Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YAL028W52851920660.0
Scas_592.145491453282e-32
CAGL0G06314g6531473063e-29
Scas_663.275591522235e-19
YOR324C6021521952e-15
Sklu_2164.44651421602e-11
KLLA0A03938g4201421254e-07
Kwal_26.70633781281051e-04
YGR140W (CBF2)95683840.046
Scas_720.94168392721.2
KLLA0E11231g1148140683.2
CAGL0G01760g85549665.8
Scas_599.13107131658.3
Scas_716.77608104649.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YAL028W
         (519 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YAL028W (YAL028W) [40] chr1 (92903..94489) Protein of unknown fu...   800   0.0  
Scas_592.14                                                           130   2e-32
CAGL0G06314g complement(603668..605629) some similarities with s...   122   3e-29
Scas_663.27                                                            91   5e-19
YOR324C (YOR324C) [5106] chr15 complement(923227..925035) Protei...    80   2e-15
Sklu_2164.4 YAL028W, Contig c2164 3696-5093 reverse complement         66   2e-11
KLLA0A03938g 351240..352502 some similarities with sp|P39734 Sac...    53   4e-07
Kwal_26.7063                                                           45   1e-04
YGR140W (CBF2) [2095] chr7 (767432..770302) Component (subunit a...    37   0.046
Scas_720.94                                                            32   1.2  
KLLA0E11231g 988846..992292 similar to sp|P38426 Saccharomyces c...    31   3.2  
CAGL0G01760g 158546..161113 similar to sp|Q06096 Saccharomyces c...    30   5.8  
Scas_599.13                                                            30   8.3  
Scas_716.77                                                            29   9.4  

>YAL028W (YAL028W) [40] chr1 (92903..94489) Protein of unknown
           function [1587 bp, 528 aa]
          Length = 528

 Score =  800 bits (2066), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/519 (79%), Positives = 413/519 (79%)

Query: 1   MQNAQXXXXXXXXXXDGTDRNSKDGVEKRPLEDVKQMIDAGTPDVGHKSTVETKPNVGWQ 60
           MQNAQ          DGTDRNSKDGVEKRPLEDVKQMIDAGTPDVGHKSTVETKPNVGWQ
Sbjct: 1   MQNAQIKSSSKGSGIDGTDRNSKDGVEKRPLEDVKQMIDAGTPDVGHKSTVETKPNVGWQ 60

Query: 61  ASHSNLAALHEKEQKYEMEHHHARHKLHRQVIPDYTSASTAMFSDCMFNAAPDKVRSLST 120
           ASHSNLAALHEKEQKYEMEHHHARHKLHRQVIPDYTSASTAMFSDCMFNAAPDKVRSLST
Sbjct: 61  ASHSNLAALHEKEQKYEMEHHHARHKLHRQVIPDYTSASTAMFSDCMFNAAPDKVRSLST 120

Query: 121 MKSSGLSPKHPFNVVATFKGPFPQHSVESKPLDGGYSAKDHFPSFKMLQAQQHPAHRHYK 180
           MKSSGLSPKHPFNVVATFKGPFPQHSVESKPLDGGYSAKDHFPSFKMLQAQQHPAHRHYK
Sbjct: 121 MKSSGLSPKHPFNVVATFKGPFPQHSVESKPLDGGYSAKDHFPSFKMLQAQQHPAHRHYK 180

Query: 181 DNDKYGLKSPSRSFVKDKKRLVHRFLKSMEPSSSGQSKDSSALAPAFDPILPNVISKPSK 240
           DNDKYGLKSPSRSFVKDKKRLVHRFLKSMEPSSSGQSKDSSALAPAFDPILPNVISKPSK
Sbjct: 181 DNDKYGLKSPSRSFVKDKKRLVHRFLKSMEPSSSGQSKDSSALAPAFDPILPNVISKPSK 240

Query: 241 RPXXXXXXXXXXXXXXXXXXLQSLLYHDLESSPKKHXXXXXXXXXXXXXXXXXXXXIGLS 300
           RP                  LQSLLYHDLESSPKKH                    IGLS
Sbjct: 241 RPTHHSHSSDGSSSTQTDISLQSLLYHDLESSPKKHVSPSRPPSVASESSPAVANPIGLS 300

Query: 301 PKDACNAXXXXXXXXXXXXXXXXXXXXXXXXXVAVDPLEPPGNITYXXXXXXXXXDELDY 360
           PKDACNA                         VAVDPLEPPGNITY         DELDY
Sbjct: 301 PKDACNASFSQSSSSSLSSSSSSSSSTSFSQSVAVDPLEPPGNITYSSSNLSLNSDELDY 360

Query: 361 YQRHIGLQLQQTEALLKHSLKDEVLKDENDLVKNIANFDKIVKELRDLRSRTIGWKELVE 420
           YQRHIGLQLQQTEALLKHSLKDEVLKDENDLVKNIANFDKIVKELRDLRSRTIGWKELVE
Sbjct: 361 YQRHIGLQLQQTEALLKHSLKDEVLKDENDLVKNIANFDKIVKELRDLRSRTIGWKELVE 420

Query: 421 EDYLMNLKQDFDKENPESFEARLSDTINTNVAKLQDLEKRMASCKDRLASRKEVMRKXXX 480
           EDYLMNLKQDFDKENPESFEARLSDTINTNVAKLQDLEKRMASCKDRLASRKEVMRK   
Sbjct: 421 EDYLMNLKQDFDKENPESFEARLSDTINTNVAKLQDLEKRMASCKDRLASRKEVMRKMES 480

Query: 481 XXXXXXXXXXXKKNVTFASKYRNEALDXXXXXXXXXXCY 519
                      KKNVTFASKYRNEALD          CY
Sbjct: 481 LLSLENSLMISKKNVTFASKYRNEALDIVFLIIIIVICY 519

>Scas_592.14
          Length = 549

 Score =  130 bits (328), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 64/145 (44%), Positives = 96/145 (66%)

Query: 356 DELDYYQRHIGLQLQQTEALLKHSLKDEVLKDENDLVKNIANFDKIVKELRDLRSRTIGW 415
           +E+DYYQRHI ++L+++EAL+K +L+D +LK ENDL  N+ NFD  + +L+ L+ + I  
Sbjct: 378 NEIDYYQRHIAIRLKKSEALMKENLRDIILKRENDLHNNLQNFDTYLHDLKKLKYQIISL 437

Query: 416 KELVEEDYLMNLKQDFDKENPESFEARLSDTINTNVAKLQDLEKRMASCKDRLASRKEVM 475
           ++LV  DYL+ LK+DFD  N  SFE  L++ +N NV KLQDLE+RM S  +RL  +KE M
Sbjct: 438 QKLVRNDYLVILKEDFDVNNKNSFENHLTEILNKNVTKLQDLERRMESSGERLNEQKETM 497

Query: 476 RKXXXXXXXXXXXXXXKKNVTFASK 500
           ++              +KN ++ SK
Sbjct: 498 KRMENLINLENSLKLSQKNASWVSK 522

 Score = 49.7 bits (117), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 63/231 (27%), Positives = 88/231 (38%), Gaps = 44/231 (19%)

Query: 51  VETKPNVGWQASHSNLAALHEKEQKYEMEHHHARHKLHRQVIPDYTSASTAMFSDCMFNA 110
           +E +P +  Q S  NL AL  K       + H      R   PDYTSA+T MFSD +FN 
Sbjct: 92  IEDQPKLVRQQSQPNLVALGAKA------NGHRESATLRSGKPDYTSANTGMFSDHIFNE 145

Query: 111 APDKVRSLSTMKSSGLSPKH---PFNVVATFK----GPFPQHSVESKPLDGGYSAKDHFP 163
           +           + GL P+    PF    T       PF Q   E         A+    
Sbjct: 146 S----------TADGLIPRQNELPFMDTNTDNPVKLTPFAQAQNE---------AERSGR 186

Query: 164 SFKMLQAQQHPAHRHYKDNDKYGLKSPSRSFVKDKKRLVHRFLKSMEPSSSGQSKDSSAL 223
             +   +      R          ++ + + V DKKRLV++FL+S+E  S+ Q +   +L
Sbjct: 187 HHRRHHSGSSELSRRS--------RASTLTNVTDKKRLVNQFLESVEAPSTLQLRFPDSL 238

Query: 224 APAFDPILPNVISKPSKRPXXXXXXXXXXXXXXXXXXLQSLLYHDLESSPK 274
           A       P  +   S                      QSLLYHDLE+  K
Sbjct: 239 AAKR----PKQMYNTSNFSSTGHSTRSSDTHMTTANSFQSLLYHDLENPSK 285

>CAGL0G06314g complement(603668..605629) some similarities with
           sp|P39734 Saccharomyces cerevisiae YAL028w, hypothetical
           start
          Length = 653

 Score =  122 bits (306), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 61/147 (41%), Positives = 90/147 (61%)

Query: 356 DELDYYQRHIGLQLQQTEALLKHSLKDEVLKDENDLVKNIANFDKIVKELRDLRSRTIGW 415
           +E DYYQ+HI  +L + E+ +K+ LK  +LKDE +L  NI +FD +  +L++L+S+ +G 
Sbjct: 481 NETDYYQQHINSRLTKLESQIKNDLKSVILKDELELKNNITSFDNLTSDLQNLKSQILGL 540

Query: 416 KELVEEDYLMNLKQDFDKENPESFEARLSDTINTNVAKLQDLEKRMASCKDRLASRKEVM 475
           K  +  +YL  LK DFD+ NPESFE++L  T+  NV  L+ LE +M+ C+ +L  +KE M
Sbjct: 541 KNTIANEYLTVLKADFDENNPESFESQLRKTVEENVKHLEFLENKMSECQSQLVDQKETM 600

Query: 476 RKXXXXXXXXXXXXXXKKNVTFASKYR 502
           RK              KKN   A KYR
Sbjct: 601 RKMESLLYLENSLMVSKKNTGLAYKYR 627

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 65/229 (28%), Positives = 100/229 (43%), Gaps = 46/229 (20%)

Query: 28  KRPLEDVKQMIDAGT-----PDVGHKSTVETKPNVGWQASHSNLAALHEKEQKYEMEHHH 82
           +R + D K+   AG+     P +G+     +KP +  Q + SNLAAL + + +       
Sbjct: 148 QRSVSDPKRSFKAGSNTDIEPKLGN-----SKPMIIRQVTASNLAALADGKNRLV----- 197

Query: 83  ARHKLHRQVIPDYTSASTAMFSDCMFNAAPDKVRSLSTMKSSGLSPKHP----------- 131
            +  L R  IPDYTS +T  FS+CMFN   +K  + +  K++      P           
Sbjct: 198 EKKMLKRPTIPDYTSVNTGAFSECMFNTELEKQYNNNLSKTTKTEKPTPNRLGDQQEEVG 257

Query: 132 -------FNVVATFKGPFPQHSVESKP-LDGGYSAKDHFPSFKMLQAQQHPAHRHYKDND 183
                  F      K P      E +P L  G +   +    +    ++H  HRH     
Sbjct: 258 NGGQATLFTADKFIKSPVKSLDNEERPELSNGQNQSKNQNQTQF--HKEHKKHRHQ---- 311

Query: 184 KYGLKSPSRSF-VKDKKRLVHRFLKSMEPSSSGQSKDSSALAPAFDPIL 231
               KS S+S+   D+KRLV++FL+S+E S +  S  SS  A A+   L
Sbjct: 312 ----KSFSQSYGSNDQKRLVNQFLQSIEKSGN-NSALSSNNASAYGSTL 355

>Scas_663.27
          Length = 559

 Score = 90.5 bits (223), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 83/152 (54%)

Query: 356 DELDYYQRHIGLQLQQTEALLKHSLKDEVLKDENDLVKNIANFDKIVKELRDLRSRTIGW 415
           +EL+YYQ HI   L + E LLK +L+  V+KDE DL   ++ FD +   L+++++R    
Sbjct: 386 NELNYYQTHICNTLAEFERLLKQNLQTFVIKDEADLHGTLSKFDNLTFHLQNMKNRIDEL 445

Query: 416 KELVEEDYLMNLKQDFDKENPESFEARLSDTINTNVAKLQDLEKRMASCKDRLASRKEVM 475
            +++ E YL  +K  F++++  SFE  L  ++  ++ +L++LE RM  C+ +L  ++E M
Sbjct: 446 YDVINEKYLSKIKTAFNEDDESSFEFELRTSVEASIKQLEELENRMEYCQLKLQEQRETM 505

Query: 476 RKXXXXXXXXXXXXXXKKNVTFASKYRNEALD 507
           R+              KKNV     YR    D
Sbjct: 506 RQLDNLILIENSLLESKKNVKHIYSYRFLVFD 537

 Score = 42.7 bits (99), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 45/167 (26%), Positives = 74/167 (44%), Gaps = 29/167 (17%)

Query: 51  VETKPNVGWQASHSNLAALHEKEQKYEMEHHHARHKLHRQVIPDYTSASTAMFSDCMFNA 110
           +E++P+    AS+   +  H  E+    +    R  L  Q +PDY++AS   FSDC+FN 
Sbjct: 77  LESEPSRIGLASY--FSQRHNSEEGLSFKTSSRRKHLESQPLPDYSAASLGTFSDCIFND 134

Query: 111 APDKVRSLSTMKSSGL--------SPKHPFNVVATFKGPFPQHSVE---SKPLDGGYSAK 159
           A  K  +L+  K + L        S +      +    P+ + +     S PL  G+S  
Sbjct: 135 ALSKEPTLTNAKGNYLDGGEKCLRSRRQSSIYSSRNTSPYKRRTSSFGASGPL--GFSQV 192

Query: 160 DHFPSFKMLQAQQHPAHRHYKDNDKYGLKSPSRSFVKDKKRLVHRFL 206
            +  S K L+ ++  ++ H            S +   DKKRLV+ FL
Sbjct: 193 QN--SGKQLKNKRSNSNNH------------STNLASDKKRLVNEFL 225

>YOR324C (YOR324C) [5106] chr15 complement(923227..925035) Protein
           of the endoplasmic reticulum membrane [1809 bp, 602 aa]
          Length = 602

 Score = 79.7 bits (195), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 48/152 (31%), Positives = 79/152 (51%)

Query: 356 DELDYYQRHIGLQLQQTEALLKHSLKDEVLKDENDLVKNIANFDKIVKELRDLRSRTIGW 415
           DEL+YYQ HI   L + E  ++ +L D ++K+EN++ K I  +D +  EL  L       
Sbjct: 427 DELNYYQNHISTLLVKIENEMRRNLNDTIIKNENNVQKTIQKYDLLSGELTLLLDEMTTL 486

Query: 416 KELVEEDYLMNLKQDFDKENPESFEARLSDTINTNVAKLQDLEKRMASCKDRLASRKEVM 475
           +  V   +L+ LK DFD+++ ++F   L  ++  +VA+LQ LE+RM  C++RL  +K  +
Sbjct: 487 RTTVINQFLVKLKSDFDEDDNKAFINELKISVEESVAQLQGLERRMEVCQERLNKQKSSL 546

Query: 476 RKXXXXXXXXXXXXXXKKNVTFASKYRNEALD 507
           R+              K N      YR   +D
Sbjct: 547 REMDSLIELKNVLNKSKNNTKSIYLYRYFIID 578

>Sklu_2164.4 YAL028W, Contig c2164 3696-5093 reverse complement
          Length = 465

 Score = 66.2 bits (160), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 37/142 (26%), Positives = 76/142 (53%)

Query: 361 YQRHIGLQLQQTEALLKHSLKDEVLKDENDLVKNIANFDKIVKELRDLRSRTIGWKELVE 420
           Y+ +I  ++ + E+++K+++ D +   E  +  +      + KELR +R+R +     V+
Sbjct: 295 YKEYIVNEIDKFESIIKNTVTDVLCMKEKYMEHSFQTLSTLEKELRRIRTRIVELHYEVK 354

Query: 421 EDYLMNLKQDFDKENPESFEARLSDTINTNVAKLQDLEKRMASCKDRLASRKEVMRKXXX 480
           E+YL+ L+  F+  + ESF ++L + I  +++ L+ LE R+ + KD LA +K  +     
Sbjct: 355 ENYLVELETHFNATDSESFISQLDEIIQEHLSSLEKLEVRIKNSKDVLARQKNALEDMES 414

Query: 481 XXXXXXXXXXXKKNVTFASKYR 502
                      KKN+TF+ + +
Sbjct: 415 IVKLKQLVADSKKNMTFSDRLK 436

 Score = 34.3 bits (77), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 13/16 (81%), Positives = 14/16 (87%)

Query: 93  PDYTSASTAMFSDCMF 108
           PDYTSAST  FSDC+F
Sbjct: 73  PDYTSASTGKFSDCIF 88

>KLLA0A03938g 351240..352502 some similarities with sp|P39734
           Saccharomyces cerevisiae YAL028w, hypothetical start
          Length = 420

 Score = 52.8 bits (125), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 37/142 (26%), Positives = 66/142 (46%)

Query: 361 YQRHIGLQLQQTEALLKHSLKDEVLKDENDLVKNIANFDKIVKELRDLRSRTIGWKELVE 420
           Y +HI   L   E  LKH L   +L  E D  +NI +   + K +  L       K   +
Sbjct: 249 YIKHIHRDLTALEFRLKHFLMKVILPQEMDFTQNINHVSNLSKSVTQLHMDIEKIKHDTK 308

Query: 421 EDYLMNLKQDFDKENPESFEARLSDTINTNVAKLQDLEKRMASCKDRLASRKEVMRKXXX 480
           + YL  L   F+  + ESF ++L+  ++++V++LQ LE +    ++ L ++K  +RK   
Sbjct: 309 DIYLEKLAAAFNGSDSESFVSKLTTLMDSHVSRLQALEGKTVDFQNELEAKKLQLRKLEN 368

Query: 481 XXXXXXXXXXXKKNVTFASKYR 502
                      K+N+  + K +
Sbjct: 369 LIKLNDMIGDFKRNMKLSEKLK 390

>Kwal_26.7063
          Length = 378

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/128 (22%), Positives = 55/128 (42%), Gaps = 3/128 (2%)

Query: 378 HSLKD---EVLKDENDLVKNIANFDKIVKELRDLRSRTIGWKELVEEDYLMNLKQDFDKE 434
           H ++D    +  DE+ + K     D + + +R+ +S        +++  +  L++ F+ E
Sbjct: 220 HYIRDLMASISSDESRITKTRTELDDLQQHIREAKSVIKDIDRCIQDQDIKMLRKSFESE 279

Query: 435 NPESFEARLSDTINTNVAKLQDLEKRMASCKDRLASRKEVMRKXXXXXXXXXXXXXXKKN 494
           +  SF +R S  I T    L   EKR+  CK  L ++K  + K              + N
Sbjct: 280 DESSFISRFSAAIATYSESLASFEKRIGKCKVDLTTQKATVHKLETTIKLNEMIQDSQSN 339

Query: 495 VTFASKYR 502
           + F  + R
Sbjct: 340 MCFLDRIR 347

 Score = 30.4 bits (67), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 20/32 (62%), Gaps = 2/32 (6%)

Query: 82  HARHKLHRQVIP--DYTSASTAMFSDCMFNAA 111
           H+R ++ R  +   DYTSAS   FS+C+F + 
Sbjct: 38  HSRCEVERNAMTQHDYTSASAGKFSECLFRSC 69

>YGR140W (CBF2) [2095] chr7 (767432..770302) Component (subunit a)
           of Cbf3 kinetochore complex, also has a role in
           activating the mitotic checkpoint [2871 bp, 956 aa]
          Length = 956

 Score = 37.0 bits (84), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 38/83 (45%), Gaps = 10/83 (12%)

Query: 129 KHPFNV--VATFKGPFPQHSVESKPLDGGYSAKDHFPSFKMLQAQQHPAHRHYKDNDKYG 186
           K PF+   +  FK P+  +S  +K        KD FP  K L  Q  P    YK +D  G
Sbjct: 398 KIPFDFKKIMNFKSPYTSYSTNAK--------KDPFPPPKDLLVQIFPEIDEYKRHDYEG 449

Query: 187 LKSPSRSFVKDKKRLVHRFLKSM 209
           L   SR F+   + L  RFL ++
Sbjct: 450 LSQNSRDFLDLMEVLRERFLSNL 472

>Scas_720.94
          Length = 1683

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 43/92 (46%), Gaps = 6/92 (6%)

Query: 389  NDLVKNIANFDKIVKELRDLRSRTIGWKELVEEDYLMNLKQDFDKENPESFEARLSDTIN 448
            N L  N+ANF+K    +  +   ++GW   + ED     ++ F    P + E  +  T  
Sbjct: 1188 NFLRTNVANFEKKSVIILLMIRLSVGWLSFLVEDCNPTDQRTFRWCVP-AMEFAMQMTSG 1246

Query: 449  TNVAKLQD-----LEKRMASCKDRLASRKEVM 475
             N+  L D     L++R+A+C   L S  +VM
Sbjct: 1247 YNILGLTDSQFRSLKRRIAACMSLLISHFDVM 1278

>KLLA0E11231g 988846..992292 similar to sp|P38426 Saccharomyces
           cerevisiae YMR261c TPS3 alpha, alpha-trehalose-phosphate
           synthase, 115 KD subunit, start by similarity
          Length = 1148

 Score = 30.8 bits (68), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 34/140 (24%), Positives = 56/140 (40%), Gaps = 36/140 (25%)

Query: 357 ELDYYQRHIGLQLQQTEALLKHSLKDEVLKDENDLVK--------NIANFDKIVKELRDL 408
           + D Y RH    +Q    LL     D  LK +  +VK        ++ N D+ +      
Sbjct: 574 QTDEYARHF---MQTATRLLMTDADDHQLKLQGRVVKVNNTPIGVDVFNLDEQIDT---- 626

Query: 409 RSRTIGWKELVEEDY----LMNLKQDFD----------------KENPESFEARLSDTIN 448
             + I W++L+ E +    L+  +  FD                KENPE  +  +   I 
Sbjct: 627 -EQVIQWRKLIRERWSDKRLIVCRDQFDRIRGLKKKMLAYERFLKENPEYVDKVVMIQIC 685

Query: 449 TNVAKLQDLEKRMASCKDRL 468
            + A+  DLE+ + S  DR+
Sbjct: 686 LDTARDIDLERDIMSVVDRI 705

>CAGL0G01760g 158546..161113 similar to sp|Q06096 Saccharomyces
           cerevisiae YPR105c, hypothetical start
          Length = 855

 Score = 30.0 bits (66), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 32/49 (65%), Gaps = 1/49 (2%)

Query: 381 KDEVLKDENDLVKNIANFDKIVKELRDLRSRTIGWKELVEEDYLMNLKQ 429
           +D V  D N L KN+A +D +++ +  + S+    KE++E+D+ ++LK+
Sbjct: 3   QDSVTIDSNQLAKNLARYDLLLRRISTI-SQVHRLKEIIEKDHAVHLKK 50

>Scas_599.13
          Length = 1071

 Score = 29.6 bits (65), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 22/31 (70%), Gaps = 1/31 (3%)

Query: 382  DEVLKDENDLVKNIANFDKIVKELRDLRSRT 412
            D+VL  E DLVK+  +FD IVKE  D+ S+T
Sbjct: 1008 DDVLV-EYDLVKDTIDFDSIVKEHFDMLSKT 1037

>Scas_716.77
          Length = 608

 Score = 29.3 bits (64), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 31/104 (29%), Positives = 43/104 (41%), Gaps = 17/104 (16%)

Query: 111 APDKVRSLSTMKSSGLSPKHPFNVVATFKGPFPQHSVESKPLDGGYSAKDHFPSFKMLQA 170
            P+    + + K++G   K  F   A F    P + V+SK    GY  K+ F    MLQ 
Sbjct: 398 GPNWYYPIFSQKAAGEGDKETFIAGANFYD-LPYYQVKSKVGVDGYHRKEGFRGVAMLQ- 455

Query: 171 QQHPAHRHYKDNDKYGLKS---------PSRSFVKDKKRLVHRF 205
                H   +D ++Y L S         PS S V DK   V +F
Sbjct: 456 -----HDFVQDYNRYKLASADIAREYSNPS-SVVFDKSYTVQKF 493

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.313    0.129    0.373 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 14,120,348
Number of extensions: 579760
Number of successful extensions: 2001
Number of sequences better than 10.0: 48
Number of HSP's gapped: 2022
Number of HSP's successfully gapped: 54
Length of query: 519
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 413
Effective length of database: 12,926,601
Effective search space: 5338686213
Effective search space used: 5338686213
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 64 (29.3 bits)