa]
          Length = 1805

 Score =  503 bits (1294), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 298/802 (37%), Positives = 464/802 (57%), Gaps = 72/802 (8%)

Query: 10  WYPHKEQGWIGGEVT-------KNDFFEGTFHLELKLEDGETVSIETNSFENDDDHPTLP 62
           W P  E+ ++ G++        K +  E    + +  ++ E + +ET +           
Sbjct: 9   WVPDAEEVFVKGQLVSTKTIKNKQNKDEKVCLVRVNGKEREVLEVETAAV---------- 58

Query: 63  VLRNPPILESTDDLTTLSYLNEPAVLHAIKKRYMNGQIYTYSGIVLIAANPFDKVDHLYS 122
              NP   +  DD++ L++LNE +VL+ ++ RY +  IYTYSG+ L+A NP+  +  +Y+
Sbjct: 59  ---NPSTFDKIDDMSELTHLNEASVLYNLENRYKDDMIYTYSGLFLVALNPYSNI-KVYT 114

Query: 123 REMIQNYSSKRKDELEPHLFAIAEEAYRFMVHEKANQTVVVSGESGAGKTVSAKYIMRYF 182
           ++ +  Y    K++ EPH+FA+AE+AYR ++ ++ +Q+V+V+GESGAGKT + K I++Y 
Sbjct: 115 QDYVNLYHGSPKEDNEPHIFAVAEQAYRNLLTQRQDQSVLVTGESGAGKTENTKKILQYL 174

Query: 183 ASVQESNNREGEVEMSQIESQILATNPIMEAFGNAKTTRNDNSSRFGKYLQILFDENTTI 242
           AS+  S+ +     +   E +IL  NPI+E+FGNA+T RN+NSSRFGK+++I FDE   I
Sbjct: 175 ASIT-SDEKLAHTNLESFERKILQANPILESFGNAQTVRNNNSSRFGKFIKIEFDEFGKI 233

Query: 243 RGSKIRTYLLEKSRLVYQPETERNYHIFYQILEGLPEPVKQELHL--SSPKDYHYTNQGG 300
            G+ I  YLLEKSR++ Q   ERNYH+FYQ+L G+P    + L L  +S  DY Y  +  
Sbjct: 234 NGAHIEWYLLEKSRIIQQNIRERNYHVFYQLLSGMPAGKLKTLELVSNSITDYAYL-RDS 292

Query: 301 QPNIAGIDEAREYKITTDALSLVGINHETQLGIFKILAGLLHIGNIEMKMTRNDASLSSE 360
            P+I G+D+A ++     A ++VG   +    IF+ +A +LHIGN+E   TR  A  ++ 
Sbjct: 293 NPSIPGVDDAHDFSSLLSAFNVVGFKEDEIHDIFQCIAIILHIGNVEFTSTR--AEQATI 350

Query: 361 EQNLQIACELLGIDPFNFAKWIVKKQIVTRSEKIVTNLNYNQALIARDSVAKFIYSTLFD 420
           + ++   C+L+G+D   F   ++K +     E +  + N  Q+    +S+++ +Y  LF 
Sbjct: 351 KNDVAPLCKLIGVDEAAFKMAVLKPKSKAGKEWVSQSKNAAQSRFILNSLSRSLYEKLFA 410

Query: 421 WLVDNINKTLYDPELDQQDHVFSFIGILDIYGFEHFEKNSFEQFCINYANEKLQQEFNQH 480
            +V  IN++     LD      ++IG+LDI GFE F+ NSFEQ CINY NEKLQQ FN H
Sbjct: 411 HIVRRINRS-----LDHGSMTENYIGLLDIAGFEIFKDNSFEQLCINYTNEKLQQFFNHH 465

Query: 481 VFKLEQEEYVKEEIEWSFIEFS-DNQPCIDLIENK---LGILSLLDEESRLPSGSDESWA 536
           +F LEQ EYVKE+I+W FI++  D +  I+LIE K    GILS+LDEES LP  +DES+ 
Sbjct: 466 MFVLEQREYVKEDIQWDFIDYGKDLEYTIELIEKKNNPAGILSILDEESILPKSTDESFY 525

Query: 537 SKLYSAFN-KPPSNEVFSKPRFGQTKFIVSHYAVDVEYEVEGFIEKNRDSVSLGHLDVFK 595
           SKL SA++ K P    F + +  Q  F++ HYA DVEY V+ ++ KN+D ++   L +  
Sbjct: 526 SKLMSAWDGKSPK---FKRSKLQQC-FVLEHYAADVEYNVKDWLSKNKDPLNDHLLTLLS 581

Query: 596 ATTNPIFKQILDNRELRSDDAPEEQNTEKKIMIPARLSQKKPTLGSMFKKSLGELMAIIN 655
            ++N +  +                 TE+        S+   T  +  K+ L  L+  ++
Sbjct: 582 ESSNKLISEFY---------------TEQS---RGHFSK---TASNRHKEQLTLLLDQLS 620

Query: 656 STNVHYIRCIKPNSEKKPWEFDNLMVLSQLRACGVLETIRISCAGFPSRWTFDEFVQRYF 715
           ST+ H++RCI PN++KK   FD  ++L QLR  GVLE IRI+  G+P+R  F EF QRY 
Sbjct: 621 STDPHFVRCIVPNTKKKAKTFDRKLILDQLRCNGVLEGIRIAREGYPNRIFFREFFQRYK 680

Query: 716 LLTDYSLWSGILYNPDLPKEAIVNFCQSILDATISDSAKYQIGNTKIFFKAGMLAFLEKL 775
           +L           +P     +  N C+ +L     D + Y++GNTK+FFKAG+LA LE  
Sbjct: 681 ILG---------ADPKFSNNSKKN-CEYLLSCISLDPSLYKVGNTKLFFKAGVLAQLETQ 730

Query: 776 RTNKMNEICIIIQKKIRARYYR 797
           +  K++ I   +   I  +  R
Sbjct: 731 KEEKISGIVTGLNAIIHGKTVR 752

>Kwal_23.5534
          Length = 1907

 Score =  497 bits (1280), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 283/759 (37%), Positives = 441/759 (58%), Gaps = 62/759 (8%)

Query: 66  NPPILESTDDLTTLSYLNEPAVLHAIKKRYMNGQIYTYSGIVLIAANPFDKVDHLYSREM 125
           NP   +  DD++ L++LNEP+VLH ++ RY +  IYTYSG+ L+A NP+  +  +YS++ 
Sbjct: 55  NPSTFDRIDDMSELTHLNEPSVLHNLENRYADDNIYTYSGLFLVAINPYSNI-RIYSQDY 113

Query: 126 IQNYSSKRKDELEPHLFAIAEEAYRFMVHEKANQTVVVSGESGAGKTVSAKYIMRYFASV 185
           +  Y    K++ +PH+FAIAEEAY+ ++ E+ +Q+++V+GESGAGKT + K I++Y AS+
Sbjct: 114 VNLYHGSPKEDNKPHIFAIAEEAYQNLLSERRDQSILVTGESGAGKTENTKKILQYLASI 173

Query: 186 QESNNREGEVEMSQIESQILATNPIMEAFGNAKTTRNDNSSRFGKYLQILFDENTTIRGS 245
              +    +      E +IL +NPI+E+FGNA+T RN+NSSRFGK+++I FDE   I G+
Sbjct: 174 TSDDKLSPDTSQESFERKILQSNPILESFGNAQTVRNNNSSRFGKFIKIEFDELGKINGA 233

Query: 246 KIRTYLLEKSRLVYQPETERNYHIFYQILEGLP--EPVKQELHLSSPKDYHYTNQGGQPN 303
            +  YLLEKSR++ Q   ERNYHIFYQ+L G+   E  +  L  +S KDY Y  +   P+
Sbjct: 234 HVDWYLLEKSRVIQQNSRERNYHIFYQMLSGMSAQELRRYGLETNSIKDYGYL-RNSNPS 292

Query: 304 IAGIDEAREYKITTDALSLVGINHETQLGIFKILAGLLHIGNIEMKMTRNDASLSSEEQN 363
           I G+D++++++    +  +VG + +    +   ++ +LHIGNIE    R  A  +S + +
Sbjct: 293 IPGVDDSQDFRTLLSSFQIVGFSEDEIQSMLTCISIILHIGNIEFVSER--AEQASFDGS 350

Query: 364 LQIACELLGIDPFNFAKWIVKKQIVTRSEKIVTNLNYNQALIARDSVAKFIYSTLFDWLV 423
           ++  C LLG+   +F   ++K +     + +    N +QA    +S+++ +Y  LF  +V
Sbjct: 351 VETLCNLLGVTEADFKVAVLKPRAKAGKDWVSQAKNAHQARFILNSLSRSLYENLFAHIV 410

Query: 424 DNINKTLYDPELDQQDHVFSFIGILDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHVFK 483
             IN       LD      ++IG+LDI GFE F+ NSFEQ CINY NEKLQQ FN H+F 
Sbjct: 411 QRINNN-----LDHGSMTENYIGLLDIAGFEIFKHNSFEQLCINYTNEKLQQFFNHHMFV 465

Query: 484 LEQEEYVKEEIEWSFIEFS-DNQPCIDLIE---NKLGILSLLDEESRLPSGSDESWASKL 539
           LEQ EY+KE ++W+FI++  D Q  IDLIE    K GIL LLDEES LP  +DES+ SKL
Sbjct: 466 LEQNEYLKENVQWNFIDYGKDLQSTIDLIERKDTKPGILPLLDEESILPKSTDESFYSKL 525

Query: 540 YSAFNKPPSNEVFSKPRFGQTKFIVSHYAVDVEYEVEGFIEKNRDSVSLGHLDVFKATTN 599
            + ++   S    SK    Q  F++ HYA DVEY V+G++ KN+D +    L +   ++N
Sbjct: 526 ETFYSDKSSKFKRSKK---QRCFVLKHYAGDVEYNVDGWLSKNKDPLHENLLQMLSNSSN 582

Query: 600 PIFKQILDNRELRSDDAPEEQNTEKKIMIPARLSQKKPTLGSMFKKS-------LGELMA 652
            + +     ++ R                           GS FK +       L  L+ 
Sbjct: 583 ELIRGFYSEKDSR---------------------------GSSFKTTSIRHRDQLKSLLD 615

Query: 653 IINSTNVHYIRCIKPNSEKKPWEFDNLMVLSQLRACGVLETIRISCAGFPSRWTFDEFVQ 712
            ++ST  H++RCI PN +KK  +F+  ++L QLR  GVLE IRI+  G+P+R  F EF Q
Sbjct: 616 RLSSTEPHFVRCIIPNDKKKAHDFNRKLILDQLRCNGVLEGIRIAREGYPNRIFFKEFFQ 675

Query: 713 RYFLLTDYSLWSGILYNPDLPKEAIVNFCQSILDATISDSAKYQIGNTKIFFKAGMLAFL 772
           RY +L+D   +S                C+ +L +   D + +++GN+K+FFKAG+LA L
Sbjct: 676 RYKILSDEYRFSNTSKKN----------CEIVLSSLRLDPSVFKVGNSKLFFKAGVLASL 725

Query: 773 EKLRTNKMNEICIIIQKKIRARYYRLQYLQTMESIKKCQ 811
           E  +  +++++   +  +I     R    Q ++ ++  Q
Sbjct: 726 EAKKEGRISDMASKLNARINGNAVRRSTSQKLKKLQAAQ 764

>KLLA0E11572g complement(1018972..1024518) similar to sp|P08964
           Saccharomyces cerevisiae YHR023w MYO1 myosin-1 isoform
           (type II myosin) heavy chain, start by similarity
          Length = 1848

 Score =  496 bits (1277), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 296/757 (39%), Positives = 443/757 (58%), Gaps = 73/757 (9%)

Query: 66  NPPILESTDDLTTLSYLNEPAVLHAIKKRYMNGQIYTYSGIVLIAANPFDKVDHLYSREM 125
           NP   +  DDL+ L++LNE +VL  ++ RY +  IYTYSG+ L+A NP+  +  +YS   
Sbjct: 59  NPSTFDKVDDLSELTHLNEASVLFNLQNRYQDDLIYTYSGLFLVAINPYSNI-KIYSNSY 117

Query: 126 IQNYSSKRKDELEPHLFAIAEEAYRFMVHEKANQTVVVSGESGAGKTVSAKYIMRYFASV 185
           I+ Y    K++ +PH+FA+AE+AY+ ++H+K +Q+++V+GESGAGKT + K I++Y AS+
Sbjct: 118 IKLYHGSPKEDNKPHIFAVAEQAYQNLLHQKQDQSILVTGESGAGKTENTKKILQYLASI 177

Query: 186 QESN----NREGEVEMSQIESQILATNPIMEAFGNAKTTRNDNSSRFGKYLQILFDENTT 241
              +    N+  E      E +IL +NPI+E+FGNA+T RN+NSSRFGK+++I FDE   
Sbjct: 178 TTDDKILLNQTNE----SFERKILQSNPILESFGNAQTVRNNNSSRFGKFIKIDFDEYGK 233

Query: 242 IRGSKIRTYLLEKSRLVYQPETERNYHIFYQILEGLPEPVKQELHL-----SSPKDYHYT 296
           I G+ I  YLLEKSR++     ERNYHIFYQIL G+    KQEL       +S  DY Y 
Sbjct: 234 INGAHIEWYLLEKSRVIQAHARERNYHIFYQILSGMS---KQELRAIGLESNSIVDYQYL 290

Query: 297 NQGGQPNIAGIDEAREYKITTDALSLVGINHETQLGIFKILAGLLHIGNIEMKMTRNDAS 356
                P+I GID+ + Y+    A   VG   +    I K ++ +LHIGN+E    R++  
Sbjct: 291 RHSN-PSIPGIDDGQNYQELVSAFETVGFTKDDIQSILKCISIILHIGNVEFVSERSEQ- 348

Query: 357 LSSEEQNLQIACELLGIDPFNFAKWIVKKQIVTRSEKIVTNLNYNQALIARDSVAKFIYS 416
            +S + +++  C+LLG+   +F   ++K +     E +    N +QA    +S+++ +Y 
Sbjct: 349 -ASIKNDIKPLCKLLGVQEDDFKSAVLKPKSKAGKEWVSQAKNASQARSILNSLSRSLYE 407

Query: 417 TLFDWLVDNINKTLYDPELDQQDHVFSFIGILDIYGFEHFEKNSFEQFCINYANEKLQQE 476
            LF+++V+ INK+L    + +      FIG+LDI GFE F+ NSFEQ CINY NEKLQQ 
Sbjct: 408 KLFEYIVNQINKSLEHGSMTE-----YFIGLLDIAGFEIFKDNSFEQLCINYTNEKLQQF 462

Query: 477 FNQHVFKLEQEEYVKEEIEWSFIEFS-DNQPCIDLIENK----LGILSLLDEESRLPSGS 531
           FN H+F LEQ EY KE+I+W+FI++  D Q  IDLIE K     GIL +L+EES LP  S
Sbjct: 463 FNHHMFVLEQNEYQKEDIQWNFIDYGKDLQTTIDLIEQKNSSIPGILPILEEESILPKSS 522

Query: 532 DESWASKLYSAFNKPPSNEVFSKPRFGQTKFIVSHYAVDVEYEVEGFIEKNRDSVSLGHL 591
           D S+ SKL S+++   +   F + +     FI+ HYA DVEY V  ++ KN+D ++   L
Sbjct: 523 DASFYSKLLSSWDNKSTK--FKRSKLDNC-FILKHYAGDVEYNVTDWLSKNKDPLNENLL 579

Query: 592 DVFKATTNPIFKQILDNRELRSDDAPEEQNTEKKIMIPARLSQKKPTLGSMFKKSLGELM 651
            V     NP+  Q   +R +R                  R S  K       ++ L  L+
Sbjct: 580 QVLNDCANPLVSQFFADR-IRGS--------------SFRTSSNK------HREQLHTLI 618

Query: 652 AIINSTNVHYIRCIKPNSEKKPWEFDNLMVLSQLRACGVLETIRISCAGFPSRWTFDEFV 711
             + +T+ H++RCI PN++KK  +FD  ++L QLR  GVLE IRI+  G+P+R  F EF 
Sbjct: 619 EQLGNTDPHFVRCIIPNNKKKAGDFDKKLILDQLRCNGVLEGIRIARDGYPNRIFFKEFF 678

Query: 712 QRYFLLTDYSLWSGILYNPDLPKEAIVNFCQSILDATISDSAKYQIGNTKIFFKAGMLAF 771
           QRY +L+D   ++                C+ +L +   D   Y++GNTK+FFKAG+LA 
Sbjct: 679 QRYKILSDECRFTNNSKKN----------CEILLSSLHLDPTIYKVGNTKLFFKAGVLAN 728

Query: 772 LEKLRTNKMNEI-----CII----IQKKIRARYYRLQ 799
           LE L+  +++        II    ++K+IR+   +LQ
Sbjct: 729 LELLKEQRLSAAVTRLNAIISANSVRKEIRSHLKKLQ 765

>CAGL0J00693g complement(61246..66900) similar to sp|P08964
           Saccharomyces cerevisiae YHR023w MYO1, hypothetical
           start
          Length = 1884

 Score =  471 bits (1213), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 297/816 (36%), Positives = 457/816 (56%), Gaps = 72/816 (8%)

Query: 8   KCWYPHKEQGWIGGEVTKNDFFEGTFH-------LELKLEDGETVSIETNSFENDDDHPT 60
           + W P   + ++ G++   D  +  F        L  K  DGET + + +          
Sbjct: 6   RVWVPDPVEIFVRGDLLNTDIVKDKFTGVEQQVGLVKKDNDGETATFKISEI-------- 57

Query: 61  LPVLRNPPILESTDDLTTLSYLNEPAVLHAIKKRYMNGQIYTYSGIVLIAANPFDKVDHL 120
            PV  NP   +  D+++ L++LNEP+VL+ ++ RY +  IYTYSG+ L+A NP+ ++ +L
Sbjct: 58  FPV--NPANFDRVDNMSELTHLNEPSVLNNLENRYKDNLIYTYSGLFLVAINPYKEISNL 115

Query: 121 YSREMIQNY-SSKRKDELEPHLFAIAEEAYRFMVHEKANQTVVVSGESGAGKTVSAKYIM 179
           YS   I++Y SS  +   +PH+F +AE AYR +  +K +Q+++V+GESGAGKT + K I+
Sbjct: 116 YSNSTIKSYHSSNEETSQKPHIFEVAESAYRDLKSKKQDQSILVTGESGAGKTENTKKIL 175

Query: 180 RYFASV-----QESNNREGEVEMSQIESQILATNPIMEAFGNAKTTRNDNSSRFGKYLQI 234
           +Y AS+     + SNN          E +IL +NP++E+FGNA+T RN+NSSRFGK+++I
Sbjct: 176 QYLASITSDSFEVSNN---------FEMKILQSNPVLESFGNAQTVRNNNSSRFGKFIKI 226

Query: 235 LFDENTTIRGSKIRTYLLEKSRLVYQPETERNYHIFYQILEGLPEPVKQELHLSSPKDYH 294
            FD++  I G+ I  YLLEKSR+  +   ERNYHIFYQ+L+G  +   + ++  S  D+ 
Sbjct: 227 EFDQSGKINGAFIEWYLLEKSRITNENRNERNYHIFYQLLKGTSQKDLESIYKLSSNDFA 286

Query: 295 YTNQGGQPN--IAGIDEAREYKITTDALSLVGINHETQLGIFKILAGLLHIGNIEMKMTR 352
           +       N  I G+D+A E++    AL  VG   +    IFKI+A +LH GNIE    +
Sbjct: 287 HYQILANSNHVIPGVDDAAEFQKLLVALETVGFGKDQINSIFKIVAVILHCGNIEFVSEK 346

Query: 353 ND-ASLSSEEQNLQIACELLGIDPFNFAKWIVKKQIVTRSEKIVTNLNYNQALIARDSVA 411
           ++ AS  S   ++     LLG+   +F   I+K +     E +    N NQA    +S+ 
Sbjct: 347 SEQASFKS---DISAIATLLGVSESDFKTAILKPRSKAGREWVSQAKNANQARFIINSLC 403

Query: 412 KFIYSTLFDWLVDNINKTLYDPELDQQDHVFSFIGILDIYGFEHFEKNSFEQFCINYANE 471
           + +Y  LF ++VD IN +L    +       ++IG+LDI GFE FE NSFEQ CINY NE
Sbjct: 404 RTLYEHLFGYIVDTINMSLNHGSM-----TANYIGLLDIAGFEIFEHNSFEQLCINYTNE 458

Query: 472 KLQQEFNQHVFKLEQEEYVKEEIEWSFIEFS-DNQPCIDLIENK---LGILSLLDEESRL 527
           KLQQ FN H+F LEQ EY+KE I+W ++++  D Q  I+L+E K    GIL LLDEE+ L
Sbjct: 459 KLQQFFNHHMFVLEQSEYLKENIQWDYVDYGKDLQSTINLLEAKGPPTGILPLLDEETIL 518

Query: 528 PSGSDESWASKLYSAFNKPPSNEVFSKPRFGQTKFIVSHYAVDVEYEVEGFIEKNRDSVS 587
           P   D S+ SKL S + +  +   F + +     F++ HYA DVEY V G++ KN+D ++
Sbjct: 519 PKSEDSSFYSKLISTWQQNSTK--FKRSKLDMC-FVLKHYAGDVEYHVNGWLAKNKDPLN 575

Query: 588 LGHLDVFKATTNPIFKQILDNRELRSDD-------APEEQNTEKKIMIPARLSQKKPTLG 640
              +++   ++N +  +     E  S              +     +   R + K  T  
Sbjct: 576 ENLVNILSVSSNRLISEFFSGFESISSPSSSPTRLTHSSSSASINSLGKGRTNLK--TAL 633

Query: 641 SMFKKSLGELMAIINSTNVHYIRCIKPNSEKKPWEFDNLMVLSQLRACGVLETIRISCAG 700
           S  ++    L++ +  TN H++RCI PN++K    FD  ++L QLR  GVLE IRI+  G
Sbjct: 634 SRHREQQSSLLSQLALTNPHFVRCIIPNNKKMSETFDRRLILDQLRCNGVLEGIRIAREG 693

Query: 701 FPSRWTFDEFVQRYFLLTDYSLWSGILYNPDLPKEAIVNFCQS--ILDATIS-DSAKYQI 757
           +P+R  F EF +RY +L+++          D   +AI N+ QS  IL + +  D   Y++
Sbjct: 694 YPNRILFKEFYERYRILSEH---------LDKSSDAI-NYKQSSQILISELHLDPTTYKV 743

Query: 758 GNTKIFFKAGMLAFLEKLRTNKMNEICIIIQKKIRA 793
           G +K+FFKAG LA LE  + + + EI +     IR 
Sbjct: 744 GTSKLFFKAGTLAELESKKESILFEITVRFNSIIRG 779

>Scas_721.119
          Length = 1232

 Score =  443 bits (1140), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 276/736 (37%), Positives = 411/736 (55%), Gaps = 71/736 (9%)

Query: 75  DLTTLSYLNEPAVLHAIKKRYMNGQIYTYSGIVLIAANPFDKVDHLYSREMIQNYSSKRK 134
           DLT LS +++  +   +KKR+MNG IYTY G VLI+ NPF  +  +Y+  ++++Y  K +
Sbjct: 40  DLTLLSKISDETINDNLKKRFMNGTIYTYIGHVLISVNPFRDLG-IYTDAIVESYKGKNR 98

Query: 135 DELEPHLFAIAEEAYRFMVHEKANQTVVVSGESGAGKTVSAKYIMRYFASVQESNNREGE 194
            E+ PH+FAIAE  Y  M     NQ V++SGESGAGKT +AK IM+Y AS   +++    
Sbjct: 99  LEVPPHVFAIAESMYYNMKSYNENQCVIISGESGAGKTEAAKRIMQYIASASTTHSES-- 156

Query: 195 VEMSQIESQILATNPIMEAFGNAKTTRNDNSSRFGKYLQILFDENTTIRGSKIRTYLLEK 254
             + +I+  +LATNP++E+FG AKT RN+NSSR GKYL+I F+         I  YLLEK
Sbjct: 157 --IGKIKDMVLATNPLLESFGCAKTLRNNNSSRHGKYLEIRFNSQFEPCAGNITNYLLEK 214

Query: 255 SRLVYQPETERNYHIFYQILEGLPEPVKQELHLSSPKDYHYTNQGGQPNIAGIDEAREYK 314
            R+V Q + ERN+HIFYQ  +G  +  +Q   +  P+ Y YT+  G  ++  ID+  +Y+
Sbjct: 215 QRVVSQIKNERNFHIFYQFTKGASDAYRQTFGVQKPEQYIYTSASGCTSVDTIDDVNDYR 274

Query: 315 ITTDALSLVGINHETQLGIFKILAGLLHIGNIEMKMTRNDASLSSEEQNLQI-------- 366
            T  A+ ++G++ E Q  IF++LA +L IGN+          + +EE N Q+        
Sbjct: 275 ETLKAMEVIGLHQEEQDQIFRMLAAVLWIGNVSF--------VENEEGNAQVRDTSVTDF 326

Query: 367 ACELLGIDPFNFAKWIVKKQIVT-----RSEKIVTNLNYNQALIARDSVAKFIYSTLFDW 421
              LL ID     K +V++ + T     R       LN  QA   RD++AK IY+ LF+W
Sbjct: 327 VAYLLQIDAPLLIKSLVERVMETNHGMRRGSVYHVPLNIVQATAVRDALAKAIYNNLFEW 386

Query: 422 LVDNINKTLYD-PELDQQDHVFSFIGILDIYGFEHFEKNSFEQFCINYANEKLQQEFNQH 480
           +V  +N +L   P  D+       IGILDIYGFE FE NSFEQ CINY NEKLQQ F Q 
Sbjct: 387 IVGRVNVSLQAYPGADRS------IGILDIYGFEIFEHNSFEQICINYVNEKLQQIFIQL 440

Query: 481 VFKLEQEEYVKEEIEWSFIEFSDNQPCIDLIENKL--GILSLLDEESRLP----SGSDES 534
             K EQE Y +E+I+W+ I++ DN+   DLIE K   GI + +++         + +D++
Sbjct: 441 TLKSEQETYKREKIKWTPIKYFDNKVVCDLIEAKRPPGIFAAMNDSVATAHADSNAADQA 500

Query: 535 WASKLYSAFNKPPSNEVFSKPRFGQTKFIVSHYAVDVEYEVEGFIEKNRDSVSLGHLDVF 594
           +A +L + F+  P  E+ S       KF++ HYA DV Y+V G  +KN+D +    +++ 
Sbjct: 501 FAQRL-NMFSSNPHFELRS------NKFVIKHYAGDVTYDVNGITDKNKDQLQKDLVELI 553

Query: 595 KATTNPIFKQILDNRELRSDDAPEEQNTEKKIMIPARLSQKKPTLGSMFKKSLGELMAII 654
             TTNP    I           P E + E K        ++ PT G    KS  EL+  +
Sbjct: 554 ATTTNPFLSGIF----------PVEVDKESK--------RRPPTAGDKIIKSANELVETL 595

Query: 655 NSTNVHYIRCIKPNSEKKPWEFDNLMVLSQLRACGVLETIRISCAGFPSRWTFDEFVQRY 714
           +     YIR IKPN  K P ++D+  VL Q++  G+ E +RI  AGF  R TF++FV+R+
Sbjct: 596 SKAQPSYIRTIKPNQTKSPNDYDDHQVLHQVKYLGLQENVRIRRAGFAYRQTFEKFVERF 655

Query: 715 FLLTDYSLWSGILYNPDLPKEA-IVNFCQSILDATISDSAKYQIGNTKIFFKAGMLAF-L 772
           +LL+ +  ++G     D   +   ++  Q IL+     +++YQ+G T +F K     F L
Sbjct: 656 YLLSPHCSYAG-----DYTWQGETLDAVQHILNDASIPASEYQLGTTSVFIKTPETLFAL 710

Query: 773 EKLRTNKMNEICIIIQ 788
           E +R    + +   IQ
Sbjct: 711 EHMRDRYWHNMAARIQ 726

>KLLA0B12562g complement(1095953..1099735) similar to sp|Q04439
           Saccharomyces cerevisiae YMR109w MYO5 myosin I, start by
           similarity
          Length = 1260

 Score =  441 bits (1134), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 281/761 (36%), Positives = 420/761 (55%), Gaps = 72/761 (9%)

Query: 75  DLTTLSYLNEPAVLHAIKKRYMNGQIYTYSGIVLIAANPFDKVDHLYSREMIQNYSSKRK 134
           DLT LS +++ A+   +KKR+ NG IYTY G VLI+ NPF  +  +Y+  ++++Y  K +
Sbjct: 38  DLTLLSSISDDAINQNLKKRFENGTIYTYIGHVLISVNPFRDLG-IYTDAVLESYKGKNR 96

Query: 135 DELEPHLFAIAEEAYRFMVHEKANQTVVVSGESGAGKTVSAKYIMRYFASVQESNNREGE 194
            E+ PH+FAIAE  Y  +     NQ V++SGESGAGKT +AK IM+Y A+   ++    E
Sbjct: 97  LEVPPHVFAIAEAMYYNLKAYNENQCVIISGESGAGKTEAAKRIMQYIAAASSTH----E 152

Query: 195 VEMSQIESQILATNPIMEAFGNAKTTRNDNSSRFGKYLQILFDENTTIRGSKIRTYLLEK 254
             + +I+  +LATNP++E+FG AKT RN+NSSR GKYL+I F+E       +I  YLLEK
Sbjct: 153 ASIGKIKDMVLATNPLLESFGCAKTLRNNNSSRHGKYLEIRFNEQFEPCAGQITNYLLEK 212

Query: 255 SRLVYQPETERNYHIFYQILEGLPEPVKQELHLSSPKDYHYTNQGGQPNIAGIDEAREYK 314
            R+V Q   ERN+HIFYQ  +G  +  +Q   +  P  Y YT+  G  ++  ID+  +Y+
Sbjct: 213 QRVVGQIRNERNFHIFYQFTKGASDTYRQNFGVLQPDQYIYTSASGCTSVDTIDDLHDYQ 272

Query: 315 ITTDALSLVGINHETQLGIFKILAGLLHIGNIEMKMTRNDASLSSEEQNL-QIACELLGI 373
            T  A+ ++G++ E Q  IF++L+ +L IGN+   +  N+ +    + ++      L+ +
Sbjct: 273 ETIKAMQVIGLSQEEQDQIFRMLSAILWIGNVTF-VENNEGNAEVRDTSVTDFVAYLMQV 331

Query: 374 DPFNFAKWIVKKQIVT-----RSEKIVTNLNYNQALIARDSVAKFIYSTLFDWLVDNINK 428
           D     K +V++ + T     R       LN  QA   RD++AK IY+ LFDW+VD +N 
Sbjct: 332 DSGLLIKCLVERVMETGHGSRRGSVYHVPLNVVQATAVRDALAKAIYNNLFDWIVDRVNV 391

Query: 429 TLYDPELDQQDHVFSFIGILDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHVFKLEQEE 488
           +     L         IGILDIYGFE FE NSFEQ CINY NEKLQQ F Q   K EQEE
Sbjct: 392 S-----LKAFPGAVKSIGILDIYGFEIFEHNSFEQICINYVNEKLQQIFIQLTLKSEQEE 446

Query: 489 YVKEEIEWSFIEFSDNQPCIDLIENKL--GILSLLDEESRLP----SGSDESWASKLYSA 542
           Y KE+I+W+ I++ DN+   DLIE+K   GI + LD+         + +D+++A +L   
Sbjct: 447 YNKEQIQWTPIKYFDNKVVCDLIESKRPPGIFATLDDSVATAHADSNAADQAFAQRL--- 503

Query: 543 FNKPPSNEVFSKPRFGQTKFIVSHYAVDVEYEVEGFIEKNRDSVSLGHLDVFKATTNPIF 602
            N   +N  F       +KF++ HYA DV Y++ G  +KN+D +     ++ + TTNP  
Sbjct: 504 -NLFSTNAHFD---LRSSKFVIKHYAGDVTYDISGMTDKNKDQLVKDLAELVQTTTNPFL 559

Query: 603 KQILDNRELRSDDAPEEQNTEKKIMIPARLSQKKPTLGSMFKKSLGELMAIINSTNVHYI 662
             I           P+  +   K        ++ PT G+   KS  EL+  ++     YI
Sbjct: 560 STIF----------PDTIDKSSK--------RRPPTAGNKIIKSANELVETLSKAQPSYI 601

Query: 663 RCIKPNSEKKPWEFDNLMVLSQLRACGVLETIRISCAGFPSRWTFDEFVQRYFLLT---- 718
           R IKPN  K P ++D+  VL Q++  G+ E +RI  AGF  R TF++FV+R++LL+    
Sbjct: 602 RTIKPNQTKSPRDYDDQQVLHQVKYLGLQENVRIRRAGFAYRQTFEKFVERFYLLSPKCS 661

Query: 719 ---DYSLWSGILYNPDLPKEAIVNFCQSILDATISDSAKYQIGNTKIFFKAGMLAF-LEK 774
              DY+ W G         + +    Q + DA+I  + +YQ+G TK+F K     F LE 
Sbjct: 662 YAGDYT-WQG---------DTLGAVKQILQDASIP-TTEYQLGVTKVFIKTPETLFALEH 710

Query: 775 LRTNKMNEICIIIQKKIRARYYRLQYLQTMESIKKCQSQIR 815
           +R      +   IQ     R +R    + ++S  K Q  IR
Sbjct: 711 MRDRYWYNMAARIQ-----RAWRRFIQRRIDSAIKIQRAIR 746

>CAGL0K03487g 322030..325683 highly similar to sp|Q04439
           Saccharomyces cerevisiae YMR109w myosin-like protein,
           start by similarity
          Length = 1217

 Score =  430 bits (1105), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 271/751 (36%), Positives = 413/751 (54%), Gaps = 88/751 (11%)

Query: 75  DLTTLSYLNEPAVLHAIKKRYMNGQIYTYSGIVLIAANPFDKVDHLYSREMIQNYSSKRK 134
           DLT L+ +++ ++   +KKR++NG IYTY G VLI+ NPF  +  +Y+  ++++Y  K +
Sbjct: 41  DLTLLTSISDESINDNLKKRFLNGTIYTYIGHVLISVNPFRDLG-IYTDAIMKSYQGKNR 99

Query: 135 DELEPHLFAIAEEAYRFMVHEKANQTVVVSGESGAGKTVSAKYIMRYFASVQESNNREGE 194
            E+ PH++AI+E  Y  +     NQ V++SGESGAGKT +AK IM Y A+   +++    
Sbjct: 100 LEVPPHVYAISEAMYYNLKAYNENQCVIISGESGAGKTEAAKKIMEYIAATSSTHSES-- 157

Query: 195 VEMSQIESQILATNPIMEAFGNAKTTRNDNSSRFGKYLQILFDENTTIRGSKIRTYLLEK 254
             + +I+  +LATNP++E+FG AKT RN+NSSR GKYL+I F+         I  YLLEK
Sbjct: 158 --IGKIKDMVLATNPLLESFGCAKTLRNNNSSRHGKYLEIRFNSQFEPCAGNITNYLLEK 215

Query: 255 SRLVYQPETERNYHIFYQILEGLPEPVKQELHLSSPKDYHYTNQGGQPNIAGIDEAREYK 314
            R+V Q   ERN+HIFYQ  +G  +  +Q   +  P+ Y YT+     ++  ID+ ++++
Sbjct: 216 QRVVGQITNERNFHIFYQFTKGASDNYRQTFGVQLPEQYVYTSASKCTSVDTIDDVKDFE 275

Query: 315 ITTDALSLVGINHETQLGIFKILAGLLHIGNIEMKMTRNDASLSSEEQNLQI-------- 366
            T  A+ ++G+  E Q  IF++LA +L IGNI          + +EE N Q+        
Sbjct: 276 ATIKAMQVIGLAQEEQDQIFRMLAAILWIGNISF--------IENEEGNAQVRDTSVTDF 327

Query: 367 ACELLGIDPFNFAKWIVKKQIVT-----RSEKIVTNLNYNQALIARDSVAKFIYSTLFDW 421
              LL +D  +  K +V++ + T     R       LN  QA   RD++AK IY+ LF+W
Sbjct: 328 VAYLLQVDSQSLIKALVERIVETNHGSRRGSVYHVPLNIVQATAVRDALAKAIYNNLFEW 387

Query: 422 LVDNINKTLYD-PELDQQDHVFSFIGILDIYGFEHFEKNSFEQFCINYANEKLQQEFNQH 480
           +VD +NK+L+  P  D+       IGILDIYGFE FE NSFEQ CINY NEKLQQ F Q 
Sbjct: 388 IVDRVNKSLHAYPGADKS------IGILDIYGFEIFEHNSFEQICINYVNEKLQQIFIQL 441

Query: 481 VFKLEQEEYVKEEIEWSFIEFSDNQPCIDLIENKL--GILSLLDEESRLP----SGSDES 534
             K EQ+ Y +E+I+W+ I++ DN+   DLIE K   GI + +++         S +D++
Sbjct: 442 TLKSEQDTYAREKIQWTPIKYFDNKVVCDLIEAKRPPGIFAAMNDSVATAHADSSAADQA 501

Query: 535 WASKLYSAFNKPPSNEVFSKPRF--GQTKFIVSHYAVDVEYEVEGFIEKNRDSVSLGHLD 592
           +A +L S F+        S P F   Q KF++ HYA DV Y+V G  +KN+D +    ++
Sbjct: 502 FAQRL-SLFS--------SNPHFEQRQNKFVIKHYAGDVTYDVLGMTDKNKDQLQKDLVE 552

Query: 593 VFKATTNPIFKQILDNRELRSDDAPEEQNTEKKIMIPARLSQKKPTLGSMFKKSLGELMA 652
           +   TTN     +  N+  + +                   ++ PT G    KS  EL+ 
Sbjct: 553 LVGTTTNAFLTTLFPNQVDKDN------------------KRRPPTAGDKIIKSANELVE 594

Query: 653 IINSTNVHYIRCIKPNSEKKPWEFDNLMVLSQLRACGVLETIRISCAGFPSRWTFDEFVQ 712
            ++     YIR IKPN  K P ++D+  VL Q++  G+ E +RI  AGF  R  F++FV+
Sbjct: 595 TLSKAQPSYIRTIKPNQTKSPNDYDDHQVLHQVKYLGLQENVRIRRAGFAYRQGFEKFVE 654

Query: 713 RYFLLT-------DYSLWSGILYNPDLPKEAIVNFCQSILDATISDSAKYQIGNTKIFFK 765
           R++LL+       DY+ W+G           I+   + IL   +    +YQ+G T++F K
Sbjct: 655 RFYLLSPRCSYAGDYT-WTG----------DILEAVRLILQDALIPEKEYQLGVTQVFIK 703

Query: 766 AGMLAF-LEKLRTNKMNEICIIIQKKIRARY 795
                F LE +R    + +   IQ+  R RY
Sbjct: 704 TPETLFALENMRDKFWHNMAARIQRAWR-RY 733

>Kwal_26.7587
          Length = 1250

 Score =  427 bits (1099), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 274/759 (36%), Positives = 419/759 (55%), Gaps = 68/759 (8%)

Query: 75  DLTTLSYLNEPAVLHAIKKRYMNGQIYTYSGIVLIAANPFDKVDHLYSREMIQNYSSKRK 134
           DLT LS +++ A+   +KKR+ NG IYTY G VLI+ NPF  +  +Y+  ++++Y  K +
Sbjct: 40  DLTLLSKISDEAINENLKKRFQNGTIYTYIGHVLISVNPFRDLG-IYTDSVLRSYVGKNR 98

Query: 135 DELEPHLFAIAEEAYRFMVHEKANQTVVVSGESGAGKTVSAKYIMRYFASVQESNNREGE 194
            E+ PH+FAIAE  Y  M     NQ V++SGESGAGKT +AK IM+Y A+  E+++    
Sbjct: 99  LEVAPHVFAIAESMYYNMKAYNENQCVIISGESGAGKTEAAKRIMQYIAAASETHSDS-- 156

Query: 195 VEMSQIESQILATNPIMEAFGNAKTTRNDNSSRFGKYLQILFDENTTIRGSKIRTYLLEK 254
             + +I+  +LATNP++E+FG AKT RN+NSSR GKYL+I F+         I  YLLEK
Sbjct: 157 --IGKIKDMVLATNPLLESFGCAKTLRNNNSSRHGKYLEIRFNAQFEPCAGNITNYLLEK 214

Query: 255 SRLVYQPETERNYHIFYQILEGLPEPVKQELHLSSPKDYHYTNQGGQPNIAGIDEAREYK 314
            R+V Q + ERN+HIFYQ  +G  +  +Q   +  P+ Y YT+  G  ++  ID+  +++
Sbjct: 215 QRVVGQLKDERNFHIFYQFTKGASDNYRQIYGVQKPEQYLYTSASGCTSVDTIDDLSDFQ 274

Query: 315 ITTDALSLVGINHETQLGIFKILAGLLHIGNIEMKMTRNDASLSSEEQNLQIACELLGID 374
            T +A+S++GI    Q  +F+ LA +L IGNI         +   +         LL +D
Sbjct: 275 ETLNAMSVIGITQHEQDEVFRFLAAILWIGNISFTENEEGNAQVRDTSVTDFVAYLLQVD 334

Query: 375 PFNFAKWIVKKQIVT-----RSEKIVTNLNYNQALIARDSVAKFIYSTLFDWLVDNINKT 429
                + +V++ + T     R       LN  QA   +D++AK IY+ LFDW VD +N +
Sbjct: 335 SNLLVQALVERVMETNHGMKRGSIYHVPLNVVQATAVKDALAKAIYNNLFDWTVDRVNLS 394

Query: 430 LYD-PELDQQDHVFSFIGILDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHVFKLEQEE 488
           L   P  ++       IGILDIYGFE F+ NSFEQ CINY NEKLQQ F Q   K EQEE
Sbjct: 395 LQALPGANKS------IGILDIYGFEIFDYNSFEQICINYVNEKLQQIFIQLTLKSEQEE 448

Query: 489 YVKEEIEWSFIEFSDNQPCIDLIENKL--GILSLLDEESRLP----SGSDESWASKLYSA 542
           Y +E+IEW+ I++ DN+   DLIE +   GI++ +++           +D+++A +L + 
Sbjct: 449 YAREQIEWTPIKYFDNRVVCDLIEARRPPGIIAAMNDSVATAHADSDAADQAFAQRL-NL 507

Query: 543 FNKPPSNEVFSKPRFGQTKFIVSHYAVDVEYEVEGFIEKNRDSVSLGHLDVFKATTN--- 599
           F+  P  E+ S      +KFI+ HYA DV Y++ G  +KN+D +    +++ K ++N   
Sbjct: 508 FSSNPHFELRS------SKFIIKHYAGDVTYDIFGMTDKNKDQLQKDLVELVKTSSNEFL 561

Query: 600 -PIFKQILDNRELRSDDAPEEQNTEKKIMIPARLSQKKPTLGSMFKKSLGELMAIINSTN 658
             +F  ++D    R                      + P+ G    KS  EL+  ++   
Sbjct: 562 CSLFPTVVDKNSKR----------------------RPPSAGDKIIKSANELVETLSKAQ 599

Query: 659 VHYIRCIKPNSEKKPWEFDNLMVLSQLRACGVLETIRISCAGFPSRWTFDEFVQRYFLLT 718
             YIR IKPN  K P ++D+  VL Q++  G+ E +RI  AGF  R  FD+FV+R++LL+
Sbjct: 600 PSYIRTIKPNQTKSPNDYDDHQVLHQVKYLGLQENVRIRRAGFAYRQVFDKFVERFYLLS 659

Query: 719 DYSLWSGILYNPDLPKEAIVNFCQSIL-DATISDSAKYQIGNTKIFFKAGMLAF-LEKLR 776
               ++G         EA+    + IL DA+I  + +YQ+G +K+F K     F LE +R
Sbjct: 660 PQCSYAGDYTWQGDTLEAV----KLILKDASIPPT-EYQLGVSKVFIKTPESLFALETMR 714

Query: 777 TNKMNEICIIIQKKIRARYYRLQYLQTMESIKKCQSQIR 815
               + +   IQ     R +R   L+ +++  + Q  IR
Sbjct: 715 DKYWHNMAARIQ-----RAWRRFLLRRIDAASRIQRAIR 748

>YMR109W (MYO5) [4066] chr13 (486586..490245) Myosin type I, may
           play a role in cell growth or polarity that is partially
           redundant with Myo3p, appears to stimulate actin patch
           formation, has an SH3 domain [3660 bp, 1219 aa]
          Length = 1219

 Score =  426 bits (1095), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 274/766 (35%), Positives = 414/766 (54%), Gaps = 82/766 (10%)

Query: 75  DLTTLSYLNEPAVLHAIKKRYMNGQIYTYSGIVLIAANPFDKVDHLYSREMIQNYSSKRK 134
           DLT LS +++ A+   +KKR++N  IYTY G VLI+ NPF  +  +Y+  ++  Y  K +
Sbjct: 40  DLTLLSKISDEAINENLKKRFLNATIYTYIGHVLISVNPFRDLG-IYTDAVMNEYKGKNR 98

Query: 135 DELEPHLFAIAEEAYRFMVHEKANQTVVVSGESGAGKTVSAKYIMRYFASVQESNNREGE 194
            E+ PH+FAIAE  Y  M     NQ V++SGESGAGKT +AK IM+Y A+   ++     
Sbjct: 99  LEVPPHVFAIAESMYYNMKSYNENQCVIISGESGAGKTEAAKRIMQYIAAASSTHTES-- 156

Query: 195 VEMSQIESQILATNPIMEAFGNAKTTRNDNSSRFGKYLQILFDENTTIRGSKIRTYLLEK 254
             + +I+  +LATNP++E+FG AKT RN+NSSR GKYL+I F+         I  YLLEK
Sbjct: 157 --IGKIKDMVLATNPLLESFGCAKTLRNNNSSRHGKYLEIKFNNQFEPCAGNITNYLLEK 214

Query: 255 SRLVYQPETERNYHIFYQILEGLPEPVKQELHLSSPKDYHYTNQGGQPNIAGIDEAREYK 314
            R+V Q + ERN+HIFYQ  +G  +  +Q   +  P+ Y YT   G  +   ID+ ++Y+
Sbjct: 215 QRVVSQIKNERNFHIFYQFTKGASDAYRQTFGVQKPEQYVYTAAAGCISAETIDDLQDYQ 274

Query: 315 ITTDALSLVGINHETQLGIFKILAGLLHIGNIEMKMTRNDASLSSEEQNLQI-------- 366
            T  A+ ++G+  E Q  IF++LA +L IGN+          + +EE N Q+        
Sbjct: 275 ETLKAMRVIGLGQEEQDQIFRMLAAILWIGNVSF--------IENEEGNAQVRDTSVTDF 326

Query: 367 ACELLGIDPFNFAKWIVKKQIVT-----RSEKIVTNLNYNQALIARDSVAKFIYSTLFDW 421
              LL ID     K +V++ + T     R       LN  QA   RD++AK IY+ LFDW
Sbjct: 327 VAYLLQIDSQLLIKSLVERIMETNHGMKRGSVYHVPLNIVQADAVRDALAKAIYNNLFDW 386

Query: 422 LVDNINKTLYD-PELDQQDHVFSFIGILDIYGFEHFEKNSFEQFCINYANEKLQQEFNQH 480
           +V  +NK+L   P  ++       IGILDIYGFE FE NSFEQ CINY NEKLQQ F Q 
Sbjct: 387 IVSRVNKSLQAFPGAEKS------IGILDIYGFEIFEHNSFEQICINYVNEKLQQIFIQL 440

Query: 481 VFKLEQEEYVKEEIEWSFIEFSDNQPCIDLIENKL--GILSLLDEESRLP----SGSDES 534
             K EQE Y +E+I+W+ I++ DN+   DLIE +   GI + +++         + +D++
Sbjct: 441 TLKSEQETYEREKIQWTPIKYFDNKVVCDLIEARRPPGIFAAMNDSVATAHADSNAADQA 500

Query: 535 WASKLYSAFNKPPSNEVFSKPRFG--QTKFIVSHYAVDVEYEVEGFIEKNRDSVSLGHLD 592
           +A +L         N   + P F     KF++ HYA DV Y+++G  +KN+D +    ++
Sbjct: 501 FAQRL---------NLFTTNPHFDLRSNKFVIKHYAGDVTYDIDGITDKNKDQLQKDLVE 551

Query: 593 VFKATTNPIFKQILDNRELRSDDAPEEQNTEKKIMIPARLSQKKPTLGSMFKKSLGELMA 652
           +   TTN     I           P+  + E K        ++ PT G    KS  +L+ 
Sbjct: 552 LIGTTTNTFLATIF----------PDTVDRESK--------RRPPTAGDKIIKSANDLVE 593

Query: 653 IINSTNVHYIRCIKPNSEKKPWEFDNLMVLSQLRACGVLETIRISCAGFPSRWTFDEFVQ 712
            ++     YIR IKPN  K P ++D+  VL Q++  G+ E +RI  AGF  R  F++FV+
Sbjct: 594 TLSKAQPSYIRTIKPNETKSPNDYDDRQVLHQIKYLGLQENVRIRRAGFAYRQVFEKFVE 653

Query: 713 RYFLLTDYSLWSG-ILYNPDLPKEAIVNFCQSILDATISDSAKYQIGNTKIFFKAGMLAF 771
           R++LL+ +  ++G   +  D      ++  + IL  +     +YQ+G T +F K     F
Sbjct: 654 RFYLLSPHCSYAGDYTWQGD-----TLDAVKYILQDSSIPQQEYQLGVTSVFIKTPETLF 708

Query: 772 -LEKLRTNKMNEICIIIQKKIRARYYRLQYLQ-TMESIKKCQSQIR 815
            LE +R    + +   IQ+  R      ++LQ  +++  K Q  IR
Sbjct: 709 ALEHMRDRYWHNMAARIQRAWR------RFLQRRIDAATKIQRTIR 748

>YKL129C (MYO3) [3137] chr11 complement(196350..200165) Myosin type
           I, may play a role in cell growth or polarity that is
           partially redundant with Myo5p, has an SH3 domain [3816
           bp, 1271 aa]
          Length = 1271

 Score =  422 bits (1085), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 281/765 (36%), Positives = 418/765 (54%), Gaps = 81/765 (10%)

Query: 75  DLTTLSYLNEPAVLHAIKKRYMNGQIYTYSGIVLIAANPFDKVDHLYSREMIQNYSSKRK 134
           DLT LS +++ ++   +KKR+ NG IYTY G VLI+ NPF  +  +Y+  ++++Y  K +
Sbjct: 40  DLTLLSKISDESINENLKKRFKNGIIYTYIGHVLISVNPFRDLG-IYTNAVLESYKGKNR 98

Query: 135 DELEPHLFAIAEEAYRFMVHEKANQTVVVSGESGAGKTVSAKYIMRYFASVQESNNREGE 194
            E+ PH+FAIAE  Y  +     NQ V++SGESGAGKT +AK IM+Y A+   S++    
Sbjct: 99  LEVPPHVFAIAESMYYNLKSYNENQCVIISGESGAGKTEAAKRIMQYIAAASNSHSES-- 156

Query: 195 VEMSQIESQILATNPIMEAFGNAKTTRNDNSSRFGKYLQILFDENTTIRGSKIRTYLLEK 254
             + +I+  +LATNP++E+FG AKT RN+NSSR GKYL+I F+         I  YLLEK
Sbjct: 157 --IGKIKDMVLATNPLLESFGCAKTLRNNNSSRHGKYLEIKFNSQFEPCAGNITNYLLEK 214

Query: 255 SRLVYQPETERNYHIFYQILEGLPEPVKQELHLSSPKDYHYTNQGGQPNIAGIDE--ARE 312
            R+V Q + ERN+HIFYQ  +G  +  KQ   +  P+ Y YT   G       D+   ++
Sbjct: 215 QRVVGQIKNERNFHIFYQFTKGASDTYKQMFGVQMPEQYIYTAAAG---CTSADQLMRKD 271

Query: 313 YKITTDALSLVGINHETQLGIFKILAGLLHIGNIEMKMTRNDASLSSEEQNLQIA----- 367
           Y+ T +A+  +G+  E Q  IF++LA +L IGNI          + +EE N Q+      
Sbjct: 272 YEGTLEAMRTIGLVQEEQDQIFRMLAAILWIGNISF--------IENEEGNAQVGDTSVT 323

Query: 368 ---CELLGIDPFNFAKWIVKKQIVT-----RSEKIVTNLNYNQALIARDSVAKFIYSTLF 419
                LL +D     K +V++ + T     R       LN  QA   RD++AK IY+ LF
Sbjct: 324 DFVAYLLQVDASLLVKCLVERIMQTSHGMKRGSVYHVPLNPVQATAVRDALAKAIYNNLF 383

Query: 420 DWLVDNINKTLYD-PELDQQDHVFSFIGILDIYGFEHFEKNSFEQFCINYANEKLQQEFN 478
           DW+VD +N +L   P  D+       IGILDIYGFE FE NSFEQ CINY NEKLQQ F 
Sbjct: 384 DWIVDRVNVSLQAFPGADKS------IGILDIYGFEIFEHNSFEQICINYVNEKLQQIFI 437

Query: 479 QHVFKLEQEEYVKEEIEWSFIEFSDNQPCIDLIE--NKLGILSLLDEESRLP----SGSD 532
           Q   K EQE Y +E+I+W+ I++ DN+   DLIE  N  GIL+ +++         + +D
Sbjct: 438 QLTLKAEQETYEREKIKWTPIKYFDNKVVCDLIEAKNPPGILAAMNDSIATAHADSNAAD 497

Query: 533 ESWASKLYSAFNKPPSNEVFSKPRFGQTKFIVSHYAVDVEYEVEGFIEKNRDSVSLGHLD 592
           +++A +L + FN  P  E+ +       KF++ HYA DV Y++ G  +KN+D +    ++
Sbjct: 498 QAFAQRL-NLFNSNPYFELRA------NKFVIKHYAGDVTYDINGITDKNKDQLQKDLIE 550

Query: 593 VFKATTNPIFKQILDNRELRSDDAPEEQNTEKKIMIPARLSQKKPTLGSMFKKSLGELMA 652
           +   TTN     I           P++ + + K        ++ PT G    KS  EL+ 
Sbjct: 551 LIGTTTNTFLSTIF----------PDDVDKDSK--------RRPPTAGDKIIKSANELVE 592

Query: 653 IINSTNVHYIRCIKPNSEKKPWEFDNLMVLSQLRACGVLETIRISCAGFPSRWTFDEFVQ 712
            ++     YIR IKPN  K P ++D+  VL Q++  G+ E +RI  AGF  R TF++FV+
Sbjct: 593 TLSKAEPSYIRTIKPNQTKSPNDYDDHQVLHQVKYLGLQENVRIRRAGFAYRQTFEKFVE 652

Query: 713 RYFLLTDYSLWSGILYNPDLPKEAIVNFCQSILDATISDSAKYQIGNTKIFFKAGMLAF- 771
           R++LL+    ++G  Y  D      V     + DA I +  ++Q+G T +F K     F 
Sbjct: 653 RFYLLSPDCSYAGD-YTWDGDTLEAVKLI--LRDAMIPEK-EFQLGVTSVFIKTPESLFA 708

Query: 772 LEKLRTNKMNEICIIIQKKIRARYYRLQYLQ-TMESIKKCQSQIR 815
           LE +R      +   IQ+  R      ++LQ  +++  K Q  IR
Sbjct: 709 LEDMRDKYWYNMAARIQRAWR------RFLQRRIDAAIKIQRTIR 747

>CAGL0K07590g 748352..752110 highly similar to sp|P36006
           Saccharomyces cerevisiae YKL129c or sp|Q04439
           Saccharomyces cerevisiae YMR109w myosin like proteins,
           start by similarity
          Length = 1252

 Score =  418 bits (1074), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 272/757 (35%), Positives = 411/757 (54%), Gaps = 64/757 (8%)

Query: 75  DLTTLSYLNEPAVLHAIKKRYMNGQIYTYSGIVLIAANPFDKVDHLYSREMIQNYSSKRK 134
           DLT LS +++ ++   +KKR+ +G IYTY G VLI+ NPF  +  +Y+ + +++Y  K +
Sbjct: 40  DLTLLSKISDESINDNLKKRFEHGIIYTYIGYVLISVNPFRDLG-IYTDDTMKSYQGKNR 98

Query: 135 DELEPHLFAIAEEAYRFMVHEKANQTVVVSGESGAGKTVSAKYIMRYFASVQESNNREGE 194
            E  PH+FAIAE  Y  +     NQ V++SGESGAGKT +AK IM+Y A+   +++    
Sbjct: 99  LEAPPHVFAIAENMYYNLKSYNENQCVIISGESGAGKTEAAKRIMQYIAATSSTHSES-- 156

Query: 195 VEMSQIESQILATNPIMEAFGNAKTTRNDNSSRFGKYLQILFDENTTIRGSKIRTYLLEK 254
             +S+I+  +LATNP++E+FG AKT RN+NSSR GKYL+I FD +       I  YLLEK
Sbjct: 157 --ISKIKDMVLATNPLLESFGCAKTLRNNNSSRHGKYLEIKFDAHFQPCAGHITNYLLEK 214

Query: 255 SRLVYQPETERNYHIFYQILEGLPEPVKQELHLSSPKDYHYTNQGGQPNIAGIDEAREYK 314
            R+V Q + ERN+HIFYQ  +G PE  +Q   +  P+ Y YT+      +  +D+  E+ 
Sbjct: 215 QRVVGQIKNERNFHIFYQFTKGAPEEYRQLFGVQQPEQYIYTSASQCTAVENMDDVEEFN 274

Query: 315 ITTDALSLVGINHETQLGIFKILAGLLHIGNIEMKMTRNDASLSSEEQNLQIACELLGID 374
            T +A+  +G+    Q  IF+ LA +L IGNI         +   ++        LL + 
Sbjct: 275 ETLNAMRTIGLTKSEQDQIFRALAAILWIGNISFVENEAGNAEIRDKSVTTFVAYLLEVQ 334

Query: 375 PFNFAKWIVKKQIVT-----RSEKIVTNLNYNQALIARDSVAKFIYSTLFDWLVDNINKT 429
                K ++++ I T     R     + LN  QA   RD++AK IY+ LF+W+V+ +N +
Sbjct: 335 EELLIKALIERIIETTHGAKRGSTYHSPLNIIQATAVRDALAKAIYNNLFEWIVERVNNS 394

Query: 430 LYD-PELDQQDHVFSFIGILDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHVFKLEQEE 488
           L   P  D+       IGILDIYGFE FE NSFEQ CINY NEKLQQ F Q   K EQ+ 
Sbjct: 395 LQAFPGADKS------IGILDIYGFEIFEHNSFEQICINYVNEKLQQIFIQLTLKSEQDT 448

Query: 489 YVKEEIEWSFIEFSDNQPCIDLIENKL--GILSLLDEESRLP----SGSDESWASKLYSA 542
           Y KE+I W+ IE+ DN+   DLIE K   GI + +++           +D+++A +L   
Sbjct: 449 YKKEQIHWTPIEYFDNKIVCDLIEAKRPPGIFAAMNDAIATAHADSDAADQAFAQRL--- 505

Query: 543 FNKPPSNEVFSKPRF--GQTKFIVSHYAVDVEYEVEGFIEKNRDSVSLGHLDVFKATTNP 600
                 N   + P F   Q KF+V HYA DV Y++ G  +KN+D +    +++   T+N 
Sbjct: 506 ------NLFTTNPHFELRQNKFVVKHYAGDVTYDIFGITDKNKDQLQKDLVELLSTTSNS 559

Query: 601 IFKQILDNRELRSDDAPEEQNTEKKIMIPARLSQKKPTLGSMFKKSLGELMAIINSTNVH 660
             ++I           P++  T+ +        ++ PT G    KS  EL+  ++     
Sbjct: 560 FVREIF----------PDQPQTDSR--------RRPPTSGDKIIKSANELVETLSKAQPS 601

Query: 661 YIRCIKPNSEKKPWEFDNLMVLSQLRACGVLETIRISCAGFPSRWTFDEFVQRYFLLTDY 720
           YIR IKPN  K    +D+  VL Q++  G+ E +RI  AGF  R  F++FV+R++LL+  
Sbjct: 602 YIRTIKPNDTKSSTIYDDQRVLHQIKYLGLKENVRIRRAGFAHRQVFEKFVERFYLLSPQ 661

Query: 721 SLWSGILYNPDLPKEAIVNFCQSILDATISDSAKYQIGNTKIFFKAGMLAF-LEKLRTNK 779
             ++G         +A+    Q   DA+I  + +Y+IG T+IF K     F LE +R   
Sbjct: 662 CSYAGDYVWDGETLDAVKLILQ---DASIP-TTEYEIGVTQIFIKHPETLFALENMRDKY 717

Query: 780 MNEICIIIQKKIRARYYRLQYLQT-MESIKKCQSQIR 815
              +   IQ+  R      +YLQ  +++  + Q+ IR
Sbjct: 718 WYNMAARIQRAWR------RYLQKRIDAAIRIQNAIR 748

>AEL306C [2199] [Homologous to ScYMR109W (MYO5) - SH; ScYKL129C
           (MYO3) - SH] (65141..69019) [3879 bp, 1292 aa]
          Length = 1292

 Score =  412 bits (1060), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 275/772 (35%), Positives = 423/772 (54%), Gaps = 90/772 (11%)

Query: 75  DLTTLSYLNEPAVLHAIKKRYMNGQIYTYSGIVLIAANPFDKVDHLYSREMIQNYSSKRK 134
           DLT LS +++  +   +K+R+ NG IYTY G VLI+ NPF  +  +Y+ ++++ Y  + +
Sbjct: 39  DLTLLSKISDEHINENLKRRFENGSIYTYIGHVLISVNPFRDLG-IYTDQVLETYKGRNR 97

Query: 135 DELEPHLFAIAEEAYRFMVHEKANQTVVVSGESGAGKTVSAKYIMRYFASVQESNNREGE 194
            E+ PH+FAIAE  Y  +     NQ V++SGESGAGKT +AK IM+Y A+   S+    E
Sbjct: 98  LEVPPHVFAIAEAMYYNLKAYNENQCVIISGESGAGKTEAAKRIMQYIAAASSSH----E 153

Query: 195 VEMSQIESQILATNPIMEAFGNAKTTRNDNSSRFGKYLQILFDENTTIRGSKIRTYLLEK 254
             + +I+  +LATNP++E+FG AKT RN+NSSR GKYL+I F+        +I  YLLEK
Sbjct: 154 ASIGRIKDMVLATNPLLESFGCAKTLRNNNSSRHGKYLEIRFNAQFEPCAGQITNYLLEK 213

Query: 255 SRLVYQPETERNYHIFYQILEGLPEPVKQELHLSSPKDYHYTNQGGQPNIAGIDEAREYK 314
            R+V Q + ERN+HIFYQ  +G  +  ++   +  P+ Y YT+  G  ++  ID+  +Y+
Sbjct: 214 QRVVGQIKNERNFHIFYQFSKGASDRYRKTYGVQLPEQYVYTSASGCTSVDTIDDLNDYE 273

Query: 315 ITTDALSLVGINHETQLGIFKILAGLLHIGNIEMKMTRNDASLSSEEQNLQIA------- 367
            T +A++++G++   Q  IF++L+ +L IGN+          +  +E N +IA       
Sbjct: 274 ATLEAMNVIGLSQAEQDEIFRLLSAILWIGNVTF--------MEDDEGNAKIADTSITDF 325

Query: 368 -CELLGIDPFNFAKWIVKKQIVT-----RSEKIVTNLNYNQALIARDSVAKFIYSTLFDW 421
              LL +D     K +V++ I T     R       LN  QA   RD++AK IY+ LF+W
Sbjct: 326 VAYLLQVDAGLLVKSLVERTIETTHGMRRGSIYNVPLNIVQATAVRDALAKAIYNNLFEW 385

Query: 422 LVDNINKTLYD-PELDQQDHVFSFIGILDIYGFEHFEKNSFEQFCINYANEKLQQEFNQH 480
           +VD +N +L   P  ++       IGILDIYGFE FE NSFEQ CINY NEKLQQ F Q 
Sbjct: 386 IVDRVNVSLQALPGAEKS------IGILDIYGFEIFEHNSFEQICINYVNEKLQQIFIQL 439

Query: 481 VFKLEQEEYVKEEIEWSFIEFSDNQPCIDLIENKL--GILSLLDEESRLP----SGSDES 534
             K EQEEY KE+I+W+ I++ DN+   +LIE K   GI + L++         + +D++
Sbjct: 440 TLKSEQEEYAKEQIQWTPIKYFDNKVVCELIEAKRPPGIFAALNDSVATAHADSNAADQA 499

Query: 535 WASKLYSAFNKPPSNEVFSKPRFGQTKFIVSHYAVDVEYEVEGFIEKNRDSVSLGHLDVF 594
           +A +L + F   P  E+ S      +KF++ HYA DV Y++ G  +KN+D +    +++ 
Sbjct: 500 FAQRL-NLFTSNPHFELRS------SKFVIKHYAGDVTYDIGGMTDKNKDQLQRDLVELL 552

Query: 595 KATTNPIFKQILDNRELRSDDAPEEQNTEKKIMIPARLSQKKPTLGSMFKKSLGELMAII 654
            +T+N     I           P+  + + K  IP+       T G    +S  EL+  +
Sbjct: 553 NSTSNTFLATIF----------PDTGDKDSK-RIPS-------TAGDKIIRSANELVDTL 594

Query: 655 NSTNVHYIRCIKPNSEKKPWEFDNLMVLSQLRACGVLETIRISCAGFPSRWTFDEFVQRY 714
           +     YIR IKPN  K P ++D+  VL Q++  G+ E +RI  A +  R  FD+FV+R+
Sbjct: 595 SKAQPSYIRTIKPNQTKSPLDYDDRQVLHQVKYLGLQENVRIRRACYAYRHIFDKFVERF 654

Query: 715 FLLT-------DYSLWSGILYNPDLPKEAIVNFCQSILDATISDSAKYQIGNTKIFFKAG 767
           +LL+       DY+ W G            ++    IL  T     +YQ+G TK+F K  
Sbjct: 655 YLLSPQCSYAGDYT-WQG----------NTLDAVNLILRDTSIPVTEYQLGVTKVFIKTP 703

Query: 768 MLAF-LEKLRTNKMNEICIIIQKKIRARYYRLQYLQ-TMESIKKCQSQIRSL 817
              F LE +R    + +   IQ+  R      ++LQ  ++S  + Q  IR +
Sbjct: 704 ETLFALENMRDKYWHNMASRIQRAWR------RFLQRRIDSAIRIQRAIREM 749

>Scas_584.6*
          Length = 1049

 Score = 31.6 bits (70), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 20/88 (22%), Positives = 41/88 (46%), Gaps = 18/88 (20%)

Query: 96  MNGQIYTYSGIVLIAANPFDKVDHLYSREMIQNYSSKRKDELEPHLFAIAEEA--YRFMV 153
           + G++Y  + + L+    F  ++H+ S+E +  Y  K+    EP +F++ +E   YRF +
Sbjct: 136 LKGKLYVLTELYLVGV--FTSLEHIESKEALPFYLQKKIHRREPIIFSVLKEILNYRFKL 193

Query: 154 HEKANQTVVVSGESGAGKTVSAKYIMRY 181
                         G   T++  ++ RY
Sbjct: 194 --------------GYTTTLATSFVKRY 207

>Kwal_56.22505
          Length = 403

 Score = 31.2 bits (69), Expect = 6.1,   Method: Composition-based stats.
 Identities = 18/50 (36%), Positives = 28/50 (56%), Gaps = 2/50 (4%)

Query: 900 KRSSILVQSAMRMQLAR--RRYIVLQKEVEERNIRASYGIGLLEEAIEFK 947
           +R SI + S  R +++R  R   + QKE EER ++    +GL +E  E K
Sbjct: 256 RRRSIKLNSGRRSEVSRALRDLAIQQKEQEERRVKRRISMGLEKETAEAK 305

>YOL031C (SIL1) [4785] chr15 complement(266264..267529) Protein
            involved in protein translocation into endoplasmic
            reticulum, associated with Kar2p and Sec63p [1266 bp, 421
            aa]
          Length = 421

 Score = 31.2 bits (69), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 32/62 (51%), Gaps = 1/62 (1%)

Query: 1264 LFKNSGDEKFAKLFTFLNEFDAVLCKFQVVDSMHTKIFNDTLKYLNVMLFNDLITKCPAL 1323
            LFK + +   + L  + NEF   + + + +D +HT+ F DTL  L  +  +D+      L
Sbjct: 308  LFKRNAENWSSNLQEWANEFQE-MVQNKSIDELHTRTFFDTLYNLKKIFKSDITINKGFL 366

Query: 1324 NW 1325
            NW
Sbjct: 367  NW 368

>CAGL0I06380g complement(615944..619534) tr|Q9C1F3 Candida glabrata
            Mitochondrial RNase P, identified start
          Length = 1196

 Score = 31.2 bits (69), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 28/45 (62%)

Query: 1126 VNVTEVNGDNVLGPIHVITTVVSSLVRNGLLIQSSKFISKVLLTV 1170
             ++ ++N   V G  ++I  +  SL RNG+ IQ  + ++KVL+++
Sbjct: 192  THIDQINKHFVKGNYNIINALYKSLKRNGIAIQDREVLTKVLISL 236

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.135    0.386 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 47,747,183
Number of extensions: 2204388
Number of successful extensions: 7331
Number of sequences better than 10.0: 52
Number of HSP's gapped: 7398
Number of HSP's successfully gapped: 56
Length of query: 1445
Length of database: 16,596,109
Length adjustment: 114
Effective length of query: 1331
Effective length of database: 12,649,657
Effective search space: 16836693467
Effective search space used: 16836693467
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)