Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YAL027W26125713510.0
Scas_592.152542645695e-73
CAGL0G06292g2532614331e-52
ADR352C2542673592e-41
Kwal_26.70662042022192e-21
KLLA0A03960g2252232053e-19
Scas_720.5044937643.6
YMR158W (MRPS8)15532598.5
KLLA0F00418g91071619.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YAL027W
         (257 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YAL027W (YAL027W) [41] chr1 (94690..95475) Protein of unknown fu...   525   0.0  
Scas_592.15                                                           223   5e-73
CAGL0G06292g complement(602454..603215) similar to sp|P39735 Sac...   171   1e-52
ADR352C [2093] [Homologous to ScYAL027W - SH] (1326273..1327037)...   142   2e-41
Kwal_26.7066                                                           89   2e-21
KLLA0A03960g 353119..353796 weakly similar to sp|P39735 Saccharo...    84   3e-19
Scas_720.50                                                            29   3.6  
YMR158W (MRPS8) [4113] chr13 (572247..572714) Protein of the mit...    27   8.5  
KLLA0F00418g 26773..29505 some similarities with sp|P32336 Sacch...    28   9.0  

>YAL027W (YAL027W) [41] chr1 (94690..95475) Protein of unknown
           function [786 bp, 261 aa]
          Length = 261

 Score =  525 bits (1351), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 257/257 (100%), Positives = 257/257 (100%)

Query: 1   MAPSIATVKIARDMVLPLRIFVNRKQILQTNDKTSNKSNATIFEAPLLSNNSIICLKSPN 60
           MAPSIATVKIARDMVLPLRIFVNRKQILQTNDKTSNKSNATIFEAPLLSNNSIICLKSPN
Sbjct: 1   MAPSIATVKIARDMVLPLRIFVNRKQILQTNDKTSNKSNATIFEAPLLSNNSIICLKSPN 60

Query: 61  TRIYLSQQDKKNLCDEIKEDLLLIVYELASPEIISSVLSKIRVGHSTDFQINVLPKLFAG 120
           TRIYLSQQDKKNLCDEIKEDLLLIVYELASPEIISSVLSKIRVGHSTDFQINVLPKLFAG
Sbjct: 61  TRIYLSQQDKKNLCDEIKEDLLLIVYELASPEIISSVLSKIRVGHSTDFQINVLPKLFAG 120

Query: 121 ADTDNAVTSHIQSVTRLAKFKYKLHYKHKWELDIFINSIKKIANLRHYLMFQTLTLNGFS 180
           ADTDNAVTSHIQSVTRLAKFKYKLHYKHKWELDIFINSIKKIANLRHYLMFQTLTLNGFS
Sbjct: 121 ADTDNAVTSHIQSVTRLAKFKYKLHYKHKWELDIFINSIKKIANLRHYLMFQTLTLNGFS 180

Query: 181 LNAGPKTLLARKIEKQPQVPNLLIENGDADALDTPVEEDIKPVIEFMYKPVINLGEIIDV 240
           LNAGPKTLLARKIEKQPQVPNLLIENGDADALDTPVEEDIKPVIEFMYKPVINLGEIIDV
Sbjct: 181 LNAGPKTLLARKIEKQPQVPNLLIENGDADALDTPVEEDIKPVIEFMYKPVINLGEIIDV 240

Query: 241 HVLHRPRRHKVRTQSKQ 257
           HVLHRPRRHKVRTQSKQ
Sbjct: 241 HVLHRPRRHKVRTQSKQ 257

>Scas_592.15
          Length = 254

 Score =  223 bits (569), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 123/264 (46%), Positives = 177/264 (67%), Gaps = 23/264 (8%)

Query: 1   MAPSIATVKIARDMVLPLRIFVNRKQILQTNDKTSNKSNATIFEAPLLSNNSIICLKSPN 60
           MA SIATV+I+++ ++ LR+F+NRK++L+ N +         F+APLLSNNSIICLKSP 
Sbjct: 1   MASSIATVRISKNAIVSLRVFINRKKLLRNNSR-----EGQTFQAPLLSNNSIICLKSPL 55

Query: 61  TRIYLSQQDKKNLCDEIKEDLLLIVYELASPEIISSVLSKIRVGHSTDFQINVLPKLF-A 119
            RI +S QD + L +EI++ ++LIVY+L+SPE++ +VL K+R+G S DF+  +LPKL   
Sbjct: 56  VRILISNQDMERLTNEIRDTIILIVYDLSSPEVMETVLGKLRIGSSADFETEILPKLMDE 115

Query: 120 GADTDNAVTSHIQSVTRLAKFKYKLHYKHKWELDIFINSIKKIANLRHYLMF-------- 171
              + + V   +Q+VTR+AKFKYKL +K  WELDIFIN++KK+  +RH+L+F        
Sbjct: 116 NTLSKDLVNVPLQTVTRVAKFKYKLRFKGNWELDIFINNMKKLIKIRHFLLFTDGHMSAA 175

Query: 172 QTLTL--NGFSLNAGPKTLLARKIEKQPQVPNLLIENGDADALDTPVE--EDIKPVIEFM 227
           +TL L  N   L    KT L    E  P +P  L  +GD + ++T  +  ED+KP I+  
Sbjct: 176 RTLELPPNRRILLTEQKTSLES--EGSPMIP--LEVDGD-EMIETTQDAVEDVKPDIKLK 230

Query: 228 YKPVINLGEIIDVHVLHRPRRHKV 251
           Y P+INLGE + +H+L RPRRHKV
Sbjct: 231 YNPIINLGECLSIHILQRPRRHKV 254

>CAGL0G06292g complement(602454..603215) similar to sp|P39735
           Saccharomyces cerevisiae YAL027w, start by similarity
          Length = 253

 Score =  171 bits (433), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 104/261 (39%), Positives = 160/261 (61%), Gaps = 20/261 (7%)

Query: 1   MAPSIATVKIARDMVLPLRIFVNRKQILQTNDKTSNKSNATIFEAPLLSNNSIICLKSPN 60
           M  +IA +K+A+D +LP+R+ +NR+QIL T  + S        +APLLSNN+I+CLKSP 
Sbjct: 1   MVQNIAYIKVAKDSILPVRVHINRRQILSTATEESK------VQAPLLSNNTIVCLKSPL 54

Query: 61  TRIYLSQQDKKNLCDEIKEDLLLIVYELASPEIISSVLSKIRVGHSTDFQINVLPKLFAG 120
           T+IYLS  D KNL  E+++D++LI+YEL+SP +  ++ SKIRVG   DF  + L K F  
Sbjct: 55  TKIYLSNTDLKNLVTEMEDDIILILYELSSPAMKQNIFSKIRVGQVYDFDEDTLKK-FPQ 113

Query: 121 ADTDNAVTSHIQSVTRLAKFKYKLHYKHKWELDIFINSIKKIANLRHYLMF--QTLTLNG 178
           +   +   S++ S+ R+ K KYKL Y+  W++DIFI++I K+  +R YL+F  Q    N 
Sbjct: 114 SIQGSLKESNLTSLKRVGKMKYKLTYRKNWDVDIFISNINKLETIRTYLIFKDQYPQWNE 173

Query: 179 FSLNAGPKTLL--ARKI-EKQPQVPNLL------IENGDADALDTPVEEDIKPVIEFMYK 229
           +      ++LL   +K+ E   Q P +L        N +  A D P  E  KP I F Y+
Sbjct: 174 YPCLQKQQSLLVMGQKLSESTNQDPIILQEEEELNLNYEQSAEDQPNNE--KPEIAFTYE 231

Query: 230 PVINLGEIIDVHVLHRPRRHK 250
           P ++L + +D+++L RP+R +
Sbjct: 232 PQLSLIQCLDLYILKRPKRKR 252

>ADR352C [2093] [Homologous to ScYAL027W - SH] (1326273..1327037)
           [765 bp, 254 aa]
          Length = 254

 Score =  142 bits (359), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 88/267 (32%), Positives = 150/267 (56%), Gaps = 28/267 (10%)

Query: 1   MAPSIATVKIARDMVLPLRIFVNRKQILQTNDKTSNKSNATIFEAPLLSNNSIICLKSPN 60
           M+P+ A +++    V+P+R+F+NR+++L      +N ++ ++FEAP+LSN++I+ LKSP+
Sbjct: 1   MSPTHALLQLQPGYVMPVRVFINRREVL------NNAASCSLFEAPILSNSAIVRLKSPS 54

Query: 61  TRIYLSQQDKKNLCDEIKEDLLLIVYELASPEIISSVLSKIRVGHSTDFQINVLPKLFAG 120
            R++LS+ DK++L  E+++DLL I+YEL SP      L K ++G   DF+ +++     G
Sbjct: 55  VRVHLSEDDKQSLLAELRDDLLYIIYELGSPG-AEETLRKFKIGGLADFR-DIVRAAEQG 112

Query: 121 ADTDNAVTS---HIQSVTRLAKFKYKLHYKHKWELDIFINSIKKIANLRHYLMFQTLTLN 177
              +  +     H  +  RL K ++ LH++H W ++I +N I+K+A  R  L+     + 
Sbjct: 113 DRPEQPIPGLDLHTMTFERLDKQRFPLHFEHNWVVNIILNDIRKLAVWRRLLLCDIAPIG 172

Query: 178 GFSLNAGPKT--------LLARKIEKQPQVPNLLIENGDADALDTPVEEDI----KPVIE 225
             +  A            L  R+    PQ   +L E+        P E D+    KPV++
Sbjct: 173 VPAAAAPAPMPAGAPYVLLRERRGRVSPQ--GMLQEDAPE---GVPREGDLNVEQKPVLD 227

Query: 226 FMYKPVINLGEIIDVHVLHRPRRHKVR 252
           + YK V NLG  I++HVL RPRR + R
Sbjct: 228 YRYKSVTNLGPGIEIHVLQRPRRVRPR 254

>Kwal_26.7066
          Length = 204

 Score = 89.0 bits (219), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 59/202 (29%), Positives = 103/202 (50%), Gaps = 33/202 (16%)

Query: 82  LLIVYELASPEIISSVLSKIRVGHSTDFQINVLPKL--FAGADTDNAVTSHIQSVTRLAK 139
           +LI+YEL + EI   VL KI+VG+  + + +++ +   F      +  + H+ ++ R  K
Sbjct: 1   MLILYELTAKEIHEEVLGKIKVGNLVEMK-DIMTRFPSFRHTKHSDTTSCHLTTLERSGK 59

Query: 140 FKYKLHYKHKWELDIFINSIKKIANLRHYLM----FQTLTLNGFSLNAG--PKTLLARKI 193
            +YKLHY++ WELDIF++ I+K+A +R  L+    F+  + +G     G   KT + R++
Sbjct: 60  HQYKLHYENNWELDIFVSDIRKLARIRSTLLQRLNFRPNSSSGLIAPIGDLSKTKVLRRV 119

Query: 194 EKQ-------PQVPNLLIENGDADALDTP-----------------VEEDIKPVIEFMYK 229
            ++          P LL+E+ + D                      V+ + KP  +F   
Sbjct: 120 REEIVSKQEASSEPKLLLESDEEDVFPESGGNEKEPTSNVLPEMIDVDSEKKPKFKFSNV 179

Query: 230 PVINLGEIIDVHVLHRPRRHKV 251
            ++NLG  ID+H+L RP R K+
Sbjct: 180 QMLNLGNCIDIHILKRPARAKM 201

>KLLA0A03960g 353119..353796 weakly similar to sp|P39735
           Saccharomyces cerevisiae YAL027w hypothetical protein
           singleton, hypothetical start
          Length = 225

 Score = 83.6 bits (205), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 67/223 (30%), Positives = 104/223 (46%), Gaps = 44/223 (19%)

Query: 71  KNLCDEIKEDLLLIVYELASPEIISSVLSKIRVGHSTDFQINVLPKLFAGAD-----TD- 124
           K L +EI++ LL ++YEL SP +   VL+K+++    DF  +VL  L  G+      TD 
Sbjct: 2   KFLLNEIRDSLLFMLYELCSPILEEKVLNKLKIDTFMDFA-DVLEILKKGSSLETRSTDV 60

Query: 125 ----NAVTSHIQSVTRLAKFKYKLHYKHKWELDIFINSIKKIANLRHYLMF----QTLTL 176
               + +  HI S+ R  K  YKLH+ H W LDI I +I K+ + R  L      Q+++ 
Sbjct: 61  YNPIDGIDVHITSIERTGKKSYKLHFSHNWRLDILIENIDKLHHWRKLLTLLDSVQSVSN 120

Query: 177 NGFSL---------------------------NAGPKTLLARKIEKQPQVPNLLIENGDA 209
            G S+                           +  P  L+  + +   QVP   IE  D 
Sbjct: 121 TGQSIPLFIPFKSTNVLVRSIKPLESDTNSSKSEDPPILIEPEDDGLGQVPRDEIEMVDQ 180

Query: 210 DALDTPVE--EDIKPVIEFMYKPVINLGEIIDVHVLHRPRRHK 250
           D  D  ++  +D KP+ ++ YK +    + I +HVL RP+R K
Sbjct: 181 DPNDIKLDTKDDKKPIFDYQYKGMRLFDKCIKIHVLGRPKRGK 223

>Scas_720.50
          Length = 449

 Score = 29.3 bits (64), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 21/37 (56%), Gaps = 1/37 (2%)

Query: 151 ELDIFINSIKKIANLRHYLMFQTLTLNGFSLNAGPKT 187
           EL I  N + K+  LR YLMF  L +NG SL   P +
Sbjct: 128 ELVIQTNPMTKLKELR-YLMFDCLAINGRSLMQSPTS 163

>YMR158W (MRPS8) [4113] chr13 (572247..572714) Protein of the
           mitochondrial small ribosomal subunit [468 bp, 155 aa]
          Length = 155

 Score = 27.3 bits (59), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 20/32 (62%), Gaps = 2/32 (6%)

Query: 46  PLLSNNSIICLKSPNTRIYLSQQDKKNLCDEI 77
           P+LS+  +I    PN+RI+L  +D K LC  +
Sbjct: 84  PVLSSCKLI--SKPNSRIHLPMEDMKKLCSGV 113

>KLLA0F00418g 26773..29505 some similarities with sp|P32336
           Saccharomyces cerevisiae YOR373w NUD1 cell cycle
           regulatory protein singleton, hypothetical start
          Length = 910

 Score = 28.1 bits (61), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 38/71 (53%), Gaps = 9/71 (12%)

Query: 146 YKHKWELDIFINSIKKIANLRHYLMFQTLTLNGFSL--------NAGPKTLLARKIE-KQ 196
           ++H  +LD+  N I  + NL + +  + L L+G S+        + G ++ + +KIE   
Sbjct: 615 WQHVTKLDLSNNRITNLKNLHYLVSLRVLILDGNSIEQLHSGSYHQGSRSRVGKKIEVGN 674

Query: 197 PQVPNLLIENG 207
           P++  L I++G
Sbjct: 675 PELRYLSIKDG 685

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.135    0.381 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,482,303
Number of extensions: 376638
Number of successful extensions: 1187
Number of sequences better than 10.0: 19
Number of HSP's gapped: 1174
Number of HSP's successfully gapped: 19
Length of query: 257
Length of database: 16,596,109
Length adjustment: 99
Effective length of query: 158
Effective length of database: 13,168,927
Effective search space: 2080690466
Effective search space used: 2080690466
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 60 (27.7 bits)