Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YAL026C (DRS2)1355133167690.0
CAGL0G06270g1328124752110.0
Kwal_26.70701315118348960.0
KLLA0A04015g1343127148320.0
ADR350W1311124245000.0
Scas_505.4102544920540.0
AGR120C1547107416630.0
CAGL0G08085g1578104016610.0
YDR093W (DNF2)1612109416290.0
KLLA0C17644g1576103816160.0
YER166W (DNF1)1571104616080.0
Scas_636.161554106316060.0
CAGL0L11814g1576104215940.0
Scas_576.81591104615600.0
YIL048W (NEO1)1151107410881e-127
Sklu_2193.11143106910751e-126
Scas_704.381161106510561e-123
ADL079C116694110501e-122
Kwal_23.57891133106710241e-119
KLLA0C08393g114899910251e-119
CAGL0L00715g114493510151e-117
CAGL0H04477g16265148141e-88
YMR162C (DNF3)16565378042e-87
KLLA0E01650g15505127952e-86
Kwal_23.355615975157472e-80
Scas_669.316385167312e-78
AFL191W15754807106e-76
Scas_89.12712713626e-38
AFL011W12425972022e-15
Kwal_47.1754712407931807e-13
KLLA0A08910g12807311781e-12
Scas_665.3014392991781e-12
KLLA0B08217g14393031637e-11
AFR567W14492971638e-11
CAGL0M11308g14523851611e-10
KLLA0F20658g10825101592e-10
Kwal_26.920714694941592e-10
YGL006W (PMC1)11735641573e-10
Kwal_23.316011007751556e-10
YOR291W14723891548e-10
CAGL0I04312g9514641466e-09
AEL301W9575941441e-08
Scas_583.14*8754981422e-08
YDR040C (ENA1)10915301395e-08
KLLA0E22352g12065231395e-08
YDR038C (ENA5)10915301386e-08
KLLA0E14630g10825001386e-08
YDR039C (ENA2)10915301387e-08
YGL167C (PMR1)9503591351e-07
YEL031W (SPF1)12152801297e-07
Kwal_56.234672802381231e-06
CAGL0A00517g11225781271e-06
CAGL0L01419g12145021216e-06
CAGL0K12034g10873031199e-06
Kwal_14.14989394611199e-06
AGL097C10967801191e-05
AFR354C12102751172e-05
CAGL0J01870g9464581153e-05
Scas_707.48*7413001101e-04
Kwal_47.17522899174980.003
KLLA0A09031g899174980.003
KLLA0A03157g938307920.015
YPL036W (PMA2)947174900.029
AGL085C909176880.038
CAGL0A00495g902174880.040
Scas_688.1913174870.053
YGL008C (PMA1)918174870.064
Scas_710.41904170850.11
Scas_297.1800107800.39
KLLA0F07447g97565761.1
CAGL0M08602g101272751.3
YJL109C (UTP10)176993742.2
ABL009W56968732.3
Kwal_26.8333422119722.5
Scas_630.1470159723.6
YNL321W90852723.6
YLR417W (VPS36)566118713.9
ABR035C98164714.0
KLLA0E23056g81884714.7
Scas_645.6830185705.2
AGL041C123335706.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YAL026C
         (1331 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YAL026C (DRS2) [42] chr1 complement(95633..99700) Membrane-spann...  2612   0.0  
CAGL0G06270g 598357..602343 highly similar to sp|P39524 Saccharo...  2011   0.0  
Kwal_26.7070                                                         1890   0.0  
KLLA0A04015g complement(355624..359655) similar to sp|P39524 Sac...  1865   0.0  
ADR350W [2091] [Homologous to ScYAL026C (DRS2) - SH] complement(...  1738   0.0  
Scas_505.4                                                            795   0.0  
AGR120C [4431] [Homologous to ScYER166W (DNF1) - SH; ScYDR093W (...   645   0.0  
CAGL0G08085g 763185..767921 highly similar to sp|Q12675 Saccharo...   644   0.0  
YDR093W (DNF2) [945] chr4 (631276..636114) Member of the haloaci...   632   0.0  
KLLA0C17644g 1557138..1561868 similar to sp|P32660 Saccharomyces...   627   0.0  
YER166W (DNF1) [1594] chr5 (512739..517454) Member of the haloac...   624   0.0  
Scas_636.16                                                           623   0.0  
CAGL0L11814g 1262124..1266854 highly similar to sp|P32660 Saccha...   618   0.0  
Scas_576.8                                                            605   0.0  
YIL048W (NEO1) [2619] chr9 (261436..264891) Member of the Drs2p-...   423   e-127
Sklu_2193.1 YIL048W, Contig c2193 334-3765 reverse complement         418   e-126
Scas_704.38                                                           411   e-123
ADL079C [1662] [Homologous to ScYIL048W (NEO1) - SH] (544854..54...   409   e-122
Kwal_23.5789                                                          399   e-119
KLLA0C08393g 734655..738101 highly similar to sp|P40527 Saccharo...   399   e-119
CAGL0L00715g 86810..90244 highly similar to sp|P40527 Saccharomy...   395   e-117
CAGL0H04477g 421857..426737 similar to sp|Q12674 Saccharomyces c...   318   1e-88
YMR162C (DNF3) [4117] chr13 complement(578950..583920) Member of...   314   2e-87
KLLA0E01650g complement(155975..160627) similar to sp|Q12674 Sac...   310   2e-86
Kwal_23.3556                                                          292   2e-80
Scas_669.3                                                            286   2e-78
AFL191W [3004] [Homologous to ScYMR162C (DNF3) - SH] complement(...   278   6e-76
Scas_89.1                                                             144   6e-38
AFL011W [3182] [Homologous to ScYGL006W (PMC1) - SH] complement(...    82   2e-15
Kwal_47.17547                                                          74   7e-13
KLLA0A08910g complement(779526..783368) similar to sp|P38929 Sac...    73   1e-12
Scas_665.30                                                            73   1e-12
KLLA0B08217g complement(724364..728683) similar to sp|Q12697 Sac...    67   7e-11
AFR567W [3759] [Homologous to ScYOR291W - SH] complement(1455295...    67   8e-11
CAGL0M11308g 1110211..1114569 similar to sp|Q12697 Saccharomyces...    67   1e-10
KLLA0F20658g 1919851..1923099 similar to sp|Q12691 Saccharomyces...    66   2e-10
Kwal_26.9207                                                           66   2e-10
YGL006W (PMC1) [1966] chr7 (485923..489444) Vacuolar Ca2+-transp...    65   3e-10
Kwal_23.3160                                                           64   6e-10
YOR291W (YOR291W) [5075] chr15 (861172..865590) Member of the ca...    64   8e-10
CAGL0I04312g complement(382354..385209) highly similar to sp|P13...    61   6e-09
AEL301W [2204] [Homologous to ScYGL167C (PMR1) - SH] complement(...    60   1e-08
Scas_583.14*                                                           59   2e-08
YDR040C (ENA1) [893] chr4 complement(535187..538462) P-type ATPa...    58   5e-08
KLLA0E22352g 1984522..1988142 highly similar to sp|P39986 Saccha...    58   5e-08
YDR038C (ENA5) [891] chr4 complement(527417..530692) Member of t...    58   6e-08
KLLA0E14630g complement(1297636..1300884) similar to sp|Q01896 S...    58   6e-08
YDR039C (ENA2) [892] chr4 complement(531302..534577) Member of t...    58   7e-08
YGL167C (PMR1) [1823] chr7 complement(187620..190472) Ca2+-trans...    57   1e-07
YEL031W (SPF1) [1394] chr5 (90258..93905) Putative Ca2+-transpor...    54   7e-07
Kwal_56.23467                                                          52   1e-06
CAGL0A00517g 58830..62198 similar to sp|P38929 Saccharomyces cer...    54   1e-06
CAGL0L01419g 156123..159767 highly similar to sp|P39986 Saccharo...    51   6e-06
CAGL0K12034g complement(1161299..1164562) highly similar to sp|P...    50   9e-06
Kwal_14.1498                                                           50   9e-06
AGL097C [4215] [Homologous to ScYDR039C (ENA2 ) - NSH] (520915.....    50   1e-05
AFR354C [3546] [Homologous to ScYEL031W (SPF1) - SH] (1078275..1...    50   2e-05
CAGL0J01870g 181666..184506 highly similar to sp|P13586 Saccharo...    49   3e-05
Scas_707.48*                                                           47   1e-04
Kwal_47.17522                                                          42   0.003
KLLA0A09031g 787768..790467 gi|1346734|sp|P49380|PMA1_KLULA Kluy...    42   0.003
KLLA0A03157g complement(281313..284129) gi|3288523|emb|CAA04476....    40   0.015
YPL036W (PMA2) [5403] chr16 (482839..485682) H[+]-transporting P...    39   0.029
AGL085C [4226] [Homologous to ScYGL008C (PMA1) - SH; ScYPL036W (...    39   0.038
CAGL0A00495g complement(55014..57722) highly similar to sp|P0503...    39   0.040
Scas_688.1                                                             38   0.053
YGL008C (PMA1) [1965] chr7 complement(479913..482669) H+-transpo...    38   0.064
Scas_710.41                                                            37   0.11 
Scas_297.1                                                             35   0.39 
KLLA0F07447g 700685..703612 similar to sp|P38995 Saccharomyces c...    34   1.1  
CAGL0M08602g complement(856349..859387) similar to sp|P38995 Sac...    33   1.3  
YJL109C (UTP10) [2806] chr10 complement(211917..217226) Componen...    33   2.2  
ABL009W [583] [Homologous to ScYLR361C - SH] complement(381102.....    33   2.3  
Kwal_26.8333                                                           32   2.5  
Scas_630.14                                                            32   3.6  
YNL321W (YNL321W) [4293] chr14 (34695..37421) Member of the calc...    32   3.6  
YLR417W (VPS36) [3793] chr12 (955006..956706) Component of the e...    32   3.9  
ABR035C [626] [Homologous to ScYLR336C (SGD1) - SH] (461282..464...    32   4.0  
KLLA0E23056g complement(2044323..2046779) weakly similar to sp|P...    32   4.7  
Scas_645.6                                                             32   5.2  
AGL041C [4270] [Homologous to ScYDR270W - NSH] (628428..632129) ...    32   6.5  

>YAL026C (DRS2) [42] chr1 complement(95633..99700) Membrane-spanning
            Ca-ATPase (P-type) required for ribosome assembly and
            involved in late Golgi function, member of the cation
            transporting (E1-E2) P-type ATPase superfamily [4068 bp,
            1355 aa]
          Length = 1355

 Score = 2612 bits (6769), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1265/1331 (95%), Positives = 1265/1331 (95%)

Query: 1    MNDDRETPPKRKPGEXXXXXXXXXXXXXXSHSGSRSKVTNSHANGYYIPPSHVLPXXXXX 60
            MNDDRETPPKRKPGE              SHSGSRSKVTNSHANGYYIPPSHVLP     
Sbjct: 1    MNDDRETPPKRKPGEDDTLFDIDFLDDTTSHSGSRSKVTNSHANGYYIPPSHVLPEETID 60

Query: 61   XXXXXXXXXXXVHENLFMSNNHDDQTSWNANRFDSDAYQPQSLRAVKPPGLFARFGNGLK 120
                       VHENLFMSNNHDDQTSWNANRFDSDAYQPQSLRAVKPPGLFARFGNGLK
Sbjct: 61   LDADDDNIENDVHENLFMSNNHDDQTSWNANRFDSDAYQPQSLRAVKPPGLFARFGNGLK 120

Query: 121  NAFTFKRKKGPESFEMNHYNAVTNNELDDNYLDSRNKFNIKILFNRYILRKNVGDAEGNG 180
            NAFTFKRKKGPESFEMNHYNAVTNNELDDNYLDSRNKFNIKILFNRYILRKNVGDAEGNG
Sbjct: 121  NAFTFKRKKGPESFEMNHYNAVTNNELDDNYLDSRNKFNIKILFNRYILRKNVGDAEGNG 180

Query: 181  EPRVIHINDSLANSSFGYSDNHISTTKYNFATFLPKFLFQEFSKYANLFFLCTSAIQQVP 240
            EPRVIHINDSLANSSFGYSDNHISTTKYNFATFLPKFLFQEFSKYANLFFLCTSAIQQVP
Sbjct: 181  EPRVIHINDSLANSSFGYSDNHISTTKYNFATFLPKFLFQEFSKYANLFFLCTSAIQQVP 240

Query: 241  HVSPTNRYTTIGTLLVVLIVSAMKECIEDIKRANSDKELNNSTAEIFSEAHDDFVEKRWI 300
            HVSPTNRYTTIGTLLVVLIVSAMKECIEDIKRANSDKELNNSTAEIFSEAHDDFVEKRWI
Sbjct: 241  HVSPTNRYTTIGTLLVVLIVSAMKECIEDIKRANSDKELNNSTAEIFSEAHDDFVEKRWI 300

Query: 301  DIRVGDIIRVKSEEPIPADTIILSSSEPEGLCYIETANLDGETNLKIKQSRVETAKFIDV 360
            DIRVGDIIRVKSEEPIPADTIILSSSEPEGLCYIETANLDGETNLKIKQSRVETAKFIDV
Sbjct: 301  DIRVGDIIRVKSEEPIPADTIILSSSEPEGLCYIETANLDGETNLKIKQSRVETAKFIDV 360

Query: 361  KTLKNMNGKVVSEQPNSSLYTYEGTMTLNDRQIPLSPDQMILRGATLRNTAWIFGLVIFT 420
            KTLKNMNGKVVSEQPNSSLYTYEGTMTLNDRQIPLSPDQMILRGATLRNTAWIFGLVIFT
Sbjct: 361  KTLKNMNGKVVSEQPNSSLYTYEGTMTLNDRQIPLSPDQMILRGATLRNTAWIFGLVIFT 420

Query: 421  GHETKLLRNATATPIKRTAVEKIINRQXXXXXXXXXXXXXXXXXXXXXMSTADAKHLSYL 480
            GHETKLLRNATATPIKRTAVEKIINRQ                     MSTADAKHLSYL
Sbjct: 421  GHETKLLRNATATPIKRTAVEKIINRQIIRLFTVLIVLILISSIGNVIMSTADAKHLSYL 480

Query: 481  YLEGTNKAGLFFKDFLTFWILFSNLVPISLFVTVELIKYYQAFMIGSDLDLYYEKTDTPT 540
            YLEGTNKAGLFFKDFLTFWILFSNLVPISLFVTVELIKYYQAFMIGSDLDLYYEKTDTPT
Sbjct: 481  YLEGTNKAGLFFKDFLTFWILFSNLVPISLFVTVELIKYYQAFMIGSDLDLYYEKTDTPT 540

Query: 541  VVRTSSLVEELGQIEYIFSDKTGTLTRNIMEFKSCSIAGHCYIDKIPEDKTATVEDGIEV 600
            VVRTSSLVEELGQIEYIFSDKTGTLTRNIMEFKSCSIAGHCYIDKIPEDKTATVEDGIEV
Sbjct: 541  VVRTSSLVEELGQIEYIFSDKTGTLTRNIMEFKSCSIAGHCYIDKIPEDKTATVEDGIEV 600

Query: 601  GYRKFDDLKKKLNDPSDEDSPIINDFLTLLATCHTVIPEFQSDGSIKYQAASPDEGALVQ 660
            GYRKFDDLKKKLNDPSDEDSPIINDFLTLLATCHTVIPEFQSDGSIKYQAASPDEGALVQ
Sbjct: 601  GYRKFDDLKKKLNDPSDEDSPIINDFLTLLATCHTVIPEFQSDGSIKYQAASPDEGALVQ 660

Query: 661  GGADLGYKFIIRKGNSVTVLLEETGEEKEYQLLNICEFNSTRKRMSAIFRFPDGSIKLFC 720
            GGADLGYKFIIRKGNSVTVLLEETGEEKEYQLLNICEFNSTRKRMSAIFRFPDGSIKLFC
Sbjct: 661  GGADLGYKFIIRKGNSVTVLLEETGEEKEYQLLNICEFNSTRKRMSAIFRFPDGSIKLFC 720

Query: 721  KGADTVILERLDDEANQYVEATMRHLEDYASEGLRTLCLAMRDISEGEYEEWNSIYNEAA 780
            KGADTVILERLDDEANQYVEATMRHLEDYASEGLRTLCLAMRDISEGEYEEWNSIYNEAA
Sbjct: 721  KGADTVILERLDDEANQYVEATMRHLEDYASEGLRTLCLAMRDISEGEYEEWNSIYNEAA 780

Query: 781  TTLDNRAEKLDEAANLIEKNLILIGATAIEDKLQDGVPETIHTLQEAGIKIWVLTGDRQE 840
            TTLDNRAEKLDEAANLIEKNLILIGATAIEDKLQDGVPETIHTLQEAGIKIWVLTGDRQE
Sbjct: 781  TTLDNRAEKLDEAANLIEKNLILIGATAIEDKLQDGVPETIHTLQEAGIKIWVLTGDRQE 840

Query: 841  TAINIGMSCRLLSEDMNLLIINEETRDDTERNLLEKINALNEHQLSTHDMKSLALVIDGK 900
            TAINIGMSCRLLSEDMNLLIINEETRDDTERNLLEKINALNEHQLSTHDMKSLALVIDGK
Sbjct: 841  TAINIGMSCRLLSEDMNLLIINEETRDDTERNLLEKINALNEHQLSTHDMKSLALVIDGK 900

Query: 901  SLGFALEPELEDYLLTVAKLCKAVICCRVSPLQKALVVKMVKRKXXXXXXAIASGANDVS 960
            SLGFALEPELEDYLLTVAKLCKAVICCRVSPLQKALVVKMVKRK      AIASGANDVS
Sbjct: 901  SLGFALEPELEDYLLTVAKLCKAVICCRVSPLQKALVVKMVKRKSSSLLLAIASGANDVS 960

Query: 961  MIQAAHVGVGISGMEGMQAARSADIALGQXXXXXXXXXVHGSWSYQRISVAILYSFYKNT 1020
            MIQAAHVGVGISGMEGMQAARSADIALGQ         VHGSWSYQRISVAILYSFYKNT
Sbjct: 961  MIQAAHVGVGISGMEGMQAARSADIALGQFKFLKKLLLVHGSWSYQRISVAILYSFYKNT 1020

Query: 1021 ALYMTQFWYVFANAFSGQSIMESWTMSFYNLFFTVWPPFVIGVFDQFVSSRLLERYPQLY 1080
            ALYMTQFWYVFANAFSGQSIMESWTMSFYNLFFTVWPPFVIGVFDQFVSSRLLERYPQLY
Sbjct: 1021 ALYMTQFWYVFANAFSGQSIMESWTMSFYNLFFTVWPPFVIGVFDQFVSSRLLERYPQLY 1080

Query: 1081 KLGQKGQFFSVYIFWGWIINGFFHSAIVFIGTILIYRYGFALNMHGELADHWSWGVTVYT 1140
            KLGQKGQFFSVYIFWGWIINGFFHSAIVFIGTILIYRYGFALNMHGELADHWSWGVTVYT
Sbjct: 1081 KLGQKGQFFSVYIFWGWIINGFFHSAIVFIGTILIYRYGFALNMHGELADHWSWGVTVYT 1140

Query: 1141 TSVIIVLGKAALVTNQWTKFTLIAIPGSLLFWLIFFPIYASIFPHANISREYYGVVKHTY 1200
            TSVIIVLGKAALVTNQWTKFTLIAIPGSLLFWLIFFPIYASIFPHANISREYYGVVKHTY
Sbjct: 1141 TSVIIVLGKAALVTNQWTKFTLIAIPGSLLFWLIFFPIYASIFPHANISREYYGVVKHTY 1200

Query: 1201 GSGVFWLTLIVLPIFALVRDFLWKYYKRMYEPETYHVIQEMQKYNISDSRPHVQQFQNAI 1260
            GSGVFWLTLIVLPIFALVRDFLWKYYKRMYEPETYHVIQEMQKYNISDSRPHVQQFQNAI
Sbjct: 1201 GSGVFWLTLIVLPIFALVRDFLWKYYKRMYEPETYHVIQEMQKYNISDSRPHVQQFQNAI 1260

Query: 1261 RKVRQVQRMKKQRGFAFSQAEEGGQEKIVRMYDTTQKRGKYGELQDASANPFNDNNGLGS 1320
            RKVRQVQRMKKQRGFAFSQAEEGGQEKIVRMYDTTQKRGKYGELQDASANPFNDNNGLGS
Sbjct: 1261 RKVRQVQRMKKQRGFAFSQAEEGGQEKIVRMYDTTQKRGKYGELQDASANPFNDNNGLGS 1320

Query: 1321 NDFESAEPFIE 1331
            NDFESAEPFIE
Sbjct: 1321 NDFESAEPFIE 1331

>CAGL0G06270g 598357..602343 highly similar to sp|P39524 Saccharomyces
            cerevisiae YAL026c DRS2, start by similarity
          Length = 1328

 Score = 2011 bits (5211), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 965/1247 (77%), Positives = 1066/1247 (85%), Gaps = 5/1247 (0%)

Query: 72   VHENLFMSNNHDDQTSWNANRFDSDAYQPQSLRAVKPPGLFARFGNGLKNAFTFKRKKGP 131
            +H+N F  + +  +  WN NRFD    QP   +      +F R G  +K  FTF+    P
Sbjct: 57   LHDNPF--SEYGGEGDWNTNRFDRINNQPHLTQIGNKGNVFTRMGRSIKGIFTFQSNSEP 114

Query: 132  ESFEMNHYNAVTNNELDDNYLDSRNKFNIKILFNRYILRKNVGDAEGNGEPRVIHINDSL 191
            +SFEM++YN V+  E+DDN+  SRNKF+IKILFN+Y+LRKN  D + +GEPR IHI+D  
Sbjct: 115  QSFEMSNYNTVSTGEMDDNFQKSRNKFDIKILFNKYLLRKNTSDGQDSGEPREIHISDRE 174

Query: 192  ANSSFGYSDNHISTTKYNFATFLPKFLFQEFSKYANLFFLCTSAIQQVPHVSPTNRYTTI 251
            +N+ FGY DNHISTTKYN ATFLPKFLFQEFSKYANLFFLCTSAIQQVPHVSPTNRYTTI
Sbjct: 175  SNNRFGYIDNHISTTKYNAATFLPKFLFQEFSKYANLFFLCTSAIQQVPHVSPTNRYTTI 234

Query: 252  GTLLVVLIVSAMKECIEDIKRANSDKELNNSTAEIFSEAHDDFVEKRWIDIRVGDIIRVK 311
            GTL+VVLIVSA+KE +ED+KRA+SD ELNNS AEI+ EA  DF++KRWIDI+VGDIIRV 
Sbjct: 235  GTLMVVLIVSAIKESVEDLKRASSDNELNNSKAEIYFEAEGDFIQKRWIDIKVGDIIRVN 294

Query: 312  SEEPIPADTIILSSSEPEGLCYIETANLDGETNLKIKQSRVETAKFIDVKTLKNMNGKVV 371
            SEEPIPAD IILSSSEPEGLCYIETANLDGETNLKIKQ+R ETAK +D + L+N+ G + 
Sbjct: 295  SEEPIPADIIILSSSEPEGLCYIETANLDGETNLKIKQARTETAKIMDSRELRNIKGVIS 354

Query: 372  SEQPNSSLYTYEGTMTLNDRQIPLSPDQMILRGATLRNTAWIFGLVIFTGHETKLLRNAT 431
            SEQPNSSLYTYEGT+ +N  +IPLSP+QMILRGATLRNT WIFG+VIFTGHETKL+RNAT
Sbjct: 355  SEQPNSSLYTYEGTLEMNGTKIPLSPEQMILRGATLRNTGWIFGIVIFTGHETKLMRNAT 414

Query: 432  ATPIKRTAVEKIINRQXXXXXXXXXXXXXXXXXXXXXMSTADAKHLSYLYLEGTNKAGLF 491
            ATPIKRTAVEK+IN Q                     MSTADAKHLSYLYL+GTNKAGLF
Sbjct: 415  ATPIKRTAVEKVINMQIIALFTVLVVLILISSIGNVIMSTADAKHLSYLYLQGTNKAGLF 474

Query: 492  FKDFLTFWILFSNLVPISLFVTVELIKYYQAFMIGSDLDLYYEKTDTPTVVRTSSLVEEL 551
            FKDFLTFWILFSNLVPISLFVTVELIKYYQAFMIGSDLDLYYE+TDTPTVV+TSSLVEEL
Sbjct: 475  FKDFLTFWILFSNLVPISLFVTVELIKYYQAFMIGSDLDLYYEETDTPTVVKTSSLVEEL 534

Query: 552  GQIEYIFSDKTGTLTRNIMEFKSCSIAGHCYIDKIPEDKTATVEDGIEVGYRKFDDLKKK 611
            GQIEYIFSDKTGTLTRNIMEFKSCSIAG CY + IPEDK AT EDGIEVGYR FDDLKK+
Sbjct: 535  GQIEYIFSDKTGTLTRNIMEFKSCSIAGRCYAEHIPEDKAATFEDGIEVGYRSFDDLKKQ 594

Query: 612  LNDPSDEDSPIINDFLTLLATCHTVIPEFQSDGSIKYQAASPDEGALVQGGADLGYKFII 671
            L   SD D  II++FLTLLATCHTVIPEFQ+DGSIKYQAASPDEGALV+GGA LGYKF+I
Sbjct: 595  LTTNSD-DCKIIDEFLTLLATCHTVIPEFQADGSIKYQAASPDEGALVEGGALLGYKFLI 653

Query: 672  RKGNSVTVLLEETGEEKEYQLLNICEFNSTRKRMSAIFRFPDGSIKLFCKGADTVILERL 731
            RK NSVT+L+ E  EE+EYQLLNICEFNSTRKRMSAIFRFPD SIKL CKGAD+VILERL
Sbjct: 654  RKPNSVTILINEE-EEREYQLLNICEFNSTRKRMSAIFRFPDDSIKLLCKGADSVILERL 712

Query: 732  DDEANQYVEATMRHLEDYASEGLRTLCLAMRDISEGEYEEWNSIYNEAATTLDNRAEKLD 791
             +  N YV+AT RHLEDYA+EGLRTLCLA +DI E EY  WN  Y +AATTLD+RAEKLD
Sbjct: 713  SETGNFYVDATTRHLEDYATEGLRTLCLATKDIPEDEYNAWNKKYMDAATTLDHRAEKLD 772

Query: 792  EAANLIEKNLILIGATAIEDKLQDGVPETIHTLQEAGIKIWVLTGDRQETAINIGMSCRL 851
              A  IE  L LIGATAIEDKLQ+GVP+TI TLQEAGIKIWVLTGD+QETAINIGMSCRL
Sbjct: 773  AVAEEIESGLTLIGATAIEDKLQEGVPDTIRTLQEAGIKIWVLTGDKQETAINIGMSCRL 832

Query: 852  LSEDMNLLIINEETRDDTERNLLEKINALNEHQLSTHDMKSLALVIDGKSLGFALEPELE 911
            LSEDMNLLII+EET++ T RN+ EK+ AL+EH LS HDM +LALVIDG SL FALE +LE
Sbjct: 833  LSEDMNLLIISEETKEATRRNMEEKLAALHEHSLSEHDMNTLALVIDGHSLSFALEADLE 892

Query: 912  DYLLTVAKLCKAVICCRVSPLQKALVVKMVKRKXXXXXXAIASGANDVSMIQAAHVGVGI 971
            DY L + K+CKAVICCRVSPLQKALVVKMVKRK      AI  GANDVSMIQAAHVGVGI
Sbjct: 893  DYFLAIGKMCKAVICCRVSPLQKALVVKMVKRKTNSLLLAIGDGANDVSMIQAAHVGVGI 952

Query: 972  SGMEGMQAARSADIALGQXXXXXXXXXVHGSWSYQRISVAILYSFYKNTALYMTQFWYVF 1031
            SGMEGMQAARSADI++GQ         VHG+WSYQRISVAILYSFYKNTALYMTQFWYVF
Sbjct: 953  SGMEGMQAARSADISVGQFRFLKKLLLVHGAWSYQRISVAILYSFYKNTALYMTQFWYVF 1012

Query: 1032 ANAFSGQSIMESWTMSFYNLFFTVWPPFVIGVFDQFVSSRLLERYPQLYKLGQKGQFFSV 1091
            ANAFSGQSIMESWTMS YN+FFTV PPFVIGVFDQFV+SRLLERYPQLYKLGQKGQFFSV
Sbjct: 1013 ANAFSGQSIMESWTMSLYNVFFTVLPPFVIGVFDQFVNSRLLERYPQLYKLGQKGQFFSV 1072

Query: 1092 YIFWGWIINGFFHSAIVFIGTILIYRYGFALNMHGELADHWSWGVTVYTTSVIIVLGKAA 1151
             IFWGWI+NGF+HSA+VF+GTIL YRYGFAL  HGE ADHWSWG+ +YT+SVIIVLGKAA
Sbjct: 1073 SIFWGWIVNGFYHSAVVFVGTILFYRYGFALRKHGETADHWSWGIAIYTSSVIIVLGKAA 1132

Query: 1152 LVTNQWTKFTLIAIPGSLLFWLIFFPIYASIFPHANISREYYGVVKHTYGSGVFWLTLIV 1211
            LVTNQWTKFTL AIPGSL FWLIFFPIY SIFP+A ISREY+GVV+HTYGS  FWLTLIV
Sbjct: 1133 LVTNQWTKFTLFAIPGSLFFWLIFFPIYGSIFPYAKISREYFGVVEHTYGSATFWLTLIV 1192

Query: 1212 LPIFALVRDFLWKYYKRMYEPETYHVIQEMQKYNISDSRPHVQQFQNAIRKVRQVQRMKK 1271
            LP FAL RDF+WKYYKRMY PE+YH+IQEMQKYN+SD RPHVQ FQNAIRKVRQVQRMKK
Sbjct: 1193 LPTFALTRDFIWKYYKRMYAPESYHLIQEMQKYNVSDYRPHVQHFQNAIRKVRQVQRMKK 1252

Query: 1272 QRGFAFSQAEEGGQEKIVRMYDTTQKRGKYGELQDASANPFNDNNGL 1318
            QRGFAFSQAEE GQEKI+RMYDTTQKRGKYGEL DASA+PF+D + L
Sbjct: 1253 QRGFAFSQAEE-GQEKIIRMYDTTQKRGKYGELHDASADPFSDTHKL 1298

>Kwal_26.7070
          Length = 1315

 Score = 1890 bits (4896), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 888/1183 (75%), Positives = 1008/1183 (85%), Gaps = 3/1183 (0%)

Query: 132  ESFEMNHYNAVTNNELDDNYLDSRNKFNIKILFNRYILRKNVGDAEGNGEPRVIHINDSL 191
            + FEM++Y+ + N   DD Y  SRNKF+IKI+F RYILR+N    +    PR I+IND  
Sbjct: 134  QGFEMHNYDDLGN---DDRYAKSRNKFDIKIIFKRYILRRNDYSDDDKSSPRQIYINDKE 190

Query: 192  ANSSFGYSDNHISTTKYNFATFLPKFLFQEFSKYANLFFLCTSAIQQVPHVSPTNRYTTI 251
            AN + G+  NHISTTKYN ATF+PKFLFQEFSKYANLFFL TSAIQQVP+V+PTNRYTTI
Sbjct: 191  ANRARGFGSNHISTTKYNLATFIPKFLFQEFSKYANLFFLFTSAIQQVPNVTPTNRYTTI 250

Query: 252  GTLLVVLIVSAMKECIEDIKRANSDKELNNSTAEIFSEAHDDFVEKRWIDIRVGDIIRVK 311
            GTLL+VLIVSA+KE +ED+KRA SD ELN+S A++FSE   DF   +W++I VGDII+V 
Sbjct: 251  GTLLIVLIVSAIKEIVEDLKRAQSDSELNDSRAQVFSEQLQDFTLSKWVNISVGDIIKVN 310

Query: 312  SEEPIPADTIILSSSEPEGLCYIETANLDGETNLKIKQSRVETAKFIDVKTLKNMNGKVV 371
            SEE IPAD I+++SSEPEGLCYIETANLDGETNLKIKQ+R+ET+KFID   L  M GKV+
Sbjct: 311  SEEAIPADVIVIASSEPEGLCYIETANLDGETNLKIKQARIETSKFIDKDDLAGMRGKVL 370

Query: 372  SEQPNSSLYTYEGTMTLNDRQIPLSPDQMILRGATLRNTAWIFGLVIFTGHETKLLRNAT 431
            SE PNSSLYTYEGTM LN + I LSP+QM+LRGATLRNTAWI+GLV+FTGHETKL+RNAT
Sbjct: 371  SEHPNSSLYTYEGTMNLNGKNISLSPEQMVLRGATLRNTAWIYGLVVFTGHETKLMRNAT 430

Query: 432  ATPIKRTAVEKIINRQXXXXXXXXXXXXXXXXXXXXXMSTADAKHLSYLYLEGTNKAGLF 491
            ATPIKRTAVE++IN Q                       T+DA+HL+YLYL+GTNK GLF
Sbjct: 431  ATPIKRTAVERVINMQIVALFGVLIVLALISSIGNVIKVTSDAEHLTYLYLQGTNKVGLF 490

Query: 492  FKDFLTFWILFSNLVPISLFVTVELIKYYQAFMIGSDLDLYYEKTDTPTVVRTSSLVEEL 551
            FKD LT+WILFSNLVPISLFVTVE+IKYYQA+MI SDLDLY E +D+PTVVRTSSLVEEL
Sbjct: 491  FKDILTYWILFSNLVPISLFVTVEMIKYYQAYMIASDLDLYDEASDSPTVVRTSSLVEEL 550

Query: 552  GQIEYIFSDKTGTLTRNIMEFKSCSIAGHCYIDKIPEDKTATVEDGIEVGYRKFDDLKKK 611
            GQIEYIFSDKTGTLTRN+MEFKSCSIAG CYI+ IPEDK AT EDGIE+G+RKFD +K+ 
Sbjct: 551  GQIEYIFSDKTGTLTRNVMEFKSCSIAGKCYIETIPEDKAATTEDGIEIGFRKFDSMKET 610

Query: 612  LNDPSDEDSPIINDFLTLLATCHTVIPEFQSDGSIKYQAASPDEGALVQGGADLGYKFII 671
            LND  D DS IINDFLTLLATCHTVIPEFQ DGSIKYQAASPDEGALV+G A LGYKFII
Sbjct: 611  LNDTQDPDSHIINDFLTLLATCHTVIPEFQEDGSIKYQAASPDEGALVEGAASLGYKFII 670

Query: 672  RKGNSVTVLLEETGEEKEYQLLNICEFNSTRKRMSAIFRFPDGSIKLFCKGADTVILERL 731
            RK NSV+VL+E+ G+E+EYQLLNICEFNSTRKRMSAIFR P+G IKLFCKGADTVILERL
Sbjct: 671  RKPNSVSVLIEDLGQEQEYQLLNICEFNSTRKRMSAIFRLPNGEIKLFCKGADTVILERL 730

Query: 732  DDEANQYVEATMRHLEDYASEGLRTLCLAMRDISEGEYEEWNSIYNEAATTLDNRAEKLD 791
                N Y+EAT+RHLEDYA+EGLRTLCLA R ++E EY EW  IY+ A+TTLD+RA+KLD
Sbjct: 731  KAGENPYIEATLRHLEDYAAEGLRTLCLASRTVTESEYAEWKDIYDAASTTLDDRAQKLD 790

Query: 792  EAANLIEKNLILIGATAIEDKLQDGVPETIHTLQEAGIKIWVLTGDRQETAINIGMSCRL 851
            +AA LIEK+L L+GATAIEDKLQDGVPETIHTLQ+AGIK+WVLTGDRQETA+NIGMSCRL
Sbjct: 791  DAAELIEKDLFLLGATAIEDKLQDGVPETIHTLQDAGIKVWVLTGDRQETAVNIGMSCRL 850

Query: 852  LSEDMNLLIINEETRDDTERNLLEKINALNEHQLSTHDMKSLALVIDGKSLGFALEPELE 911
            LSEDMNLLIINEE ++ T +NL EK+ A+++HQ+S  DM SLALVIDGKSLGFALE +LE
Sbjct: 851  LSEDMNLLIINEEDKEATRKNLTEKLKAISDHQISQQDMNSLALVIDGKSLGFALEADLE 910

Query: 912  DYLLTVAKLCKAVICCRVSPLQKALVVKMVKRKXXXXXXAIASGANDVSMIQAAHVGVGI 971
            DYLL + KLCKAVICCRVSPLQKALVVKMVKRK      AI  GANDVSMIQAAHVGVGI
Sbjct: 911  DYLLAIGKLCKAVICCRVSPLQKALVVKMVKRKTDSLLLAIGDGANDVSMIQAAHVGVGI 970

Query: 972  SGMEGMQAARSADIALGQXXXXXXXXXVHGSWSYQRISVAILYSFYKNTALYMTQFWYVF 1031
            SGMEGMQAARSAD A+ Q         VHGSWSYQRIS AILYSFYKN ALYMTQFWYVF
Sbjct: 971  SGMEGMQAARSADFAIAQFKYLKKLLLVHGSWSYQRISQAILYSFYKNIALYMTQFWYVF 1030

Query: 1032 ANAFSGQSIMESWTMSFYNLFFTVWPPFVIGVFDQFVSSRLLERYPQLYKLGQKGQFFSV 1091
            ANA+SGQSIMESWTM+FYN+FFTV PPFV+GVFDQFVSSRLL+RYPQLYKLGQ+GQFFSV
Sbjct: 1031 ANAYSGQSIMESWTMTFYNVFFTVLPPFVMGVFDQFVSSRLLDRYPQLYKLGQRGQFFSV 1090

Query: 1092 YIFWGWIINGFFHSAIVFIGTILIYRYGFALNMHGELADHWSWGVTVYTTSVIIVLGKAA 1151
             IFWGW+INGF+HSA+ FIG+ L YR G  LN HGE ADHW+WGV++YT SVIIV+GKAA
Sbjct: 1091 RIFWGWVINGFYHSAVTFIGSTLFYRNGNVLNSHGETADHWAWGVSIYTCSVIIVIGKAA 1150

Query: 1152 LVTNQWTKFTLIAIPGSLLFWLIFFPIYASIFPHANISREYYGVVKHTYGSGVFWLTLIV 1211
            LVTNQWTKFT  AIPGSL+FWL+FFPIYASI PHAN+S+EYYGVV H YGS  FWL  IV
Sbjct: 1151 LVTNQWTKFTAFAIPGSLVFWLVFFPIYASILPHANVSKEYYGVVSHVYGSATFWLMCIV 1210

Query: 1212 LPIFALVRDFLWKYYKRMYEPETYHVIQEMQKYNISDSRPHVQQFQNAIRKVRQVQRMKK 1271
            LP FAL+RD +WKYYKR Y PE+YHV+QEMQKYNI D RP ++QFQ AIR+VRQVQRMKK
Sbjct: 1211 LPTFALMRDLVWKYYKRTYTPESYHVVQEMQKYNIGDYRPRIEQFQKAIRRVRQVQRMKK 1270

Query: 1272 QRGFAFSQAEEGGQEKIVRMYDTTQKRGKYGELQDASANPFND 1314
            QRGFAFSQ+E GGQ+K++RMYDTT KRG++GELQDASANPF D
Sbjct: 1271 QRGFAFSQSETGGQDKVMRMYDTTLKRGEHGELQDASANPFRD 1313

>KLLA0A04015g complement(355624..359655) similar to sp|P39524
            Saccharomyces cerevisiae YAL026c DRS2 P-type
            amino-phospholipids-ATPase, start by similarity
          Length = 1343

 Score = 1865 bits (4832), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 901/1271 (70%), Positives = 1038/1271 (81%), Gaps = 22/1271 (1%)

Query: 73   HENLFMSNN--HDDQTSWNANRFDSDAYQPQSLRAVKP-PGLFARFGNGLKNAFTFK--R 127
             E + +S+N  +D +  +N +R+ +         +V P P  F RF + +K+A       
Sbjct: 78   QETIDLSDNIENDIENPFN-DRYSASFADTNPRNSVLPQPSGFNRFMSNVKSAVGMNGGH 136

Query: 128  KKGPESFEMNHYNAVTNNELDDNYLDSRNKFNIKILFNRYILRKNVGDAEGNGEPRVIHI 187
            K   +SFEMN Y+    N     Y  S  KF+IK+LFNRYILRK     + + EPR I +
Sbjct: 137  KGQFQSFEMNDYDQSNTNR----YESSTRKFDIKVLFNRYILRKGKTSCKSD-EPRTILL 191

Query: 188  NDSLANSSFGYSDNHISTTKYNFATFLPKFLFQEFSKYANLFFLCTSAIQQVPHVSPTNR 247
            NDS ANS FGY DNHISTTKYN ATFLPKFLFQEFSKYANLFFL TS IQQVP+V+PTNR
Sbjct: 192  NDSSANSRFGYRDNHISTTKYNAATFLPKFLFQEFSKYANLFFLFTSIIQQVPNVTPTNR 251

Query: 248  YTTIGTLLVVLIVSAMKECIEDIKRANSDKELNNSTAEIFSEAHDDFVEKRWIDIRVGDI 307
            YTTIGTLLVVLIVSA+KE +ED+KR+N+DKELN+S  ++  E   +FV K+WIDI VGDI
Sbjct: 252  YTTIGTLLVVLIVSAVKESVEDLKRSNADKELNHSLCDVLDERSGEFVRKKWIDIAVGDI 311

Query: 308  IRVKSEEPIPADTIILSSSEPEGLCYIETANLDGETNLKIKQSRVETAKFIDVKTLKNMN 367
            IRV+SEE IPAD IILSSSEPEGLCYIETANLDGETNLKIKQ+R ETA ++D K L  ++
Sbjct: 312  IRVRSEEAIPADLIILSSSEPEGLCYIETANLDGETNLKIKQARQETANYLDEKALCKLH 371

Query: 368  GKVVSEQPNSSLYTYEGTMTLNDRQIPLSPDQMILRGATLRNTAWIFGLVIFTGHETKLL 427
            G+V SE PNSSLYTYEGTMTLN    PLSPDQM+LRGATLRNTAWIFGL++FTGHETKL+
Sbjct: 372  GRVQSEHPNSSLYTYEGTMTLNGSTFPLSPDQMLLRGATLRNTAWIFGLIVFTGHETKLM 431

Query: 428  RNATATPIKRTAVEKIINRQXXXXXXXXXXXXXXXXXXXXXMSTADAKHLSYLYLEGTNK 487
            RNATATPIKRTAVE++IN Q                     M+  D+ HL YLY+EGTNK
Sbjct: 432  RNATATPIKRTAVERVINMQILALFGVLIVLALISSTGNVIMTKRDSAHLGYLYIEGTNK 491

Query: 488  AGLFFKDFLTFWILFSNLVPISLFVTVELIKYYQAFMIGSDLDLYYEKTDTPTVVRTSSL 547
            AGLFFKD LTFWILFSNLVPISLFVTVE+IKYYQA+MIGSDLDLY+E++DTPTVVRTSSL
Sbjct: 492  AGLFFKDILTFWILFSNLVPISLFVTVEMIKYYQAYMIGSDLDLYHEESDTPTVVRTSSL 551

Query: 548  VEELGQIEYIFSDKTGTLTRNIMEFKSCSIAGHCYIDKIPEDKTATVEDGIEVGYRKFDD 607
            VEELGQIEYIFSDKTGTLTRN+MEFKS SIAG CYI+ IPED+ ATVEDGIE+G+  F+ 
Sbjct: 552  VEELGQIEYIFSDKTGTLTRNVMEFKSVSIAGRCYIETIPEDRRATVEDGIEIGFHSFES 611

Query: 608  LKKKLNDPSDEDSPIINDFLTLLATCHTVIPEFQSDGSIKYQAASPDEGALVQGGADLGY 667
            LK K+ DP D+++ I+ +FLTLLATCHTVIPE QSDG+IKYQAASPDEGALVQG ADLG+
Sbjct: 612  LKDKMTDPEDDEAGIVIEFLTLLATCHTVIPETQSDGTIKYQAASPDEGALVQGAADLGF 671

Query: 668  KFIIRKGNSVTVLLEETGEEKEYQLLNICEFNSTRKRMSAIFRFPDGSIKLFCKGADTVI 727
            +F IR+ NSV++    + E+ EYQLLNICEFNSTRKRMSAIFR PDGSIKLFCKGADTVI
Sbjct: 672  RFDIRRPNSVSISTPFS-EQLEYQLLNICEFNSTRKRMSAIFRMPDGSIKLFCKGADTVI 730

Query: 728  LERLDDEANQYVEATMRHLEDYASEGLRTLCLAMRDISEGEYEEWNSIYNEAATTLDNRA 787
            LERLD E N YV++T+RHLEDYA+EGLRTLC+A R I E EYEEW+ IY  A+TT+ +R 
Sbjct: 731  LERLDSEFNPYVQSTLRHLEDYAAEGLRTLCIASRTIPEKEYEEWSKIYEAASTTMKDRT 790

Query: 788  EKLDEAANLIEKNLILIGATAIEDKLQDGVPETIHTLQEAGIKIWVLTGDRQETAINIGM 847
            E+LD AA LIE +L  +GATAIEDKLQ+GVPETIH LQEAG+K+WVLTGDRQETAINIGM
Sbjct: 791  EELDRAAELIEHDLFFLGATAIEDKLQEGVPETIHHLQEAGLKVWVLTGDRQETAINIGM 850

Query: 848  SCRLLSEDMNLLIINEETRDDTERNLLEKINALNEHQLSTHDMKSLALVIDGKSLGFALE 907
            SCRLLSEDMNLLI+NEET++DT  NL  K+NA+  HQ+S  DM SLALVIDGKSLG+ALE
Sbjct: 851  SCRLLSEDMNLLIVNEETKEDTRTNLQSKLNAIESHQISQQDMNSLALVIDGKSLGYALE 910

Query: 908  PELEDYLLTVAKLCKAVICCRVSPLQKALVVKMVKRKXXXXXXAIASGANDVSMIQAAHV 967
             +LED  LT+ KLCKAVICCRVSPLQKALVVKMVKRK      AI  GANDVSMIQAAHV
Sbjct: 911  EDLEDQFLTIGKLCKAVICCRVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHV 970

Query: 968  GVGISGMEGMQAARSADIALGQXXXXXXXXXVHGSWSYQRISVAILYSFYKNTALYMTQF 1027
            GVGISGMEGMQAARSAD A+GQ         VHGSWSYQRIS+AILYSFYKN ALYMTQF
Sbjct: 971  GVGISGMEGMQAARSADFAIGQFRFLRKLLIVHGSWSYQRISLAILYSFYKNMALYMTQF 1030

Query: 1028 WYVFANAFSGQSIMESWTMSFYNLFFTVWPPFVIGVFDQFVSSRLLERYPQLYKLGQKGQ 1087
            WYVFANAFSGQSIMESWT++FYN+FFTV PPFVIG+FDQFV+SRLL+RYPQLYKLGQKGQ
Sbjct: 1031 WYVFANAFSGQSIMESWTLTFYNVFFTVMPPFVIGIFDQFVTSRLLDRYPQLYKLGQKGQ 1090

Query: 1088 FFSVYIFWGWIINGFFHSAIVFIGTILIYRYGFALNMHGELADHWSWGVTVYTTSVIIVL 1147
            FFSV IFWGW++NGF+HSA+VFIG++L YRYG  LNM GE ADHW WGV +YTTS+IIVL
Sbjct: 1091 FFSVTIFWGWVLNGFYHSAVVFIGSVLFYRYGNCLNMGGETADHWVWGVGIYTTSIIIVL 1150

Query: 1148 GKAALVTNQWTKFTLIAIPGSLLFWLIFFPIYASIFPHANISREYYGVVKHTYGSGVFWL 1207
            GKAAL+T+QWTKFTL+AIPGSL+ WL+FFP Y+++FP  N+S+EYYG++ H YGS  FWL
Sbjct: 1151 GKAALITSQWTKFTLVAIPGSLVIWLLFFPFYSAVFPRVNVSKEYYGIIGHVYGSATFWL 1210

Query: 1208 TLIVLPIFALVRDFLWKYYKRMYEPETYHVIQEMQKYNISDSRPHVQQFQNAIRKVRQVQ 1267
              IVLP+FAL+RDF+WKYYKR Y PE+YHV+QEMQKYNISD RP ++QFQ AIRKVRQVQ
Sbjct: 1211 MCIVLPVFALLRDFVWKYYKRTYSPESYHVVQEMQKYNISDYRPRMEQFQKAIRKVRQVQ 1270

Query: 1268 RMKKQRGFAFSQAEEGGQEKIVRMYDTTQKRGKYGELQDASANPFND---------NNGL 1318
            RMKKQRGFAFSQ+EEGGQ++I+RMYDTT KRG +GEL DAS NPFND         N GL
Sbjct: 1271 RMKKQRGFAFSQSEEGGQDRIIRMYDTTLKRGVHGELADASLNPFNDTPAQVEPSSNVGL 1330

Query: 1319 GSNDFESAEPF 1329
                FES  PF
Sbjct: 1331 -RQSFESTNPF 1340

>ADR350W [2091] [Homologous to ScYAL026C (DRS2) - SH]
            complement(1320732..1324667) [3936 bp, 1311 aa]
          Length = 1311

 Score = 1738 bits (4500), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 842/1242 (67%), Positives = 986/1242 (79%), Gaps = 12/1242 (0%)

Query: 82   HDD--QTSWNANRFDSDAYQPQSLRA-----VKPPGLFARFGNGLKNAFTFKRKKGPE-- 132
            HDD  +     N FD +  Q + L +     V  P  + R   GL+++   +  +  +  
Sbjct: 72   HDDSIENDLIENPFDDERGQQRYLASANRLSVPQPSGWQRLVGGLRDSVGGRGTENSQYQ 131

Query: 133  SFEMNHYNAVTNNELDDNYLDSRNKFNIKILFNRYILRKNVGDAEGNGEPRVIHINDSLA 192
            SFEM  Y    +    D Y  SRNKFN+K LF+ Y+LRK      G GEPRVI+IN+  A
Sbjct: 132  SFEMQDYR---DTHSGDRYQRSRNKFNLKALFDHYVLRKPAAADTGAGEPRVIYINERRA 188

Query: 193  NSSFGYSDNHISTTKYNFATFLPKFLFQEFSKYANLFFLCTSAIQQVPHVSPTNRYTTIG 252
            N + GY DNHISTTKYN ATFLPKFLFQEFSKYANLFFL TS IQQVP+V+PTNR+TTIG
Sbjct: 189  NGAMGYGDNHISTTKYNAATFLPKFLFQEFSKYANLFFLFTSIIQQVPNVTPTNRFTTIG 248

Query: 253  TLLVVLIVSAMKECIEDIKRANSDKELNNSTAEIFSEAHDDFVEKRWIDIRVGDIIRVKS 312
            TL+VVL+VSA+KE +ED+KR+NSDKELN+S A+++S+    F+ K+WIDI VGDIIRV+S
Sbjct: 249  TLIVVLVVSAIKESVEDLKRSNSDKELNHSRADVYSDEMGQFISKKWIDIAVGDIIRVRS 308

Query: 313  EEPIPADTIILSSSEPEGLCYIETANLDGETNLKIKQSRVETAKFIDVKTLKNMNGKVVS 372
            EE IPAD I+LSSSEPEGLCYIETANLDGETNLKIKQ+R ET+K +DV+ L  M GK++S
Sbjct: 309  EEAIPADLIVLSSSEPEGLCYIETANLDGETNLKIKQARPETSKILDVRELSAMRGKILS 368

Query: 373  EQPNSSLYTYEGTMTLNDRQIPLSPDQMILRGATLRNTAWIFGLVIFTGHETKLLRNATA 432
            EQPN+SLYTYEGTM L++ +IPLSPDQ++LRGATLRNT WIFG+VIFTGHETKL RNATA
Sbjct: 369  EQPNTSLYTYEGTMILHNNRIPLSPDQILLRGATLRNTVWIFGIVIFTGHETKLTRNATA 428

Query: 433  TPIKRTAVEKIINRQXXXXXXXXXXXXXXXXXXXXXMSTADAKHLSYLYLEGTNKAGLFF 492
            TPIKRTAVE++IN Q                     +     ++LSYLYL+GTN   LFF
Sbjct: 429  TPIKRTAVERVINLQIVALFGVLICLSLISSFGNLIVMYNQKENLSYLYLQGTNMVALFF 488

Query: 493  KDFLTFWILFSNLVPISLFVTVELIKYYQAFMIGSDLDLYYEKTDTPTVVRTSSLVEELG 552
            K+ LTFWILFSNLVPISLFVTVE+IKYYQA+MI SDLDL++E+++ PTVVRTSSLVEELG
Sbjct: 489  KNILTFWILFSNLVPISLFVTVEMIKYYQAYMIASDLDLFHEESNMPTVVRTSSLVEELG 548

Query: 553  QIEYIFSDKTGTLTRNIMEFKSCSIAGHCYIDKIPEDKTATVEDGIEVGYRKFDDLKKKL 612
            QIEYIFSDKTGTLT+N+MEFKSCSIAG CYI  IPEDK A  ++GIEVGYR +DD+ + L
Sbjct: 549  QIEYIFSDKTGTLTQNVMEFKSCSIAGRCYIQSIPEDKDAAFDEGIEVGYRTYDDMHELL 608

Query: 613  NDPSDEDSPIINDFLTLLATCHTVIPEFQSDGSIKYQAASPDEGALVQGGADLGYKFIIR 672
            + P   D  II++FLTLL+ CHTVIPEFQ +GSIKYQAASPDEGALVQG ADLGYKFIIR
Sbjct: 609  HTPGSGDGAIIDEFLTLLSICHTVIPEFQENGSIKYQAASPDEGALVQGAADLGYKFIIR 668

Query: 673  KGNSVTVLLEETGEEKEYQLLNICEFNSTRKRMSAIFRFPDGSIKLFCKGADTVILERLD 732
            K NSVT+L E+  EE  Y+LLNICEFNSTRKRMSAIFRFPD SI+L CKGADTVILERL 
Sbjct: 669  KPNSVTILREDITEEVVYELLNICEFNSTRKRMSAIFRFPDNSIRLLCKGADTVILERLA 728

Query: 733  DEANQYVEATMRHLEDYASEGLRTLCLAMRDISEGEYEEWNSIYNEAATTLDNRAEKLDE 792
              +N YV AT+RHLEDYA+EGLRTLC+A R I E EYEEW+ +Y+ AATT+ NR+E+LD+
Sbjct: 729  ATSNPYVAATLRHLEDYAAEGLRTLCIASRTIPESEYEEWSKLYDAAATTMHNRSEELDK 788

Query: 793  AANLIEKNLILIGATAIEDKLQDGVPETIHTLQEAGIKIWVLTGDRQETAINIGMSCRLL 852
             A +IEK L+L+GATAIEDKLQDGVPETIHTLQ+AGIK+WVLTGDRQETAINIGMSC+LL
Sbjct: 789  VAEMIEKGLVLLGATAIEDKLQDGVPETIHTLQQAGIKVWVLTGDRQETAINIGMSCKLL 848

Query: 853  SEDMNLLIINEETRDDTERNLLEKINALNEHQLSTHDMKSLALVIDGKSLGFALEPELED 912
            SEDMNLLI+NE+T++ T  NL++K+ A+N+HQ+S  DM +LALVIDGKSLGFALEP+LE+
Sbjct: 849  SEDMNLLIVNEDTKESTRNNLIDKLRAINDHQISQQDMNTLALVIDGKSLGFALEPDLEE 908

Query: 913  YLLTVAKLCKAVICCRVSPLQKALVVKMVKRKXXXXXXAIASGANDVSMIQAAHVGVGIS 972
            +LL + K+C+AVICCRVSPLQKALVVKMVKR+      AI  GANDVSMIQAAHVGVGIS
Sbjct: 909  FLLAIGKMCRAVICCRVSPLQKALVVKMVKRRTKSLLLAIGDGANDVSMIQAAHVGVGIS 968

Query: 973  GMEGMQAARSADIALGQXXXXXXXXXVHGSWSYQRISVAILYSFYKNTALYMTQFWYVFA 1032
            GMEGMQAARSAD ALGQ         VHGSWSYQRIS AILYSFYKN ALYMTQFWYV  
Sbjct: 969  GMEGMQAARSADFALGQFKYLKKLLLVHGSWSYQRISQAILYSFYKNIALYMTQFWYVLY 1028

Query: 1033 NAFSGQSIMESWTMSFYNLFFTVWPPFVIGVFDQFVSSRLLERYPQLYKLGQKGQFFSVY 1092
            NAFSGQSIMESWT++FYN   T  PP      DQF  S LL R  Q   +GQKGQF+   
Sbjct: 1029 NAFSGQSIMESWTLTFYNWGGTAAPPGPPKRRDQFERSGLLNRDAQSCTVGQKGQFWPAT 1088

Query: 1093 IFWGWIINGFFHSAIVFIGTILIYRYGFALNMHGELADHWSWGVTVYTTSVIIVLGKAAL 1152
            IF G  ING +H+ I   G I+ YRYG A  MHGE ADHW WGV +  TS+I VLGKAAL
Sbjct: 1089 IFRGSAINGNYHNWITIDGWIMDYRYGAAGAMHGETADHWVWGVAIQPTSIIFVLGKAAL 1148

Query: 1153 VTNQWTKFTLIAIPGSLLFWLIFFPIYASIFPHANISREYYGVVKHTYGSGVFWLTLIVL 1212
            +TNQWTKFT++AIPGSL+FWL+FFPIYA + P  N+S+EYYG+V H YGS  FW    VL
Sbjct: 1149 ITNQWTKFTVLAIPGSLVFWLLFFPIYAYLLPGLNVSKEYYGIVSHVYGSFTFWAMCYVL 1208

Query: 1213 PIFALVRDFLWKYYKRMYEPETYHVIQEMQKYNISDSRPHVQQFQNAIRKVRQVQRMKKQ 1272
            P+ AL+RD LWKYYKR Y PE+YHV+QEMQKY+ISD+RP ++QFQ AIRKVRQVQRMKKQ
Sbjct: 1209 PVLALLRDLLWKYYKRTYTPESYHVVQEMQKYDISDNRPRIEQFQKAIRKVRQVQRMKKQ 1268

Query: 1273 RGFAFSQAEEGGQEKIVRMYDTTQKRGKYGELQDASANPFND 1314
            RGFAFSQ+EE GQ++IVRMYDTTQKRG +GELQD S NPF D
Sbjct: 1269 RGFAFSQSEEAGQDRIVRMYDTTQKRGTHGELQDPSMNPFKD 1310

>Scas_505.4
          Length = 1025

 Score =  795 bits (2054), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/449 (80%), Positives = 408/449 (90%), Gaps = 2/449 (0%)

Query: 869  TERNLLEKINALNEHQLSTHDMKSLALVIDGKSLGFALEPELEDYLLTVAKLCKAVICCR 928
            T +N+ +KI AL EH+LS H+M +LALVIDGKSL +ALE +LEDYLL + K+CKAV+CCR
Sbjct: 534  TRKNMRDKIMALKEHKLSQHEMNTLALVIDGKSLSYALESDLEDYLLALGKICKAVVCCR 593

Query: 929  VSPLQKALVVKMVKRKXXXXXXAIASGANDVSMIQAAHVGVGISGMEGMQAARSADIALG 988
            VSPLQKALVVKMVKRK      AI  GANDVSMIQAAHVGVGISGMEGMQAARSADIA+G
Sbjct: 594  VSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADIAVG 653

Query: 989  QXXXXXXXXXVHGSWSYQRISVAILYSFYKNTALYMTQFWYVFANAFSGQSIMESWTMSF 1048
            Q         VHGSWSYQRISVAILYSFYKNTALYMTQFW+VFANAFSGQSIMESWTMS+
Sbjct: 654  QFRFLKKLLLVHGSWSYQRISVAILYSFYKNTALYMTQFWFVFANAFSGQSIMESWTMSY 713

Query: 1049 YNLFFTVWPPFVIGVFDQFVSSRLLERYPQLYKLGQKGQFFSVYIFWGWIINGFFHSAIV 1108
            YN+FFTV+PPFVIGVFDQFVSSRLLERYPQLYKLGQ+G+FFSV IFWGWI+NGF+HSA+V
Sbjct: 714  YNVFFTVFPPFVIGVFDQFVSSRLLERYPQLYKLGQQGKFFSVRIFWGWIVNGFYHSAVV 773

Query: 1109 FIGTILIYRYGFALNMHGELADHWSWGVTVYTTSVIIVLGKAALVTNQWTKFTLIAIPGS 1168
            +IGT+L YRYG ALNMHGE+ADHWSWG+ VYT+S++IVLGKAALVTNQWTKFTL AIPGS
Sbjct: 774  YIGTMLFYRYGMALNMHGEVADHWSWGIAVYTSSILIVLGKAALVTNQWTKFTLFAIPGS 833

Query: 1169 LLFWLIFFPIYASIFPHANISREYYGVVKHTYGSGVFWLTLIVLPIFALVRDFLWKYYKR 1228
             +FW+IFFPIYAS+FP+ANISREY+GVVKHTYGSG FWLTLIVLP+FAL+RDF+WKYY+R
Sbjct: 834  FIFWMIFFPIYASVFPYANISREYFGVVKHTYGSGTFWLTLIVLPVFALMRDFVWKYYRR 893

Query: 1229 MYEPETYHVIQEMQKYNISDSRPHVQQFQNAIRKVRQVQRMKKQRGFAFSQAEEGGQEKI 1288
            MYEPE+YH++QEMQK+NISD+RPHVQ FQN IRKVRQVQRMKKQRGFAFSQ+EEGGQ+KI
Sbjct: 894  MYEPESYHLVQEMQKFNISDNRPHVQHFQNEIRKVRQVQRMKKQRGFAFSQSEEGGQDKI 953

Query: 1289 VRMYDTTQKRGKYGELQDASANPFNDNNG 1317
            +RMYDTTQKRG YGEL D  ANPF++NN 
Sbjct: 954  IRMYDTTQKRGVYGELHD--ANPFSNNNA 980

 Score =  566 bits (1458), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/400 (69%), Positives = 318/400 (79%), Gaps = 2/400 (0%)

Query: 83  DDQTSWNANRFDSDAYQPQSLRAVKPPGLFARFGNGLKNAFTFKRKKGPE-SFEMNHYNA 141
           ++ T+W+ NRF+++ YQPQ     +  G FA   N +KN F F  K     S+EMN YNA
Sbjct: 122 EESTTWDTNRFETNNYQPQLYPTGQRNGFFANSFNKVKNIFVFNTKPSDSGSYEMNRYNA 181

Query: 142 VTNNELDDNYLDSRNKFNIKILFNRYILRKNVGDAEGNGEPRVIHINDSLANSSFGYSDN 201
           VTNNELD  Y DSRN+FNIKILFNRYILRKNVG A  +G PR I++ND  AN +F Y DN
Sbjct: 182 VTNNELDGRYADSRNRFNIKILFNRYILRKNVG-ASDDGTPREIYLNDRTANHAFNYGDN 240

Query: 202 HISTTKYNFATFLPKFLFQEFSKYANLFFLCTSAIQQVPHVSPTNRYTTIGTLLVVLIVS 261
           HISTTKYN ATFLPKFLFQEFSKYANLFFLCT+AIQQVPHVSPTNRYTT+GTL+VVLIVS
Sbjct: 241 HISTTKYNIATFLPKFLFQEFSKYANLFFLCTAAIQQVPHVSPTNRYTTVGTLMVVLIVS 300

Query: 262 AMKECIEDIKRANSDKELNNSTAEIFSEAHDDFVEKRWIDIRVGDIIRVKSEEPIPADTI 321
           A KE IEDIKRANSDKELNNS  EI+SE + DF+E+RWIDIR GD+IRVKSEE IPAD I
Sbjct: 301 AFKESIEDIKRANSDKELNNSKTEIYSEENGDFIERRWIDIRAGDVIRVKSEEAIPADLI 360

Query: 322 ILSSSEPEGLCYIETANLDGETNLKIKQSRVETAKFIDVKTLKNMNGKVVSEQPNSSLYT 381
           ++SSSEPEGLCYIETANLDGETNLKIKQ+R ETA+ +D + L N  GKV+SEQPNSSLYT
Sbjct: 361 VISSSEPEGLCYIETANLDGETNLKIKQARPETAEMMDSRKLNNFKGKVISEQPNSSLYT 420

Query: 382 YEGTMTLNDRQIPLSPDQMILRGATLRNTAWIFGLVIFTGHETKLLRNATATPIKRTAVE 441
           YEGT+  N+R+IPLSP+QMILRGATLRNT+W+FGLVIFTGHETKL+RNATATPIKRTAVE
Sbjct: 421 YEGTLEFNNRKIPLSPEQMILRGATLRNTSWMFGLVIFTGHETKLMRNATATPIKRTAVE 480

Query: 442 KIINRQXXXXXXXXXXXXXXXXXXXXXMSTADAKHLSYLY 481
           ++IN Q                     +S+   KHLSYLY
Sbjct: 481 RVINLQIVALFGVLIVLVLISSLGNAIISSTQEKHLSYLY 520

>AGR120C [4431] [Homologous to ScYER166W (DNF1) - SH; ScYDR093W (DNF2)
            - SH] (972456..977099) [4644 bp, 1547 aa]
          Length = 1547

 Score =  645 bits (1663), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 409/1074 (38%), Positives = 575/1074 (53%), Gaps = 111/1074 (10%)

Query: 294  FVEKRWIDIRVGDIIRVKSEEPIPADTIILSSSEPEGLCYIETANLDGETNLKIKQSRVE 353
            F +  W DIRVGDI+R+ + + IPAD I+LS+S+ +G CY+ET NLDGETNLK++QS   
Sbjct: 400  FGKSHWKDIRVGDIVRIHNNDEIPADIILLSTSDADGACYVETKNLDGETNLKVRQSLKC 459

Query: 354  TAKFIDVKTLKNMNGKVVSEQPNSSLYTYEGTMTLNDRQI------PLSPDQMILRGATL 407
            + +  + K +      V SE P+++LY+Y+G     D +       P++ + M+LRG +L
Sbjct: 460  SHRIRNSKDISRCKFWVESEGPHANLYSYQGNFKWVDSETGVMHNEPVNINNMLLRGCSL 519

Query: 408  RNTAWIFGLVIFTGHETKLLRNATATPIKRTAVEKIINRQXXXXXXXXXXXXXXXXXXXX 467
            RNT W  G+V+FTG +TK++ NA  TP KR+ + + +N                      
Sbjct: 520  RNTKWAMGIVMFTGTDTKIMLNAGVTPTKRSRISRELNYSVILNFVFLFVLCLAAGLVNG 579

Query: 468  XMSTADAKHLSYLYLEGTNKAGLFFKDFLTFW---ILFSNLVPISLFVTVELIKYYQAFM 524
                 DA   ++    GT     F    L F+   IL+ +LVPISL++++E+IK  QA  
Sbjct: 580  IYYRRDATSRTFFEF-GTVAGTPFANGILAFFVALILYQSLVPISLYISIEIIKTAQAAF 638

Query: 525  IGSDLDLYYEKTDTPTVVRTSSLVEELGQIEYIFSDKTGTLTRNIMEFKSCSIAGHCY-- 582
            I  D+ LY  K D P   RT ++ ++LGQIEYIFSDKTGTLT+N+MEFK C+I G  Y  
Sbjct: 639  IYGDVLLYNPKLDYPCTPRTWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGR 698

Query: 583  --------------ID----------KIPEDKTATVEDGIEVGYRKFDD------LKKKL 612
                          +D          +I EDK   VE  +++G     D      + K+L
Sbjct: 699  AYTEALAGLRKRQGVDIEEEGARERAEIEEDKKQMVELLLKLGKNSQLDPHTVTFVSKEL 758

Query: 613  -----NDPSDEDSPIINDFLTLLATCHTVIPEFQSDGSIKY--QAASPDEGALVQGGADL 665
                    S E    +  F+  LA CH+V+ E   +   K   +A SPDE ALV+   D+
Sbjct: 759  VQDLGGANSQEQKEAVEHFMLSLALCHSVVVEENKNNPEKLDIKAQSPDEAALVETARDM 818

Query: 666  GYKFIIRKGNSVTVLLEETGEEKEYQLLNICEFNSTRKRMSAIFRFP--DGSIK----LF 719
            G+ F+ R  N V  ++E  G +KE+++LN+ EFNSTRKRMS I + P  D + K    L 
Sbjct: 819  GFSFVGRTKNGV--IIEIQGVQKEFRILNVLEFNSTRKRMSCIVKIPAADENSKPKALLL 876

Query: 720  CKGADTVILERLDDEAN--QYVEATMRHLEDYASEGLRTLCLAMRDISEGEYEEWNSIYN 777
            CKGAD+VI  RLD   N  + +E T  HLE +A+EGLRTLC+A R+I   EY  WN    
Sbjct: 877  CKGADSVIYSRLDRSRNDPKLLERTALHLEQFATEGLRTLCVAQREIDWDEYLNWNERRE 936

Query: 778  EAATTLDNRAEKLDEAANLIEKNLILIGATAIEDKLQDGVPETIHTLQEAGIKIWVLTGD 837
             AA +LDNR E L+  A+ IE+ L+L+G TAIED+LQDGVP++I  L +AGIK+WVLTGD
Sbjct: 937  LAAASLDNREEALERVADAIERQLVLLGGTAIEDRLQDGVPDSISILADAGIKLWVLTGD 996

Query: 838  RQETAINIGMSCRLLSEDMNLLIINEETRDDTERNLLEK----INALNEHQLSTH-DMK- 891
            + ETAINIG SC LL  DM LL+I + + +D E +L EK    + AL +  L TH +MK 
Sbjct: 997  KVETAINIGFSCNLLGSDMELLVI-KSSGEDVE-HLGEKDSDVVLALIDKYLETHFNMKG 1054

Query: 892  -----------------SLALVIDGKSLGFALEPE-LEDYLLTVAKLCKAVICCRVSPLQ 933
                             +  +VIDG +L  AL  E +    L + K CKAV+CCRVSP Q
Sbjct: 1055 SPEELAAARKDHTPPQSAFGVVIDGDALKLALHGEDIRRKFLLLCKNCKAVLCCRVSPSQ 1114

Query: 934  KALVVKMVKRKXXXXXXAIASGANDVSMIQAAHVGVGISGMEGMQAARSADIALGQXXXX 993
            KA VVK+VK        AI  G+NDV+MIQAA VG+GI+G EG QA  SAD A+GQ    
Sbjct: 1115 KAAVVKLVKESLDVVTLAIGDGSNDVAMIQAADVGIGIAGEEGRQAVMSADYAIGQFRYL 1174

Query: 994  XXXXXVHGSWSYQRISVAILYSFYKNTALYMTQFWYVFANAFSGQSIMESWTMSFYNLFF 1053
                 VHG WSY+R++  I   FYKN    +  FW+   + + G  + E   + FYNL F
Sbjct: 1175 TRLVLVHGRWSYKRLAEMIPQFFYKNITFTLALFWFGICSNYDGSYLFEYTYLMFYNLAF 1234

Query: 1054 TVWPPFVIGVFDQFVSSRLLERYPQLYKLGQKGQFFSVYIFWGWIINGFFHSAIVFIGTI 1113
            T  P   +G+ DQ  S  L    PQLYK+G     ++   FW +  +G + S I F    
Sbjct: 1235 TSLPVIFLGIMDQDASDVLSVVVPQLYKVGILRTEWTQNKFWWYCFDGVYQSIICFFFPY 1294

Query: 1114 LI-YRYGFALNMHGELADHWSWGVTVYTTSVIIVLGKAALVTNQ--WTKFTLIAI---PG 1167
            L  YR G        L   +++G  V+ TS+ +V     ++ +Q  W  FT + I    G
Sbjct: 1295 LCYYRTGLITKNAYGLDHRYTFG--VFVTSIAVVSCNLYVLIHQYRWDWFTTLFIFLSCG 1352

Query: 1168 SLLFWLIFFPIYASIFPHANISREYYGVVKHTYGSGVFWLTLIVLPIFALVRDFLWKYYK 1227
             L FW         ++  A  S E+Y      Y   VFW  L V  IF L+  F W   +
Sbjct: 1353 ILFFW-------TGVWSSATYSGEFYKTAVRLYAQPVFWAVLFVGVIFCLLPRFTWDAVQ 1405

Query: 1228 RMYEPETYHVIQEM----------QKYNISD-SRPHVQQFQNAIRKVRQVQRMK 1270
            +++ P    +++E           + Y+ +D +RP +      + +    +R +
Sbjct: 1406 KLFFPRDIDIVRECWWRGDFDMYPEDYDPTDPNRPRINVSHTGVDRASDDERSR 1459

 Score = 55.5 bits (132), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 46/90 (51%)

Query: 198 YSDNHISTTKYNFATFLPKFLFQEFSKYANLFFLCTSAIQQVPHVSPTNRYTTIGTLLVV 257
           Y  N I TTKY   +FLPK L  +F   AN++FL    +  V     TN       L+ +
Sbjct: 203 YPRNKIRTTKYTPLSFLPKNLAYQFKNAANIYFLLLVCLSFVSIFGVTNPALAAIPLIAI 262

Query: 258 LIVSAMKECIEDIKRANSDKELNNSTAEIF 287
           ++++ +K+  ED +R   D E+NN  + I 
Sbjct: 263 VVITGLKDAFEDSRRTILDLEVNNMRSHIL 292

>CAGL0G08085g 763185..767921 highly similar to sp|Q12675 Saccharomyces
            cerevisiae YDR093w, hypothetical start
          Length = 1578

 Score =  644 bits (1661), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/1040 (37%), Positives = 573/1040 (55%), Gaps = 91/1040 (8%)

Query: 294  FVEKRWIDIRVGDIIRVKSEEPIPADTIILSSSEPEGLCYIETANLDGETNLKIKQSRVE 353
            F +  W +++VGDI+R+ + E IPAD I+LS+S+ +G CY+ET NLDGETNLK++QS   
Sbjct: 400  FSKDYWKNVKVGDIVRIHNNEEIPADIILLSTSDSDGACYVETKNLDGETNLKVRQSMKC 459

Query: 354  TAKFIDVKTLKNMNGKVVSEQPNSSLYTYEGTM---TLNDRQI---PLSPDQMILRGATL 407
            T+       +      + SE P+++LY+Y+G     +L D Q+   P++ + ++LRG TL
Sbjct: 460  TSDIRSSIDIARTRFWIESEGPHANLYSYQGNFRWNSLEDNQLKNEPVNINNLLLRGCTL 519

Query: 408  RNTAWIFGLVIFTGHETKLLRNATATPIKRTAVEKIINRQXXXXXXXXXXXXXXXXXXXX 467
            RNT W  G+V FTG +TK++ NA  TP K++ + K +N                      
Sbjct: 520  RNTKWAMGVVAFTGDDTKIMLNAGVTPTKKSRISKELNLSVLFNFALLFVLCFIAGLYNG 579

Query: 468  XMSTADAKHLSYLYLEGTNKAGLFFKDFLTFW---ILFSNLVPISLFVTVELIKYYQAFM 524
                   +   +    GT   G     F++FW   IL+ +LVPISL+++VE+IK  QA  
Sbjct: 580  IYHNKHPRSRDFFDF-GTGTGGSATSGFVSFWVAVILYQSLVPISLYISVEIIKTAQAIF 638

Query: 525  IGSDLDLYYEKTDTPTVVRTSSLVEELGQIEYIFSDKTGTLTRNIMEFKSCSIAGHCY-- 582
            I  D+ +Y EK D P   ++ ++ ++LGQIEYIFSDKTGTLT+N+MEFK C+I G  Y  
Sbjct: 639  IYLDVMMYNEKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGR 698

Query: 583  --------------IDKIPEDKTATVEDGI----EVGYRKFDDLKKKLNDPSDE----DS 620
                          +D   E K    ++GI    E    K  +L K      DE      
Sbjct: 699  AYTEALAGLRKRQGVDVAHESKIE--KEGIKRDREEMINKLQNLAKNSQFYEDEVTFVSK 756

Query: 621  PIIND---------------FLTLLATCHTVI--PEFQSDGSIKYQAASPDEGALVQGGA 663
              ++D               F+  LA CH+V+  P  +    ++ +A SPDE ALV    
Sbjct: 757  EFVDDLTGGSGSVQQKSCQHFMLALALCHSVLTEPSKEDPAKLEIKAQSPDEAALVTTAR 816

Query: 664  DLGYKFIIRKGNSVTVLLEETGEEKEYQLLNICEFNSTRKRMSAIFRFP----DGSIK-- 717
            D+G+ F+  K     ++LE  G EKE+Q+LNI EFNS+RKRMS I + P    +G  K  
Sbjct: 817  DMGFSFL--KKTKEGMVLEVQGIEKEFQILNILEFNSSRKRMSCIVKIPGDDANGKPKAL 874

Query: 718  LFCKGADTVILERLDDEA---NQYVEATMRHLEDYASEGLRTLCLAMRDISEGEYEEWNS 774
            L CKGAD+VI  RLD         +E T  HLE YA+EGLRTLCLA R++S  EYE WN 
Sbjct: 875  LICKGADSVIYSRLDKTGLNEESLLEKTALHLEQYATEGLRTLCLAQRELSWEEYERWNK 934

Query: 775  IYNEAATTLDNRAEKLDEAANLIEKNLILIGATAIEDKLQDGVPETIHTLQEAGIKIWVL 834
             Y+ AA  + +R E+L++ ++ IE++LIL+G TAIED+LQDGVP++I  L EAGIK+WVL
Sbjct: 935  KYDIAAAAVVDREEELEKVSDEIERHLILLGGTAIEDRLQDGVPDSIALLGEAGIKLWVL 994

Query: 835  TGDRQETAINIGMSCRLLSEDMNLLIINEETRD-----DTERNLLEKI----------NA 879
            TGD+ ETAINIG SC LL+ DM LL+I     D      T +++++ +           A
Sbjct: 995  TGDKVETAINIGFSCNLLNNDMELLVIKTTGPDVEDLGATPKDIVDTLISQYLHDKFGMA 1054

Query: 880  LNEHQL----STHDMK--SLALVIDGKSLGFALEPE-LEDYLLTVAKLCKAVICCRVSPL 932
             +E +L    + HD+     A++IDG++L +AL  E ++   L + K CK+V+CCRVSP 
Sbjct: 1055 GSEEELKKAKAEHDIPRGEFAVIIDGEALKYALSTEDMKRKFLLLCKNCKSVLCCRVSPA 1114

Query: 933  QKALVVKMVKRKXXXXXXAIASGANDVSMIQAAHVGVGISGMEGMQAARSADIALGQXXX 992
            QKA VVK+VK        AI  G+NDV+MIQ+A++GVGI+G EG QA  S+D A+GQ   
Sbjct: 1115 QKAAVVKLVKNTLDVMTLAIGDGSNDVAMIQSANIGVGIAGEEGRQAVMSSDYAIGQFRY 1174

Query: 993  XXXXXXVHGSWSYQRISVAILYSFYKNTALYMTQFWYVFANAFSGQSIMESWTMSFYNLF 1052
                  VHG W Y+R++  I   FYKN    +  FW+   N + G  + E   ++FYNL 
Sbjct: 1175 LTRLLLVHGKWCYKRLAEMIPQFFYKNMIFTLALFWFGIYNDYDGSYLFEYTYLTFYNLA 1234

Query: 1053 FTVWPPFVIGVFDQFVSSRLLERYPQLYKLGQKGQFFSVYIFWGWIINGFFHSAIVFIGT 1112
            FT  P  ++G+FDQ VS  +   +PQLY++G   + +S   F  ++++G + S I F   
Sbjct: 1235 FTSIPVILLGIFDQDVSDTISLVFPQLYRVGILRKEWSQTKFLWYMLDGLYQSVIAFFFP 1294

Query: 1113 ILIYRYGFALNMHGELADHWSW-GVTVYTTSVIIVLGKAALVTNQWTKFTLIAIPGSLLF 1171
             L+YR    +  +G   DH  + GV V   + I       +    W  F    +  S+  
Sbjct: 1295 YLLYRRHMIVTSNGLGLDHRYYVGVPVTAIACISCNLYILIQQKHWDVFCSFFVGVSI-- 1352

Query: 1172 WLIFFPIYASIFPHANISREYYGVVKHTYGSGVFWLTLIVLPIFALVRDFLWKYYKRMYE 1231
             +IFF  +  I+  A+ S E+Y      +G+  FW  L V  +F L+  F    +KR + 
Sbjct: 1353 -MIFF-TWTGIWSSASRSNEFYHGAARVFGTPTFWAVLFVGIMFCLLPRFTLDVFKRYFY 1410

Query: 1232 PETYHVIQEMQKYNISDSRP 1251
            P+   +I+EM      DS P
Sbjct: 1411 PKDIDIIREMWSRGDFDSFP 1430

 Score = 49.3 bits (116), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 36/101 (35%), Positives = 55/101 (54%), Gaps = 4/101 (3%)

Query: 188 NDSLANSSFGYSDNHISTTKYNFATFLPKFLFQEFSKYANLFFLCTSAIQQVPHVSPTNR 247
           N  LAN    Y  N I TTKY   TFLPK +  +F  +AN++FL    +        TN 
Sbjct: 190 NKPLAN----YPRNKIRTTKYTPLTFLPKNILLQFHNFANIYFLILIILGAFQIFGVTNP 245

Query: 248 YTTIGTLLVVLIVSAMKECIEDIKRANSDKELNNSTAEIFS 288
             +   L+V++I++A+K+ IED +R   D E+NN+   + +
Sbjct: 246 GFSAVPLIVIIIITAIKDGIEDSRRTVLDLEVNNTKTHVLT 286

>YDR093W (DNF2) [945] chr4 (631276..636114) Member of the haloacid
            dehalogenase or epoxide hydrolase family, has low
            similarity to familial intrahepatic cholestasis 1 (human
            ATP8B1), which is an aminophospholipid ATPase transporter
            associated with familial intrahepatic cholestasis [4839
            bp, 1612 aa]
          Length = 1612

 Score =  632 bits (1629), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/1094 (36%), Positives = 577/1094 (52%), Gaps = 117/1094 (10%)

Query: 263  MKECIEDIKRANSDKELNNSTAEIFSEAHDDFVEKRWIDIRVGDIIRVKSEEPIPADTII 322
            + + +    R N  + L + T +   E    F +  W +++VGDI+RV + + IPAD I+
Sbjct: 409  LNQTMSQANRYNDGENLVDRTLQPNPECR--FAKDYWKNVKVGDIVRVHNNDEIPADMIL 466

Query: 323  LSSSEPEGLCYIETANLDGETNLKIKQSRVETAKFI-DVKTLKNMNGKVVSEQPNSSLYT 381
            LS+S+ +G CY+ET NLDGETNLK++QS ++ +K I   + +      V SE P+++LY+
Sbjct: 467  LSTSDVDGACYVETKNLDGETNLKVRQS-LKCSKIIKSSRDITRTKFWVESEGPHANLYS 525

Query: 382  YEGTMTLND------RQIPLSPDQMILRGATLRNTAWIFGLVIFTGHETKLLRNATATPI 435
            Y+G     D      R  P++ + ++LRG TLRNT W  G+VIFTG +TK++ NA  TP 
Sbjct: 526  YQGNFKWQDTQNGNIRNEPVNINNLLLRGCTLRNTKWAMGMVIFTGDDTKIMINAGVTPT 585

Query: 436  KRTAVEKIINRQXXXXXXXXXXXXXXXXXXXXXMSTADAKHLSYLYLEGTNKAGLFFKDF 495
            K++ + + +N                             +   Y    GT         F
Sbjct: 586  KKSRISRELNFSVILNFVLLFILCFTAGIVNGVYYKQKPRSRDYFEF-GTIGGSASTNGF 644

Query: 496  LTFW---ILFSNLVPISLFVTVELIKYYQAFMIGSDLDLYYEKTDTPTVVRTSSLVEELG 552
            ++FW   IL+ +LVPISL+++VE+IK  QA  I +D+ LY  K D P   ++ ++ ++LG
Sbjct: 645  VSFWVAVILYQSLVPISLYISVEIIKTAQAIFIYTDVLLYNAKLDYPCTPKSWNISDDLG 704

Query: 553  QIEYIFSDKTGTLTRNIMEFKSCSIAGHCY--------------------------IDKI 586
            QIEYIFSDKTGTLT+N+MEFK C+I G  Y                           ++I
Sbjct: 705  QIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQGVDVESEGRREKEEI 764

Query: 587  PEDKTATV--------------EDGIEVGYRKFDDLKKKLNDPSDEDSPIINDFLTLLAT 632
             +D+   +              ED   V     +DLK       D        FL  LA 
Sbjct: 765  AKDRETMIDELRSMSDNTQFCPEDLTFVSKEIVEDLK---GSSGDHQQKCCEHFLLALAL 821

Query: 633  CHTVIPEFQSDGSIKY--QAASPDEGALVQGGADLGYKFIIRKGNSVTVLLEE-TGEEKE 689
            CH+V+ E   D   K   +A SPDE ALV     LGY F+   G+S + L+ E  G +KE
Sbjct: 822  CHSVLVEPNKDDPKKLDIKAQSPDESALVSTARQLGYSFV---GSSKSGLIVEIQGVQKE 878

Query: 690  YQLLNICEFNSTRKRMSAIFRFPDGSIK------LFCKGADTVILERLDDEANQ--YVEA 741
            +Q+LN+ EFNS+RKRMS I + P  + K      L CKGAD+VI  RLD   N    +E 
Sbjct: 879  FQVLNVLEFNSSRKRMSCIIKIPGSTPKDEPKALLICKGADSVIYSRLDRTQNDATLLEK 938

Query: 742  TMRHLEDYASEGLRTLCLAMRDISEGEYEEWNSIYNEAATTLDNRAEKLDEAANLIEKNL 801
            T  HLE+YA+EGLRTLCLA R+++  EYE W   Y+ AA ++ NR E+LD+  ++IE+ L
Sbjct: 939  TALHLEEYATEGLRTLCLAQRELTWSEYERWVKTYDVAAASVTNREEELDKVTDVIEREL 998

Query: 802  ILIGATAIEDKLQDGVPETIHTLQEAGIKIWVLTGDRQETAINIGMSCRLLSEDMNLLII 861
            IL+G TAIED+LQDGVP++I  L EAGIK+WVLTGD+ ETAINIG SC +L+ DM LL++
Sbjct: 999  ILLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCNVLNNDMELLVV 1058

Query: 862  NEETRDDTE---------RNLLEKI---------------NALNEHQLSTHDMKSLALVI 897
                 D  E          NL+ K                 A  EH L   +    A++I
Sbjct: 1059 KASGEDVEEFGSDPIQVVNNLVTKYLREKFGMSGSEEELKEAKREHGLPQGN---FAVII 1115

Query: 898  DGKSLGFALE-PELEDYLLTVAKLCKAVICCRVSPLQKALVVKMVKRKXXXXXXAIASGA 956
            DG +L  AL   E+    L + K CKAV+CCRVSP QKA VVK+VK+       AI  G+
Sbjct: 1116 DGDALKVALNGEEMRRKFLLLCKNCKAVLCCRVSPAQKAAVVKLVKKTLDVMTLAIGDGS 1175

Query: 957  NDVSMIQAAHVGVGISGMEGMQAARSADIALGQXXXXXXXXXVHGSWSYQRISVAILYSF 1016
            NDV+MIQ+A VGVGI+G EG QA   +D A+GQ         VHG W Y+R++  I   F
Sbjct: 1176 NDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFRYVTRLVLVHGKWCYKRLAEMIPQFF 1235

Query: 1017 YKNTALYMTQFWYVFANAFSGQSIMESWTMSFYNLFFTVWPPFVIGVFDQFVSSRLLERY 1076
            YKN    ++ FWY   N F G  + E   ++FYNL FT  P  ++ V DQ VS  +    
Sbjct: 1236 YKNVIFTLSLFWYGIYNNFDGSYLFEYTYLTFYNLAFTSVPVILLAVLDQDVSDTVSMLV 1295

Query: 1077 PQLYKLGQKGQFFSVYIFWGWIINGFFHSAIVFIGTILIYRYGFALNMHGELADHWSWGV 1136
            PQLY++G   + ++   F  ++++G + S I F    L Y     +  +G   DH  + V
Sbjct: 1296 PQLYRVGILRKEWNQTKFLWYMLDGVYQSVICFFFPYLAYHKNMVVTENGLGLDH-RYFV 1354

Query: 1137 TVYTTSVIIVLGKAALVTNQ--WTKFTLIAIPGSLLFWLIFFPIYASIFPHANISREYYG 1194
             V+ T++ +      +   Q  W  F  + I  SL    +F+  +  I+  ++ S E+Y 
Sbjct: 1355 GVFVTAIAVTSCNFYVFMEQYRWDWFCGLFICLSL---AVFYG-WTGIWTSSSSSNEFYK 1410

Query: 1195 VVKHTYGSGVFWLTLIVLPIFALVRDFLWKYYKRMYEPETYHVIQEM----------QKY 1244
                 +    +W  L V  +F L+  F     ++++ P+   +++EM          Q Y
Sbjct: 1411 GAARVFAQPAYWAVLFVGVLFCLLPRFTIDCIRKIFYPKDIEIVREMWLRGDFDLYPQGY 1470

Query: 1245 NISD-SRPHVQQFQ 1257
            + +D SRP + + +
Sbjct: 1471 DPTDPSRPRINEIR 1484

 Score = 58.5 bits (140), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 34/98 (34%), Positives = 52/98 (53%)

Query: 198 YSDNHISTTKYNFATFLPKFLFQEFSKYANLFFLCTSAIQQVPHVSPTNRYTTIGTLLVV 257
           Y  N I TTKY   TF PK +  +F  +AN++FL    +        TN       L+V+
Sbjct: 229 YPRNKIRTTKYTPLTFFPKNILFQFHNFANIYFLILLILGAFQIFGVTNPGFASVPLIVI 288

Query: 258 LIVSAMKECIEDIKRANSDKELNNSTAEIFSEAHDDFV 295
           +I++A+K+ IED +R   D E+NN+   I S   ++ V
Sbjct: 289 VIITAIKDGIEDSRRTVLDLEVNNTRTHILSGVKNENV 326

>KLLA0C17644g 1557138..1561868 similar to sp|P32660 Saccharomyces
            cerevisiae YER166w, start by similarity
          Length = 1576

 Score =  627 bits (1616), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/1038 (36%), Positives = 559/1038 (53%), Gaps = 87/1038 (8%)

Query: 294  FVEKRWIDIRVGDIIRVKSEEPIPADTIILSSSEPEGLCYIETANLDGETNLKIKQSRVE 353
            F +  W  + VGDI+RV + + IPAD I+LSSS+ +G CY+ET NLDGETNLK++QS   
Sbjct: 438  FAKDYWKSVSVGDIVRVHNNDEIPADIILLSSSDSDGACYVETKNLDGETNLKVRQSLKC 497

Query: 354  TAKFIDVKTLKNMNGKVVSEQPNSSLYTYEGTMTLNDRQI------PLSPDQMILRGATL 407
            +    + + +     KV SE P+S+LY+Y+G +   DR+       P++ + ++LRG TL
Sbjct: 498  SHMIRNSRNITRTKFKVESEGPHSNLYSYQGNLKWVDRETGLEKNEPVNINNLLLRGCTL 557

Query: 408  RNTAWIFGLVIFTGHETKLLRNATATPIKRTAVEKIINRQXXXXXXXXXXXXXXXXXXXX 467
            RNT W  G+V+FTG +TK++ NA  TP K + + + +N                      
Sbjct: 558  RNTKWAMGIVVFTGPDTKIMLNAGVTPTKVSRISRELNLSVFMNFALLFVLCFAAGIVNG 617

Query: 468  XMSTADAKHLSYLYLEGTNKAGLFFKDFLTFW---ILFSNLVPISLFVTVELIKYYQAFM 524
                 D    +Y    G+          ++FW   IL+ ++VPISL++++E+IK  QA  
Sbjct: 618  VYYRTDNTSRNYFEF-GSIAGSAAANGVVSFWVALILYQSVVPISLYISIEIIKTAQALF 676

Query: 525  IGSDLDLYYEKTDTPTVVRTSSLVEELGQIEYIFSDKTGTLTRNIMEFKSCSIAG----H 580
            I  D+ LY E+ D P   ++ ++ ++LGQIEYIFSDKTGTLT+N+MEFK C+I G     
Sbjct: 677  IYGDVALYNERLDYPCTPKSWTISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGR 736

Query: 581  CYIDKIP----------EDKTATVEDGIEVGYRKFDDLKKKLNDPSD------------- 617
             Y + +           E++ A  ++GI           K L + S              
Sbjct: 737  AYTEALAGLRKRQGIDVEEEGALEKEGIAQDKEIMLANLKILGENSQLRPENVTFVSKEF 796

Query: 618  -EDSPIIN---------DFLTLLATCHTVIPEFQSDGS--IKYQAASPDEGALVQGGADL 665
             +D+   N         +F+  LA CHTV+ E   D    + ++A SPDE ALV    D+
Sbjct: 797  VQDTAGANGETQKKCNENFMLALALCHTVLVEENKDDPEIMDFKAQSPDEAALVGTARDM 856

Query: 666  GYKFIIRKGNSVTVLLEETGEEKEYQLLNICEFNSTRKRMSAIFRFP------DGSIKLF 719
            G+ F+ R  N V V ++  G +KEY+LLN+ EFNSTRKRMS I + P      +    L 
Sbjct: 857  GFSFVGRTKNGVIVDIQ--GVQKEYRLLNVLEFNSTRKRMSCILKIPSENPNEEPRALLI 914

Query: 720  CKGADTVILERLDDEANQ-YVEATMRHLEDYASEGLRTLCLAMRDISEGEYEEWNSIYNE 778
            CKGAD++I  RL    ++  +E T  HLE YA+EGLRTLC+A R++S  EY+EWN  +  
Sbjct: 915  CKGADSIIYSRLSKNNDEKLLEKTALHLEQYATEGLRTLCIAQRELSWKEYQEWNEKHEI 974

Query: 779  AATTLDNRAEKLDEAANLIEKNLILIGATAIEDKLQDGVPETIHTLQEAGIKIWVLTGDR 838
            AA  L +R +++++ A++IE+ L L+G TAIED+LQDGVP++I TL EAGIK+WVLTGD+
Sbjct: 975  AAAALVDREDEMEKVADVIERELTLLGGTAIEDRLQDGVPDSIATLGEAGIKLWVLTGDK 1034

Query: 839  QETAINIGMSCRLLSEDMNLLIINEETRDDTE----------RNLL-----EKINALNEH 883
             ETAINIG SC LL+ +M LL+I + + DD +          +NL+     EK      +
Sbjct: 1035 VETAINIGFSCNLLNNEMELLVI-KASGDDVDIYGSKPAEIVKNLILKYLQEKFQMSGSY 1093

Query: 884  QLSTHDMK-------SLALVIDGKSLGFALE-PELEDYLLTVAKLCKAVICCRVSPLQKA 935
            +      K       +  ++IDG +L  AL   +++   L + K CKAV+CCRVSP QKA
Sbjct: 1094 EELEEAKKVHEPPTGNFGVIIDGDALKLALRNDDVKREFLLLCKRCKAVLCCRVSPAQKA 1153

Query: 936  LVVKMVKRKXXXXXXAIASGANDVSMIQAAHVGVGISGMEGMQAARSADIALGQXXXXXX 995
             VVK+VK        AI  G+NDV+MIQ+A +GVGI+G EG QA  S+D A+GQ      
Sbjct: 1154 AVVKLVKNTLDVMTLAIGDGSNDVAMIQSADIGVGIAGEEGRQAVMSSDYAIGQFRYLTR 1213

Query: 996  XXXVHGSWSYQRISVAILYSFYKNTALYMTQFWYVFANAFSGQSIMESWTMSFYNLFFTV 1055
               VHG WSY+R++  I   FYKN    ++ FWY   N + G  + E   ++ +NL FT 
Sbjct: 1214 LVLVHGRWSYKRMAEMIPLFFYKNVIFTLSLFWYGVYNNYDGSYLFEYTYLTLFNLAFTS 1273

Query: 1056 WPPFVIGVFDQFVSSRLLERYPQLYKLGQKGQFFSVYIFWGWIINGFFHSAIVFIGTILI 1115
             P   +G+ DQ V+  +    PQLY++G     ++   FW ++ +  + S I F    L 
Sbjct: 1274 LPVIFLGILDQDVNDIVSMVVPQLYRVGILRSEWNQTKFWLYMFDAMYQSVICFFLPYLC 1333

Query: 1116 YRYGFALNMHGELADHWSW-GVTVYTTSVIIVLGKAALVTNQWTKFTLIAIPGSLLFWLI 1174
            Y     +  +G   DH  W GV V T +V+       L   +W  F+ + I  S L    
Sbjct: 1334 YYKTGIVTQNGFGLDHRYWVGVFVATIAVVSCNTYVLLHQYRWDWFSSLFIALSCLCIFA 1393

Query: 1175 FFPIYASIFPHANISREYYGVVKHTYGSGVFWLTLIVLPIFALVRDFLWKYYKRMYEPET 1234
            +  I++S       S E+Y    H YG  VFW  +    +F L+  F    + R Y P+ 
Sbjct: 1394 WTGIWSSF----TSSGEFYKSAAHIYGQPVFWAIMFAGILFCLLPRFAADTFLRTYMPKD 1449

Query: 1235 YHVIQEMQKYNISDSRPH 1252
              +I+E  K    D  P 
Sbjct: 1450 IDIIRECWKRGDFDHYPE 1467

 Score = 55.5 bits (132), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 38/145 (26%), Positives = 68/145 (46%), Gaps = 14/145 (9%)

Query: 143 TNNELDDNYLDSRNKFNIKILFNRYILRKNVGDAEGNGEPRVIHINDSLANSSFGYSDNH 202
           ++++ D+NY  S  +   + ++    L +++ D +GN              S+  Y  N 
Sbjct: 199 SDDDNDENYDKSHRQRETRTIYYNLPLPEDILDEDGN--------------STIYYPRNK 244

Query: 203 ISTTKYNFATFLPKFLFQEFSKYANLFFLCTSAIQQVPHVSPTNRYTTIGTLLVVLIVSA 262
           I TTKY   TF PK +  +F   AN++FL    +         N       L+V++++++
Sbjct: 245 IRTTKYTPLTFFPKNIAFQFKNVANVYFLVLIIMGFFQIFGVANPGLATVPLIVIVVLTS 304

Query: 263 MKECIEDIKRANSDKELNNSTAEIF 287
            K+ IED +R   D E+NN+   I 
Sbjct: 305 FKDAIEDSRRTILDMEVNNAPTHIL 329

>YER166W (DNF1) [1594] chr5 (512739..517454) Member of the haloacid
            dehalogenase or epoxide hydrolase family, has low
            similarity to S. cerevisiae Drs2p, which is a
            membrane-spanning Ca-ATPase (P-type) required for
            ribosome assembly and involved in late Golgi function
            [4716 bp, 1571 aa]
          Length = 1571

 Score =  624 bits (1608), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/1046 (37%), Positives = 563/1046 (53%), Gaps = 102/1046 (9%)

Query: 294  FVEKRWIDIRVGDIIRVKSEEPIPADTIILSSSEPEGLCYIETANLDGETNLKIKQSRVE 353
            F +  W  ++VGDI+R+ + + IPAD I+LS+S+ +G CY+ET NLDGETNLK++QS   
Sbjct: 393  FAKNYWKGVKVGDIVRIHNNDEIPADIILLSTSDTDGACYVETKNLDGETNLKVRQSLKC 452

Query: 354  TAKFIDVKTLKNMNGKVVSEQPNSSLYTYEGTM---TLNDRQI---PLSPDQMILRGATL 407
            T      K +      + SE P+S+LYTY+G M    L D +I   P++ + ++LRG TL
Sbjct: 453  TNTIRTSKDIARTKFWIESEGPHSNLYTYQGNMKWRNLADGEIRNEPITINNVLLRGCTL 512

Query: 408  RNTAWIFGLVIFTGHETKLLRNATATPIKRTAVEKIINRQXXXXXXXXXXXXXXXXXXXX 467
            RNT W  G+V+FTG +TK++ N+  TP K++ + + +N                      
Sbjct: 513  RNTKWAMGVVMFTGGDTKIMLNSGITPTKKSRISRELNFSVVINFVLLFILCFVSGIANG 572

Query: 468  XMSTADAKHLSYLYLEGTNKAGLFFKDFLTFW---ILFSNLVPISLFVTVELIKYYQAFM 524
                   +   + Y  GT         F++FW   IL+ +LVPISL+++VE+IK  QA  
Sbjct: 573  VYYDKKGRS-RFSYEFGTIAGSAATNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAAF 631

Query: 525  IGSDLDLYYEKTDTPTVVRTSSLVEELGQIEYIFSDKTGTLTRNIMEFKSCSIAGHCYID 584
            I  D+ LY  K D P   ++ ++ ++LGQ+EYIFSDKTGTLT+N+MEFK C+I G  Y  
Sbjct: 632  IYGDVLLYNAKLDYPCTPKSWNISDDLGQVEYIFSDKTGTLTQNVMEFKKCTINGVSYGR 691

Query: 585  KIPEDKTATVE-DGIEV---GYRKFDDLKKKLNDPSDE------------------DSPI 622
               E      +  GI+V   G R+  ++ K  +   DE                      
Sbjct: 692  AYTEALAGLRKRQGIDVETEGRREKAEIAKDRDTMIDELRALSGNSQFYPEEVTFVSKEF 751

Query: 623  IND---------------FLTLLATCHTVIPEFQSDGSIKY--QAASPDEGALVQGGADL 665
            + D               F+  LA CH+V+ E   D   K   +A SPDE ALV    D+
Sbjct: 752  VRDLKGASGEVQQRCCEHFMLALALCHSVLVEANPDNPKKLDLKAQSPDEAALVATARDV 811

Query: 666  GYKFI--IRKGNSVTVLLEETGEEKEYQLLNICEFNSTRKRMSAIFRFP------DGSIK 717
            G+ F+   +KG    +++E  G +KE+++LNI EFNS+RKRMS I + P      +    
Sbjct: 812  GFSFVGKTKKG----LIIEMQGIQKEFEILNILEFNSSRKRMSCIVKIPGLNPGDEPRAL 867

Query: 718  LFCKGADTVILERLDDEANQYVEA----TMRHLEDYASEGLRTLCLAMRDISEGEYEEWN 773
            L CKGAD++I  RL  ++    EA    T  HLE YA+EGLRTLC+A R++S  EYE+WN
Sbjct: 868  LICKGADSIIYSRLSRQSGSNSEAILEKTALHLEQYATEGLRTLCIAQRELSWSEYEKWN 927

Query: 774  SIYNEAATTLDNRAEKLDEAANLIEKNLILIGATAIEDKLQDGVPETIHTLQEAGIKIWV 833
              Y+ AA +L NR ++L+  A+ IE+ LIL+G TAIED+LQDGVP+ I  L EAGIK+WV
Sbjct: 928  EKYDIAAASLANREDELEVVADSIERELILLGGTAIEDRLQDGVPDCIELLAEAGIKLWV 987

Query: 834  LTGDRQETAINIGMSCRLLSEDMNLLIINEETRDDTER----------NLLEK------- 876
            LTGD+ ETAINIG SC LL+ +M LL+I + T DD +            LL K       
Sbjct: 988  LTGDKVETAINIGFSCNLLNNEMELLVI-KTTGDDVKEFGSEPSEIVDALLSKYLKEYFN 1046

Query: 877  --------INALNEHQLSTHDMKSLALVIDGKSLGFALEPE-LEDYLLTVAKLCKAVICC 927
                      A  +H+    +    A+VIDG +L  AL  E +    L + K C+AV+CC
Sbjct: 1047 LTGSEEEIFEAKKDHEFPKGNY---AIVIDGDALKLALYGEDIRRKFLLLCKNCRAVLCC 1103

Query: 928  RVSPLQKALVVKMVKRKXXXXXXAIASGANDVSMIQAAHVGVGISGMEGMQAARSADIAL 987
            RVSP QKA VVK+VK        AI  G+NDV+MIQ+A VG+GI+G EG QA   +D A+
Sbjct: 1104 RVSPSQKAAVVKLVKDSLDVMTLAIGDGSNDVAMIQSADVGIGIAGEEGRQAVMCSDYAI 1163

Query: 988  GQXXXXXXXXXVHGSWSYQRISVAILYSFYKNTALYMTQFWYVFANAFSGQSIMESWTMS 1047
            GQ         VHG WSY+R++  I   FYKN    +  FWY   N F G  + E   M 
Sbjct: 1164 GQFRYLARLVLVHGRWSYKRLAEMIPEFFYKNMIFALALFWYGIYNDFDGSYLYEYTYMM 1223

Query: 1048 FYNLFFTVWPPFVIGVFDQFVSSRLLERYPQLYKLGQKGQFFSVYIFWGWIINGFFHSAI 1107
            FYNL FT  P   +G+ DQ V+  +    PQLY++G   + ++   F  ++++G + S I
Sbjct: 1224 FYNLAFTSLPVIFLGILDQDVNDTISLVVPQLYRVGILRKEWNQRKFLWYMLDGLYQSII 1283

Query: 1108 VFIGTILIYRYGFALNMHGELADHWSWGVTVYTTSVIIVLGKAALVTNQ--WTKFTLIAI 1165
             F    L+Y     +  +G   DH  + V VY T++ ++     ++ +Q  W  F+ + I
Sbjct: 1284 CFFFPYLVYHKNMIVTSNGLGLDH-RYFVGVYVTTIAVISCNTYVLLHQYRWDWFSGLFI 1342

Query: 1166 PGSLLFWLIFFPIYASIFPHANISREYYGVVKHTYGSGVFWLTLIVLPIFALVRDFLWKY 1225
              S L    +  I++S    A  SRE++      YG+  FW    V  +F L+  F +  
Sbjct: 1343 ALSCLVVFAWTGIWSS----AIASREFFKAAARIYGAPSFWAVFFVAVLFCLLPRFTYDS 1398

Query: 1226 YKRMYEPETYHVIQEMQKYNISDSRP 1251
            +++ + P    +++EM ++   D  P
Sbjct: 1399 FQKFFYPTDVEIVREMWQHGHFDHYP 1424

 Score = 62.8 bits (151), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 48/178 (26%), Positives = 80/178 (44%), Gaps = 21/178 (11%)

Query: 118 GLKNAFTFKRKKGPESFEMNHYNAVTNNELDDNYLDSRNKFNIKILFNRYILRKNVGDAE 177
           G      + RK  P  FE       T +++D   ++   +  ++ ++    L K++ D E
Sbjct: 132 GRSKTLKWARKNIPNPFE-----DFTKDDIDPGAINRAQE--LRTVYYNMPLPKDMIDEE 184

Query: 178 GNGEPRVIHINDSLANSSFGYSDNHISTTKYNFATFLPKFLFQEFSKYANLFFLCTSAIQ 237
           GN                  Y  N I TTKY   TFLPK +  +F  +AN++FL    + 
Sbjct: 185 GN--------------PIMQYPRNKIRTTKYTPLTFLPKNILFQFHNFANVYFLVLIILG 230

Query: 238 QVPHVSPTNRYTTIGTLLVVLIVSAMKECIEDIKRANSDKELNNSTAEIFSEAHDDFV 295
                  TN   +   L+V++I++A+K+ IED +R   D E+NN+   I     ++ V
Sbjct: 231 AFQIFGVTNPGLSAVPLVVIVIITAIKDAIEDSRRTVLDLEVNNTKTHILEGVENENV 288

>Scas_636.16
          Length = 1554

 Score =  623 bits (1606), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/1063 (36%), Positives = 565/1063 (53%), Gaps = 97/1063 (9%)

Query: 270  IKRANSDKELNNSTAEIFSE-----AHDDFVEKRWIDIRVGDIIRVKSEEPIPADTIILS 324
            ++++N D    N    +        A+  F    W ++RVGDI+R+ + + IPAD I+LS
Sbjct: 343  LEQSNIDSTFENGEISVLDPSLPPMANSKFANDFWKNVRVGDIVRIHNNDEIPADVILLS 402

Query: 325  SSEPEGLCYIETANLDGETNLKIKQSRVETAKFIDVKTLKNMNGKVVSEQPNSSLYTYEG 384
            +S+ +G CY+ET NLDGE+NLK++QS   T    + + +      V SE P+++LY Y+G
Sbjct: 403  TSDIDGGCYVETKNLDGESNLKVRQSLRCTNAIRNSRDICRTKFWVESEGPHANLYVYQG 462

Query: 385  TMTLND------RQIPLSPDQMILRGATLRNTAWIFGLVIFTGHETKLLRNATATPIKRT 438
             +   D         P++ + M+LRG TLRNT W  G+V+FTG +TK + NA  TP K++
Sbjct: 463  NLKWIDSLDGQTHNEPITINNMLLRGCTLRNTKWAMGIVVFTGDDTKTMINAGVTPTKKS 522

Query: 439  AVEKIINRQXXXXXXXXXXXXXXXXXXXXXMSTADAKHLSYLYLEGTNKAGLFFKDFLTF 498
             + + +N                             +   +    GT         F++F
Sbjct: 523  RISRELNFSVLINFVFLFILCLIAGVANGAYYRKKPRSRDFFEF-GTIAGNPTTNGFVSF 581

Query: 499  W---ILFSNLVPISLFVTVELIKYYQAFMIGSDLDLYYEKTDTPTVVRTSSLVEELGQIE 555
            W   IL+ +LVPISL+++VE+IK  QA  I  D+ LY E+ D P   ++ S+ ++LGQIE
Sbjct: 582  WVAVILYQSLVPISLYISVEIIKTAQAIFIYLDVLLYNERLDYPCTPKSWSISDDLGQIE 641

Query: 556  YIFSDKTGTLTRNIMEFKSCSIAGHCY-------------IDKIPEDKTATVE-DGIEVG 601
            YIFSDKTGTLT+N+MEFK C+I G  Y                I  +K   +E +GI   
Sbjct: 642  YIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQGIDTEKEGRIEREGIAQD 701

Query: 602  YR-KFDDLKKKLNDP----------SDEDSPII------------NDFLTLLATCHTVI- 637
                 DDL+K  N+           S E S  +              F+  LA CH+V+ 
Sbjct: 702  REIMIDDLRKISNNSQFYPEELTFVSKEFSQDLLGNNGEVQQKRCQHFMLALALCHSVLV 761

Query: 638  -PEFQSDGSIKYQAASPDEGALVQGGADLGYKFIIRKGNSVTVLLEETGEEKEYQLLNIC 696
             P+      ++  A SPDE ALV    D+G+ FI +    +  L+E  G +KE+Q+LNI 
Sbjct: 762  EPDKNDPNKLELTAQSPDETALVTTARDMGFSFIGKTKQGL--LVEVQGIQKEFQILNIL 819

Query: 697  EFNSTRKRMSAIFRFPDGSIK------LFCKGADTVILERL------DDEANQYVEATMR 744
            EFNS+RKRMS I + P  + K      L CKGAD+VI  RL      +DE    +E T  
Sbjct: 820  EFNSSRKRMSCIVKLPPATEKDEPRALLICKGADSVIYSRLSRKPGYNDET--LLEKTAL 877

Query: 745  HLEDYASEGLRTLCLAMRDISEGEYEEWNSIYNEAATTLDNRAEKLDEAANLIEKNLILI 804
            HLE YA+EGLRTLC+  R+IS  EY+EWN  YN AA +L  R E+LD  A+LIE++L+L+
Sbjct: 878  HLEQYATEGLRTLCVGQREISWSEYQEWNEKYNIAAASLAGREEELDHVADLIERDLVLL 937

Query: 805  GATAIEDKLQDGVPETIHTLQEAGIKIWVLTGDRQETAINIGMSCRLLSEDMNLLIINEE 864
            G TAIED+LQDGVP++I  L EAGIK+WVLTGD+ ETAINIG SC LL+ DM LL+I   
Sbjct: 938  GGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCNLLNTDMELLVIKTT 997

Query: 865  TRDDTE--------------RNLLEKINAL-NEHQLS------THDMKSLALVIDGKSLG 903
              D  E              + L+EK N   +E +L+      +      A++IDG++L 
Sbjct: 998  GEDVKEFGDDPTEIVNALVSKYLMEKFNMTGSEEELAAAKKDHSPPQGEFAIIIDGEALK 1057

Query: 904  FALEPE-LEDYLLTVAKLCKAVICCRVSPLQKALVVKMVKRKXXXXXXAIASGANDVSMI 962
             AL  + ++   L + K CKAV+CCRVSP QKA VVK+VK        AI  G+NDV+MI
Sbjct: 1058 IALTGDTMKRKFLLLCKNCKAVLCCRVSPAQKAAVVKLVKDTLDVMTLAIGDGSNDVAMI 1117

Query: 963  QAAHVGVGISGMEGMQAARSADIALGQXXXXXXXXXVHGSWSYQRISVAILYSFYKNTAL 1022
            Q+A VGVGI+G EG QA   +D A+GQ         VHG W Y+R++  I   FYKN   
Sbjct: 1118 QSADVGVGIAGEEGRQAVMCSDYAIGQFRYVTRLVLVHGKWCYKRLAEMIPQFFYKNVIF 1177

Query: 1023 YMTQFWYVFANAFSGQSIMESWTMSFYNLFFTVWPPFVIGVFDQFVSSRLLERYPQLYKL 1082
             +  FWY   N F G  + E   ++FYNL FT  P   +G+ DQ VS+ +    PQLY+ 
Sbjct: 1178 TLALFWYGVHNDFDGSYLFEYTYLTFYNLAFTSLPVIFLGILDQDVSATVSMIVPQLYRS 1237

Query: 1083 GQKGQFFSVYIFWGWIINGFFHSAIVFIGTILIYRYGFALNMHGELADHWSW-GVTVYTT 1141
            G   Q ++   F  ++ +G + S I +    LIYR    +  +G   DH  + G+ V   
Sbjct: 1238 GILRQEWNQTKFLWYMFDGIYQSVICYFFPYLIYRKTNIITQNGLGLDHRYYVGIPVTGI 1297

Query: 1142 SVIIVLGKAALVTNQWTKFTLIAIPGSLLFWLIFFPIYASIFPHANISREYYGVVKHTYG 1201
            +V        +   +W  FT      + L  +++F  +  I+  +  S E++      YG
Sbjct: 1298 AVTSCNFYVLMEQYRWDWFTTFF---AFLSTIVYFG-WTGIWSSSIASYEFWKGASRMYG 1353

Query: 1202 SGVFWLTLIVLPIFALVRDFLWKYYKRMYEPETYHVIQEMQKY 1244
            +  FW    V  +F ++  F +  + +   P    +I+EM ++
Sbjct: 1354 TPSFWAVYFVGFLFCILPRFTYDVFMKYLYPSDVEIIREMWQH 1396

 Score = 59.3 bits (142), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 32/90 (35%), Positives = 49/90 (54%)

Query: 198 YSDNHISTTKYNFATFLPKFLFQEFSKYANLFFLCTSAIQQVPHVSPTNRYTTIGTLLVV 257
           Y  N I TTKY   TF PK +  +F+ +AN++FL    +        TN       L+V+
Sbjct: 168 YPRNKIRTTKYTPLTFFPKNVMLQFNNFANIYFLIMIILGAFQIFGVTNPGLAAVPLIVI 227

Query: 258 LIVSAMKECIEDIKRANSDKELNNSTAEIF 287
           +I++A+K+ IED +R   D E+NN+   I 
Sbjct: 228 IILTAIKDAIEDSRRTLLDMEVNNTRTHIL 257

>CAGL0L11814g 1262124..1266854 highly similar to sp|P32660
            Saccharomyces cerevisiae YER166w or sp|Q12675
            Saccharomyces cerevisiae YDR093w, start by similarity
          Length = 1576

 Score =  618 bits (1594), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/1042 (36%), Positives = 552/1042 (52%), Gaps = 94/1042 (9%)

Query: 294  FVEKRWIDIRVGDIIRVKSEEPIPADTIILSSSEPEGLCYIETANLDGETNLKIKQSRVE 353
            F    W  ++VGDI+R+ + + IPAD I+LS+S+ +G CY+ET NLDGETNLK++Q+   
Sbjct: 389  FARDYWKSVKVGDIVRIHNNDEIPADIILLSTSDSDGGCYVETKNLDGETNLKVRQALKC 448

Query: 354  TAKFIDVKTLKNMNGKVVSEQPNSSLYTYEGTMTLND------RQIPLSPDQMILRGATL 407
            + K    + +      + SE P+++LY+Y+G +   D      R  P++ + M+LRG TL
Sbjct: 449  SYKIKTSRDIARTRFWIESEGPHANLYSYQGNLKWKDSTNNELRNEPVTINNMLLRGCTL 508

Query: 408  RNTAWIFGLVIFTGHETKLLRNATATPIKRTAVEKIINRQXXXXXXXXXXXXXXXXXXXX 467
            RNT W  G+V+FTG +TK++ NA  TP K++ + + +N                      
Sbjct: 509  RNTKWAMGIVVFTGDDTKIMLNAGVTPTKKSRISRELNFSVLINFLVLFILCFISGLANG 568

Query: 468  XMSTADAKHLSYLYLEGTNKAGLFFKDFLTFW---ILFSNLVPISLFVTVELIKYYQAFM 524
                   +   +    GT         F++FW   IL+ +LVPISL+++VE+IK  QA  
Sbjct: 569  IDYDKHPRSRDFFEF-GTVAGNPATNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAAF 627

Query: 525  IGSDLDLYYEKTDTPTVVRTSSLVEELGQIEYIFSDKTGTLTRNIMEFKSCSIAGHCYID 584
            I  D+ LY  K D P   ++ ++ ++LGQIEYIFSDKTGTLT+N+MEFK C+I G  Y  
Sbjct: 628  IYGDVLLYNAKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGR 687

Query: 585  KIPEDKTATVE-DGIEV---GYRKFDDLKKK----LNDP----------SDE----DSPI 622
               E      +  GI+V   G R+ +++ K     +ND            DE       I
Sbjct: 688  AYTEALAGLRKRQGIDVEAEGRREKEEIAKDRDVMINDLRNLSNNTQFFPDEITFISKEI 747

Query: 623  INDF---------------LTLLATCHTVI--PEFQSDGSIKYQAASPDEGALVQGGADL 665
            + DF               +  LA CH+V+  P   +   ++ +A SPDE ALV    DL
Sbjct: 748  VQDFKGRNGDIQKKCCEHFMLALALCHSVLTEPSPTNPNKLEMKAQSPDEAALVTTARDL 807

Query: 666  GYKFIIRKGNSVTVLLEETGEEKEYQLLNICEFNSTRKRMSAIFRFPDGSIK------LF 719
            G+ F+ +    + V  E  G +KE+++LNI EFNS RKRMS I + P  +        L 
Sbjct: 808  GFCFMGKTKTGMVV--EIQGIQKEFEILNILEFNSARKRMSCIIKIPGATPNDEPRALLI 865

Query: 720  CKGADTVILERLDDEANQ----YVEATMRHLEDYASEGLRTLCLAMRDISEGEYEEWNSI 775
            CKGAD+VI  RL  +A +     +E T  HLE YA+EGLRTLCLA R+++  EY EWN+ 
Sbjct: 866  CKGADSVIYSRLSTKAGENDETLLEKTALHLEQYATEGLRTLCLAQRELTWSEYTEWNAR 925

Query: 776  YNEAATTLDNRAEKLDEAANLIEKNLILIGATAIEDKLQDGVPETIHTLQEAGIKIWVLT 835
            Y+ AA +L NR E+L+  ++ IE++LIL+G TAIED+LQDGVPE+I  L EAGIK+WVLT
Sbjct: 926  YDIAAASLTNREEQLEIVSDSIERDLILLGGTAIEDRLQDGVPESIALLAEAGIKLWVLT 985

Query: 836  GDRQETAINIGMSCRLLSEDMNLLIINEETRDDTE--------------RNLLEKI---- 877
            GD+ ETAINIG SC LL+ DM LL++     D  E              + L EK     
Sbjct: 986  GDKVETAINIGFSCNLLNNDMELLVVKTAGEDVLEYGEDPHEVVNSLISKYLREKFGLSG 1045

Query: 878  ------NALNEHQLSTHDMKSLALVIDGKSLGFALE-PELEDYLLTVAKLCKAVICCRVS 930
                  NA  +H     D    A+VIDG +L  AL   +++   L + K CKAV+CCRVS
Sbjct: 1046 SEMELDNAKGDHSFPKGD---FAVVIDGDALKIALTGDDMKRKFLLLCKNCKAVLCCRVS 1102

Query: 931  PLQKALVVKMVKRKXXXXXXAIASGANDVSMIQAAHVGVGISGMEGMQAARSADIALGQX 990
            P QKA VVK+VK        AI  G+NDV+MIQ+A VG+GI+G EG QA   +D A+GQ 
Sbjct: 1103 PAQKAAVVKLVKNTLDVMTLAIGDGSNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQF 1162

Query: 991  XXXXXXXXVHGSWSYQRISVAILYSFYKNTALYMTQFWYVFANAFSGQSIMESWTMSFYN 1050
                    VHG WSY+R+S  I   FYKN    +  FWY   N F G  + E   + FYN
Sbjct: 1163 RYLTRLLLVHGRWSYKRLSEMIPEFFYKNVIFTLALFWYGIYNNFDGSYLFEYTYLMFYN 1222

Query: 1051 LFFTVWPPFVIGVFDQFVSSRLLERYPQLYKLGQKGQFFSVYIFWGWIINGFFHSAIVFI 1110
            L FT  P  ++G+ DQ V+  +    PQLY++G     ++   F  ++ +G + S I F 
Sbjct: 1223 LAFTSIPVILLGILDQDVNDTISLVVPQLYRVGILRLEWNQTKFLWYMFDGLYQSVICFF 1282

Query: 1111 GTILIYRYGFALNMHGELADHWSWGVTVYTTSVIIVLGKAALVTN-QWTKFTLIAIPGSL 1169
               L+Y+    +  +G   +H  +   + TT  +       L+   +W  F+   I  S 
Sbjct: 1283 FPYLLYKRNGVVTKNGMGLEHRYYVGIIVTTIAVFACNLYILIHQYRWDWFSGFFIFLSC 1342

Query: 1170 LFWLIFFPIYASIFPHANISREYYGVVKHTYGSGVFWLTLIVLPIFALVRDFLWKYYKRM 1229
            +  + +  I+ S F     S + +   +  Y S  FW    +   F L+  F W  Y + 
Sbjct: 1343 IVVIGWTGIWTSSF----TSLDLWKAGERIYDSPSFWAVFFIGVFFCLLPRFTWDCYTQF 1398

Query: 1230 YEPETYHVIQEMQKYNISDSRP 1251
            + P    +I+EM K    D  P
Sbjct: 1399 FNPSDVQIIREMWKRGDYDHYP 1420

 Score = 60.1 bits (144), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 50/184 (27%), Positives = 85/184 (46%), Gaps = 20/184 (10%)

Query: 104 RAVKPPGLFARFGNGLKNAFTFKRKKGPESFEMNHYNAVTNNELDDNYLDSRNKFNIKIL 163
           R VK  G  ++FGN  +N      KK  +    N ++  + +E ++N   +     ++ +
Sbjct: 110 RRVK--GHKSQFGNMSRNKTLKWAKKNIK----NPFDDFSRDEEEENDRSTNRADQLRTV 163

Query: 164 FNRYILRKNVGDAEGNGEPRVIHINDSLANSSFGYSDNHISTTKYNFATFLPKFLFQEFS 223
           ++   L + + D EGN                  Y  N I TTKY   +F PK L  +F 
Sbjct: 164 YHNLPLPEEMLDEEGN--------------PIMEYPRNKIRTTKYTPLSFFPKNLLFQFQ 209

Query: 224 KYANLFFLCTSAIQQVPHVSPTNRYTTIGTLLVVLIVSAMKECIEDIKRANSDKELNNST 283
            +AN++FL    +        TN   +   L+V++I++A+K+ IED +R   D E+NN+ 
Sbjct: 210 NFANVYFLVLIILGAFQIFGVTNPGLSAVPLIVIVIITAIKDGIEDSRRTILDLEVNNTR 269

Query: 284 AEIF 287
             I 
Sbjct: 270 THIL 273

>Scas_576.8
          Length = 1591

 Score =  605 bits (1560), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/1046 (36%), Positives = 558/1046 (53%), Gaps = 101/1046 (9%)

Query: 294  FVEKRWIDIRVGDIIRVKSEEPIPADTIILSSSEPEGLCYIETANLDGETNLKIKQSRVE 353
            F +  W +++VGDI+R+ + + IPAD I+LS+S+ +G CY+ET NLDGETNLK+++S   
Sbjct: 409  FSKDYWKNVKVGDIVRIHNNDEIPADIILLSTSDSDGGCYLETKNLDGETNLKVRESLKC 468

Query: 354  TAKFIDVKTLKNMNGKVVSEQPNSSLYTYEGTMTLND------RQIPLSPDQMILRGATL 407
            +    + + +      V SE P+++LY+Y+G +   D      +  P++ + ++LRG TL
Sbjct: 469  SHSIRNSRDIARTKFWVESEGPHANLYSYQGNVKWVDSKDGDLKNEPVTINNLLLRGCTL 528

Query: 408  RNTAWIFGLVIFTGHETKLLRNATATPIKRTAVEKIINRQXXXXXXXXXXXXXXXXXXXX 467
            RNT W  G+V+FTG +TK++ N+ ATP K++ + + +N                      
Sbjct: 529  RNTKWAMGMVVFTGDDTKIMLNSGATPTKKSRISRELNLSVSLNFLFLFIICFISAIING 588

Query: 468  XMSTADAKHLSYLYLEGTNKAGLFFKDFLTFW---ILFSNLVPISLFVTVELIKYYQAFM 524
                   +   +    GT         F++FW   IL+ +LVPISL+++VE+IK  QA  
Sbjct: 589  VDYDKHPRSRDFFEF-GTVAGSASTNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAAF 647

Query: 525  IGSDLDLYYEKTDTPTVVRTSSLVEELGQIEYIFSDKTGTLTRNIMEFKSCSIAGHCY-- 582
            I  D+ LY  K D P   ++ ++ +++GQIEYIFSDKTGTLT+N+MEFK C+I G  Y  
Sbjct: 648  IYGDVLLYNAKLDYPCTPKSWNISDDMGQIEYIFSDKTGTLTQNVMEFKKCTINGISYGR 707

Query: 583  --------------ID----------KIPEDKTATVE-------------DGIEVGYRKF 605
                          ID          +I +D+   +              D I    ++F
Sbjct: 708  AYTEALAGLRKRQGIDVEEEGRREKEEIAKDRDTMINTLRNLSHNSQFYPDDITFISKEF 767

Query: 606  -DDLKKKLNDPSDEDSPIINDFLTLLATCHTVI--PEFQSDGSIKYQAASPDEGALVQGG 662
             +DLK       D        F+  LA CH+V+  P       +  +A SPDE ALV   
Sbjct: 768  VNDLKGA---SGDMQQKCCEHFMLALALCHSVLVEPNKHDSKKLDVKAQSPDEAALVCTA 824

Query: 663  ADLGYKFIIRKGNSVT-VLLEETGEEKEYQLLNICEFNSTRKRMSAIFRFPDGSIK---- 717
             D+G+ FI   G + T +++E  G +KE+Q+LN  EFNSTRKRMS I + P  +      
Sbjct: 825  RDVGFSFI---GKTKTGLIIEVQGVQKEFQILNTLEFNSTRKRMSCIVKIPGANPDDEPR 881

Query: 718  --LFCKGADTVILERLDDE----ANQYVEATMRHLEDYASEGLRTLCLAMRDISEGEYEE 771
              L CKGAD++I  RL  +    +   +E T  HLE YA+EGLRTLC+A R++S  EY E
Sbjct: 882  ALLICKGADSIIYSRLGTKNGANSENLLEKTALHLEQYATEGLRTLCIAQRELSWPEYLE 941

Query: 772  WNSIYNEAATTLDNRAEKLDEAANLIEKNLILIGATAIEDKLQDGVPETIHTLQEAGIKI 831
            WN  Y+ AA ++ NR E+L+  ++ IE+ L L+G TAIED+LQDGVPE+I  L +AGIK+
Sbjct: 942  WNKRYDIAAASVTNREEQLEAVSDEIERELTLLGGTAIEDRLQDGVPESISILAQAGIKL 1001

Query: 832  WVLTGDRQETAINIGMSCRLLSEDMNLLIINEETRDDTE--------------RNLLEKI 877
            WVLTGD+ ETAINIG SC LL+ DM LL++     D  E              + L EK 
Sbjct: 1002 WVLTGDKVETAINIGFSCNLLNNDMELLVVKTNGDDVQEFGNDPAEIAESLITKYLREKF 1061

Query: 878  NALNEHQLSTHDMK--------SLALVIDGKSLGFALEPE-LEDYLLTVAKLCKAVICCR 928
              L   ++   D K          A+VIDG++L  AL  E +    L + K CKAV+CCR
Sbjct: 1062 -GLTGSEMELADAKKNHDFPRGDFAVVIDGEALKLALNGESIRRKFLLLCKNCKAVLCCR 1120

Query: 929  VSPLQKALVVKMVKRKXXXXXXAIASGANDVSMIQAAHVGVGISGMEGMQAARSADIALG 988
            VSP QKA VVK+V         AI  G+NDV+MIQ+A VGVGI+G EG QA   +D A+G
Sbjct: 1121 VSPAQKAAVVKLVMTSLDVMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIG 1180

Query: 989  QXXXXXXXXXVHGSWSYQRISVAILYSFYKNTALYMTQFWYVFANAFSGQSIMESWTMSF 1048
            Q         VHG WSY+R++  I   FYKN    +  FWY   N F G  + E   + F
Sbjct: 1181 QFRYLTRLVLVHGRWSYRRLAEMIPAFFYKNVIFTLALFWYGIYNNFDGSYLFEYTFLMF 1240

Query: 1049 YNLFFTVWPPFVIGVFDQFVSSRLLERYPQLYKLGQKGQFFSVYIFWGWIINGFFHSAIV 1108
            YNL FT  P   +G+ DQ VS  +    PQLY+ G     ++   F  ++++G + S I 
Sbjct: 1241 YNLAFTSLPVIFMGIMDQDVSDTVSLVMPQLYRSGILRLDWNQTKFLWYMLDGLYQSCIC 1300

Query: 1109 FIGTILIYRYGFALNMHGELADHWSWGVTVYTTSVIIVLGKAALVTNQ--WTKFTLIAIP 1166
            F     +Y     ++ +G   DH  + V V  TS+ +V     ++ +Q  W  F+ + I 
Sbjct: 1301 FFFPYCLYHKNQIVSNNGLGLDH-RFYVGVMVTSLAVVSCNIYMLLHQYRWDWFSCLFIG 1359

Query: 1167 GSLLFWLIFFPIYASIFPHANISREYYGVVKHTYGSGVFWLTLIVLPIFALVRDFLWKYY 1226
             S +  ++FF  +  ++  +  S+E++      YG+  FW    V  ++ L+  F    +
Sbjct: 1360 LSCI--ILFF--WTGVWSSSLTSKEFFKAASRIYGAPSFWGVFFVGIVYCLLPRFTLDCF 1415

Query: 1227 KRMYEPETYHVIQEM-QKYNISDSRP 1251
            ++ + P    +++EM Q+ + S   P
Sbjct: 1416 RKFFYPTDVEIVREMWQRGDFSHYPP 1441

 Score = 57.0 bits (136), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 48/90 (53%)

Query: 198 YSDNHISTTKYNFATFLPKFLFQEFSKYANLFFLCTSAIQQVPHVSPTNRYTTIGTLLVV 257
           Y  N I TTKY+   F PK +  +F  +AN++FL    +        TN       L+V+
Sbjct: 201 YPRNKIRTTKYSPLNFFPKNIMFQFQNFANVYFLVLIILGAFQIFGVTNPGLAAVPLIVI 260

Query: 258 LIVSAMKECIEDIKRANSDKELNNSTAEIF 287
           +I++A+K+ IED +R   D E+NN+   I 
Sbjct: 261 VIITAIKDAIEDSRRTLLDMEVNNTRTHIL 290

>YIL048W (NEO1) [2619] chr9 (261436..264891) Member of the Drs2p-like
            ATPases family in the superfamily of P-type ATPases,
            overproduction confers neomycin resistance [3456 bp, 1151
            aa]
          Length = 1151

 Score =  423 bits (1088), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 328/1074 (30%), Positives = 525/1074 (48%), Gaps = 97/1074 (9%)

Query: 183  RVIHINDSLANSSFGYSDNHISTTKYNFATFLPKFLFQEFSKYANLFFLCTSAIQQVPHV 242
            R IH + +       Y  N +S  KYN  TF+P  L+++F  + NL+FL  +  Q VP +
Sbjct: 155  REIHPDTTPVYDRNRYVSNELSNAKYNAVTFVPTLLYEQFKFFYNLYFLVVALSQAVPAL 214

Query: 243  SPTNRYTTIGTLLVVLIVSAMKECIEDIKRANSDKELNNSTAEIFSEAHDDFVEKRWI-- 300
                  + I  L  VL V+  KE I+DI+R   D+E NN       E +      R I  
Sbjct: 215  RIGYLSSYIVPLAFVLTVTMAKEAIDDIQRRRRDRESNN-------ELYHVITRNRSIPS 267

Query: 301  -DIRVGDIIRVKSEEPIPADTIILSSSEPEGLCYIETANLDGETNLKIKQSRVETAKFID 359
             D++VGD+I+V   + IPAD ++L SSEP G  +I+T  LDGET+ K++ +   T    +
Sbjct: 268  KDLKVGDLIKVHKGDRIPADLVLLQSSEPSGESFIKTDQLDGETDWKLRVACPLTQNLSE 327

Query: 360  VKTLKNMNGKVVSEQPNSSLYTYEGTMTLNDRQI-PLSPDQMILRGATLRNTAWIFGLVI 418
               +  ++  + +  P  S++ + G +T  D    PLS D  +     L ++ +    V+
Sbjct: 328  NDLINRIS--ITASAPEKSIHKFLGKVTYKDSTSNPLSVDNTLWANTVLASSGFCIACVV 385

Query: 419  FTGHETKLLRNATATPIKRTAVEKIINRQXXXXXXXXXXXXXXXXXXXXXMSTADAKHLS 478
            +TG +T+   N T   +K   +E  IN                       +  A    LS
Sbjct: 386  YTGRDTRQAMNTTTAKVKTGLLELEIN-------------------SISKILCACVFALS 426

Query: 479  YLYLEGTNKAGL----FFKDFLTFWILFSNLVPISLFVTVELIKYYQAFMIGSDLDLYYE 534
             L +     AG     ++ D L + ILFS ++P+SL V ++L K   A  I  D      
Sbjct: 427  ILLVAF---AGFHNDDWYIDILRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHD------ 477

Query: 535  KTDTPTVVRTSSLVEELGQIEYIFSDKTGTLTRNIMEFKSCSIAGHCYIDKIPEDKTATV 594
            KT   T+VRTS++ E+LG+IEY+ SDKTGTLT+N M+ K   +    Y  +  +  +  V
Sbjct: 478  KTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSYTSETLDIVSDYV 537

Query: 595  EDGIEVGYRKFDDLKKKLNDPSDEDSPIINDFLTLLATCHTVIPEFQSDGSIKYQAASPD 654
            +  +       ++ K  L+    + S  + D +  LA CH V P F+ D  + YQAASPD
Sbjct: 538  QSLVSSKNDSLNNSKVALSTTRKDMSFRVRDMILTLAICHNVTPTFEDD-ELTYQAASPD 596

Query: 655  EGALVQGGADLGYKFIIRKGNSVTVLLEETGEEKEYQLLNICEFNSTRKRMSAIFRFPDG 714
            E A+V+    +G     R  +S+++L E +G+   Y++L +  FNS  KRM  I R    
Sbjct: 597  EIAIVKFTESVGLSLFKRDRHSISLLHEHSGKTLNYEILQVFPFNSDSKRMGIIVRDEQL 656

Query: 715  SIKLFC-KGADTVILERLDDEANQYVEATMRHLEDYASEGLRTLCLAMRDISEGEYEEWN 773
                F  KGADTV+ + +  E+N ++E    ++   A EGLRTL +  + +++  YE++ 
Sbjct: 657  DEYWFMQKGADTVMSKIV--ESNDWLEEETGNM---AREGLRTLVIGRKKLNKKIYEQFQ 711

Query: 774  SIYNEAATTLDNRAEKLDEA-ANLIEKNLILIGATAIEDKLQDGVPETIHTLQEAGIKIW 832
              YN+A+ ++ NR +++ +     +E +L L+G T +EDKLQ  V  +I  L+ AGIKIW
Sbjct: 712  KEYNDASLSMLNRDQQMSQVITKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIW 771

Query: 833  VLTGDRQETAINIGMSCRLLSEDMNLLIINEETRDDTERNLLE--KINALNEHQLSTHDM 890
            +LTGD+ ETA  + +S +L+S    +  I + TR +   N LE  KIN            
Sbjct: 772  MLTGDKVETARCVSISAKLISRGQYVHTITKVTRPEGAFNQLEYLKIN------------ 819

Query: 891  KSLALVIDGKSLGFALEPELEDYLLTVAKLCKAVICCRVSPLQKALVVKMVKRKXXXXXX 950
            ++  L+IDG+SLG  L+   +++   V  L   VI CR +P QKA V  ++++       
Sbjct: 820  RNACLLIDGESLGMFLKHYEQEFFDVVVHL-PTVIACRCTPQQKADVALVIRKMTGKRVC 878

Query: 951  AIASGANDVSMIQAAHVGVGISGMEGMQAARSADIALGQXXXXXXXXXVHGSWSYQRISV 1010
             I  G NDVSMIQ A VGVGI G EG QA+ +AD ++ Q          HG  SY+R + 
Sbjct: 879  CIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQFCHLTELLLWHGRNSYKRSAK 938

Query: 1011 AILYSFYKNTALYMTQFWYVFANAFSGQSIMESWTMSFYNLFFTVWPPFVIGVFDQFVSS 1070
               +  ++   + + Q  Y   + F   ++ + W M  Y   +T+ P F +   D  +  
Sbjct: 939  LAQFVMHRGLIIAICQAVYSICSLFEPIALYQGWLMVGYATCYTMAPVFSL-TLDHDIEE 997

Query: 1071 RLLERYPQLYKLGQKGQFFSVYIFWGWIINGFFHSAIVFIGTILIYRYGFALNMHGELAD 1130
             L + YP+LYK   +G+  S   F+ W++   F  +++ +         F+      L  
Sbjct: 998  SLTKIYPELYKELTEGKSLSYKTFFVWVLLSLFQGSVIQL---------FSQAFTSLLDT 1048

Query: 1131 HWSWGVTV-YTTSVIIVLGKAALVTNQWTKFTLIAIPGSLLFWLIFFPIYASIFPHANIS 1189
             ++  V + +T  V+  L   AL    W K  L+    +LLF+++  P     F      
Sbjct: 1049 DFTRMVAISFTALVVNELIMVALEIYTWNKTMLVTEIATLLFYIVSVPFLGDYFDLG--- 1105

Query: 1190 REYYGVVKHTYGSGVFWLTLIVLPIFALVRDFLW---KYYKRMYEPETYHVIQE 1240
              Y   V +  G     L ++++ IF      +W     Y+R++ P +Y  +QE
Sbjct: 1106 --YMTTVNYYAG----LLVILLISIFP-----VWTAKAIYRRLH-PPSYAKVQE 1147

>Sklu_2193.1 YIL048W, Contig c2193 334-3765 reverse complement
          Length = 1143

 Score =  418 bits (1075), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 325/1069 (30%), Positives = 509/1069 (47%), Gaps = 91/1069 (8%)

Query: 183  RVIHINDSLANSSFGYSDNHISTTKYNFATFLPKFLFQEFSKYANLFFLCTSAIQQVPHV 242
            R IH + +       Y  N IS  KYN  TF+P  L+++F  + NL+FL  +  Q +P +
Sbjct: 151  REIHPDTTPIYDKNKYPSNAISNAKYNPITFIPIILYEQFKFFFNLYFLLVALSQAIPAL 210

Query: 243  SPTNRYTTIGTLLVVLIVSAMKECIEDIKRANSDKELNNSTAEIFSEAHDDFVEKRWIDI 302
                  + I  L  VL+V+  KE ++DI+R   DKE NN   E+ ++A    V  +  D+
Sbjct: 211  RIGYLSSYIVPLAFVLMVTMSKEAMDDIQRRQRDKESNNELYEVLNKAQ--LVPSK--DL 266

Query: 303  RVGDIIRVKSEEPIPADTIILSSSEPEGLCYIETANLDGETNLKIKQSRVETAKFIDVKT 362
            +VGD+I++     IPAD ++L SSEP G  +I+T  LDGET+ K+   RV  +   ++ T
Sbjct: 267  KVGDLIKIHKGTRIPADLVLLQSSEPSGESFIKTDQLDGETDWKL---RVACSLTQNLST 323

Query: 363  LKNMNG-KVVSEQPNSSLYTYEGTMTLNDRQI-PLSPDQMILRGATLRNTAWIFGLVIFT 420
               +N   + +  P  S++ + G +T  D     LS D  +     L +     G V++T
Sbjct: 324  DDLLNKISITASSPEKSIHRFLGKLTYKDSSSNALSVDNTMWANTVLASVGSCIGCVVYT 383

Query: 421  GHETKLLRNATATPIKRTAVEKIINRQXXXXXXXXXXXXXXXXXXXXXMSTADAKHLSYL 480
            G +T+   N T + +K   +E  IN                       +S      +  L
Sbjct: 384  GTDTRQAMNTTMSSVKTGLLELEIN----------------------SLSKILCACVFVL 421

Query: 481  YLEGTNKAGL----FFKDFLTFWILFSNLVPISLFVTVELIKYYQAFMIGSDLDLYYEKT 536
             +     AG     ++ D + + ILFS ++P+SL V ++L K   A  I  D       T
Sbjct: 422  SIVLVAFAGFGNKDWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYARQIEHD------AT 475

Query: 537  DTPTVVRTSSLVEELGQIEYIFSDKTGTLTRNIMEFKSCSIAGHCYIDKIPEDKTATVED 596
               T+VRTS++ E+LG+IEY+ SDKTGTLT+N M+ K   +    Y     +  T  V++
Sbjct: 476  IPDTIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKLHLGTVSYTMDTMDIVTDYVQE 535

Query: 597  GIEVGYRKFDDLKKKLNDPSDEDSP-IINDFLTLLATCHTVIPEFQSDGSIKYQAASPDE 655
             +                 + +D P  + D +  LA CH V P F+ DG + YQAASPDE
Sbjct: 536  LVSSSTTT-----PMPQSTAKKDLPNRVRDLVVTLAICHNVTPTFE-DGELTYQAASPDE 589

Query: 656  GALVQGGADLGYKFIIRKGNSVTVLLEETGEEKEYQLLNICEFNSTRKRMSAI-FRFPDG 714
             A+V+    +G     R  +SV++  + +    EY +L +  FNS  KRM  I +    G
Sbjct: 590  IAIVKFTESVGLSLFKRDRHSVSLFHQHSATNFEYDILQVFPFNSDTKRMGIIVYDKVKG 649

Query: 715  SIKLFCKGADTVILERLDDEANQYVEATMRHLEDYASEGLRTLCLAMRDISEGEYEEWNS 774
                  KGADTV+   +  ++N +++  + ++   A EGLRTL +  + +S   YE++  
Sbjct: 650  EHWFMQKGADTVMARIV--QSNDWLDEEVGNM---AREGLRTLVIGRKKLSPKSYEQFRK 704

Query: 775  IYNEAATTLDNRAEKLDEA-ANLIEKNLILIGATAIEDKLQDGVPETIHTLQEAGIKIWV 833
             Y++A+ ++ NR E +       +E NL L+G T +EDKLQ+ V  +I  L+ AG+KIW+
Sbjct: 705  EYHDASLSMLNRDETMSSVIKKHLEHNLELLGLTGVEDKLQNDVKSSIELLRNAGVKIWM 764

Query: 834  LTGDRQETAINIGMSCRLLSEDMNLLIINEETRDDTERNLLE--KINALNEHQLSTHDMK 891
            LTGD+ ETA  + +S +L+S    +  + + +R +   N LE  KIN            K
Sbjct: 765  LTGDKVETARCVSISAKLISRGQYVHTVTKLSRPEGALNALEYLKIN------------K 812

Query: 892  SLALVIDGKSLGFALEPELEDYLLTVAKLCKAVICCRVSPLQKALVVKMVKRKXXXXXXA 951
            S  L+IDG+SLG  L    +++   V  L  AVI CR +P QKA V  +++         
Sbjct: 813  SSCLLIDGESLGMFLTYYKQEFFDIVVDL-PAVIACRCTPQQKADVALLIREITGKRVCC 871

Query: 952  IASGANDVSMIQAAHVGVGISGMEGMQAARSADIALGQXXXXXXXXXVHGSWSYQRISVA 1011
            I  G NDVSMIQ A VGVGI G EG QA+ +AD ++ Q          HG  SY+R +  
Sbjct: 872  IGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSVTQFCHLTKLLLWHGRNSYKRSAKL 931

Query: 1012 ILYSFYKNTALYMTQFWYVFANAFSGQSIMESWTMSFYNLFFTVWPPFVIGVFDQFVSSR 1071
              +  ++   + + Q  Y   + F   ++ + W M  Y   +T+ P F +   D  +   
Sbjct: 932  AQFVIHRGLIISVCQAVYSVCSKFEPIALYQGWLMVGYATCYTMAPVFSL-TLDHDIDES 990

Query: 1072 LLERYPQLYKLGQKGQFFSVYIFWGWIINGFFHSAIVFIGTILIYRYGFALNMHGELADH 1131
            L + YP+LYK    G   S   F+ W+I   F    +      I +Y  +L+      D 
Sbjct: 991  LTKIYPELYKELTAGTSLSYKTFFVWVILSLFQGCAI----QGISQYFTSLDE----VDF 1042

Query: 1132 WSWGVTVYTTSVIIVLGKAALVTNQWTKFTLIAIPGSLLFWLIFFPIYASIFPHANISRE 1191
                   +T  VI  L   AL    W K  +I    + L +++  P  +  F    +S+ 
Sbjct: 1043 KKLVALSFTALVINELIMVALEIYTWNKTMVITEIVTFLIYVVSVPFLSEYFDLTFVSQL 1102

Query: 1192 YYGVVKHTYGSGVFWLTLIVLPIFALVRDFLWKYYKRMYEPETYHVIQE 1240
             +      Y   +F L + V P++A       K   R   P  Y  +Q+
Sbjct: 1103 PF------YAKLIFILAVSVFPVWAA------KAIHRKINPPNYAKVQQ 1139

>Scas_704.38
          Length = 1161

 Score =  411 bits (1056), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 311/1065 (29%), Positives = 506/1065 (47%), Gaps = 79/1065 (7%)

Query: 183  RVIHINDSLANSSFGYSDNHISTTKYNFATFLPKFLFQEFSKYANLFFLCTSAIQQVPHV 242
            R IH + +       Y  N IS  KYN  TF+P  L+++F  + NL+FL  +  Q +P +
Sbjct: 165  REIHPSTTPVYDRNRYPGNEISNAKYNAFTFIPTLLYEQFKFFYNLYFLVVALSQAIPAL 224

Query: 243  SPTNRYTTIGTLLVVLIVSAMKECIEDIKRANSDKELNNSTAEIFSEAHDDFVEKRWIDI 302
                  + +  L  VL V+  KE ++DI+R   D E N+    + +++    V  +  D+
Sbjct: 225  RIGYLSSYVVPLAFVLTVTMSKEAMDDIQRRRRDNESNSELYHVLNQSK--LVPSK--DL 280

Query: 303  RVGDIIRVKSEEPIPADTIILSSSEPEGLCYIETANLDGETNLKIKQSRVETAKFIDVKT 362
            +VGD+I++   + +PAD ++L SSEP G  +I+T  LDGET+ K++ +   T    +   
Sbjct: 281  KVGDLIKISKGDRLPADLVLLQSSEPSGETFIKTDQLDGETDWKLRIAPALTQNLTEPDL 340

Query: 363  LKNMNGKVVSEQPNSSLYTYEGTMTLNDRQI-PLSPDQMILRGATLRNTAWIFGLVIFTG 421
            +  ++  + +  P  +++ + G +T  D    PLS D  +     L +T +  G V++TG
Sbjct: 341  MNKVS--ITASAPEKAIHNFLGKVTYKDTSSNPLSIDNTLWANTVLASTGFCIGCVVYTG 398

Query: 422  HETKLLRNATATPIKRTAVEKIINRQXXXXXXXXXXXXXXXXXXXXXMSTADAKHLSYLY 481
             +T+   N T   +K   +E  IN                        ++  A  +  + 
Sbjct: 399  RDTRQAMNTTTATVKTGLLELEIN-----------------SISKILCASVFALSIILVV 441

Query: 482  LEGTNKAGLFFKDFLTFWILFSNLVPISLFVTVELIKYYQAFMIGSDLDLYYEKTDTPTV 541
              G + +  +  D + + ILFS ++P+SL V ++L K   A  I  D       T   T+
Sbjct: 442  FAGFHNSDWYL-DVMRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHD------DTIPETI 494

Query: 542  VRTSSLVEELGQIEYIFSDKTGTLTRNIMEFKSCSIAGHCYIDKIPEDKTATVEDGIEVG 601
            VRTS++ E+LG+IEY+ SDKTGTLT+N M+ K   +    Y  +   D  +   D +   
Sbjct: 495  VRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSYTSETL-DIVSDYVDALVNS 553

Query: 602  YRKFDDLKKKLNDPSDED-SPIINDFLTLLATCHTVIPEFQSDGSIKYQAASPDEGALVQ 660
                +   K +   S +D S  + D +  LA CH V P F+ D  + YQAASPDE A+V+
Sbjct: 554  SNSANPSGKSVPSTSRKDLSARVRDMVVTLAICHNVTPTFEDD-ELTYQAASPDEIAIVK 612

Query: 661  GGADLGYKFIIRKGNSVTVLLEETGEEKEYQLLNICEFNSTRKRMSAIFRFPDGSIKLFC 720
                +G     R  +S+++L   +G    Y++L +  FNS  KRM  I          F 
Sbjct: 613  FTESVGLSLFKRDRHSISLLHGHSGSILTYEILQVFPFNSDSKRMGIIVHDEQKDEYWFM 672

Query: 721  -KGADTVILERLDDEANQYVEATMRHLEDYASEGLRTLCLAMRDISEGEYEEWNSIYNEA 779
             KGADTV+   +  E N ++E    ++   A EGLRTL +  + +S   Y+++   Y++A
Sbjct: 673  QKGADTVMARIV--ENNDWLEEETGNM---AREGLRTLVVGRKKLSRNIYDQFKKDYDDA 727

Query: 780  ATTLDNRAEKLDEA-ANLIEKNLILIGATAIEDKLQDGVPETIHTLQEAGIKIWVLTGDR 838
            + ++ NR ++++      +E +L L+G T +EDKLQ+ V  +I  L+ AGIKIW+LTGD+
Sbjct: 728  SLSMVNRDQQMNAVITKYLEYDLELLGLTGVEDKLQNDVKSSIELLRNAGIKIWMLTGDK 787

Query: 839  QETAINIGMSCRLLSEDMNLLIINEETRDDTERNLLE--KINALNEHQLSTHDMKSLALV 896
             ETA  + +S +L+S    + II + T+ +   N LE  K+N            K   L+
Sbjct: 788  VETARCVSISAKLISRGQYVHIITKLTKPEGALNQLEYLKVN------------KGACLL 835

Query: 897  IDGKSLGFALEPELEDYLLTVAKLCKAVICCRVSPLQKALVVKMVKRKXXXXXXAIASGA 956
            IDG+SLG  L     ++   V  L   V+ CR +P QKA V  +++         I  G 
Sbjct: 836  IDGESLGMFLRYYKREFFDVVICL-PTVVACRCTPQQKADVALVIREFTGKRVCCIGDGG 894

Query: 957  NDVSMIQAAHVGVGISGMEGMQAARSADIALGQXXXXXXXXXVHGSWSYQRISVAILYSF 1016
            NDVSMIQ A VGVGI G EG QA+ +AD ++ +          HG  SY+R +    +  
Sbjct: 895  NDVSMIQCADVGVGIVGKEGKQASLAADFSITEFCHLTELLLWHGRNSYKRSAKLAQFIM 954

Query: 1017 YKNTALYMTQFWYVFANAFSGQSIMESWTMSFYNLFFTVWPPFVIGVFDQFVSSRLLERY 1076
            ++   + + Q  Y   + F    + + + M  Y   +T+ P F +   D  +   L + Y
Sbjct: 955  HRGLVIAICQAVYSICSKFEPIGLYQGFLMVGYATCYTMAPVFSM-TLDHDIEESLTKIY 1013

Query: 1077 PQLYKLGQKGQFFSVYIFWGWIINGFFHSAIVFIGTILIYRYGFALNMHGELADHWSWGV 1136
            P+LYK   +G+  S   F+ W     F   ++          G +      L   ++  V
Sbjct: 1014 PELYKDLTEGKSLSYKTFFVWCALSLFQGCVI---------QGCSQVFSSLLEVDFTKMV 1064

Query: 1137 TVYTTSVII-VLGKAALVTNQWTKFTLIAIPGSLLFWLIFFPIYASIFPHANISREYYGV 1195
             +  T++I+  L   AL    W K  +     + L ++I  P     F         Y +
Sbjct: 1065 AIGFTALILNELIMVALEIYTWNKIMVFTEILTFLCYVISVPFLGEYFDLK------YMM 1118

Query: 1196 VKHTYGSGVFWLTLIVLPIFALVRDFLWKYYKRMYEPETYHVIQE 1240
                YG  +F L + V P++A       K   R   P +Y  +QE
Sbjct: 1119 TLRFYGELLFILLVSVFPVWAA------KAIHRRLHPPSYAKVQE 1157

>ADL079C [1662] [Homologous to ScYIL048W (NEO1) - SH] (544854..548354)
            [3501 bp, 1166 aa]
          Length = 1166

 Score =  409 bits (1050), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 295/941 (31%), Positives = 466/941 (49%), Gaps = 66/941 (7%)

Query: 183  RVIHINDSLANSSFGYSDNHISTTKYNFATFLPKFLFQEFSKYANLFFLCTSAIQQVPHV 242
            R IH++ +       Y  N IS  KYN  TFLP  L+++F  + NL+FL  S  Q +P +
Sbjct: 173  REIHLDTTPIYDKRKYPTNAISNAKYNAITFLPIVLYEQFKFFFNLYFLLVSLSQSIPAL 232

Query: 243  SPTNRYTTIGTLLVVLIVSAMKECIEDIKRANSDKELNNSTAEIFSEAHDDFVEKRWIDI 302
                  + I  L  VL+V+  KE ++DI+R   D+E NN   E+ + +    V  +  ++
Sbjct: 233  RIGYLSSYIVPLAFVLVVTMSKEAMDDIQRRRRDRETNNELYEVLNNSQ--LVPSK--NL 288

Query: 303  RVGDIIRVKSEEPIPADTIILSSSEPEGLCYIETANLDGETNLKIKQSRVETAKFIDVKT 362
            RVGD++++  +  IPAD I+L SSEP G  +++T  LDGET+ K++ +   T      + 
Sbjct: 289  RVGDLVKLHKDSRIPADMILLQSSEPSGETFVKTDQLDGETDWKLRVAPSLTQNLTQDEM 348

Query: 363  LKNMNGKVVSEQPNSSLYTYEGTMTLNDRQIPLSPDQMILRGATLRNTAWIFGLVIFTGH 422
            L  ++  + +  P  S++ + G +T      PLS D  +     L ++      VI+TG 
Sbjct: 349  LTKVH--ITASAPEKSIHMFTGKLTYKGSSAPLSVDNTLWANTVLASSGTCVACVIYTGT 406

Query: 423  ETKLLRNATATPIKRTAVEKIINRQXXXXXXXXXXXXXXXXXXXXXMSTADAKHLSYLYL 482
            +T+   N + + +K   +E  IN                                  L +
Sbjct: 407  DTRQAMNTSKSSVKTGLLELEINSLSKILCICVFTLSI------------------LLVV 448

Query: 483  EGTNKAGLFFKDFLTFWILFSNLVPISLFVTVELIKYYQAFMIGSDLDLYYEKTDTPTVV 542
             G      ++ D + + ILFS ++P+SL V ++L K   A  I SD      K+   T+V
Sbjct: 449  IGGLDDDKWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYARQIESD------KSIPDTIV 502

Query: 543  RTSSLVEELGQIEYIFSDKTGTLTRNIMEFKSCSIAGHCY----IDKIPEDKTATVEDGI 598
            RTS++ E+LG+IEY+ SDKTGTLT+N M+ +   +    Y    +D +  D   T+    
Sbjct: 503  RTSTIPEDLGRIEYLLSDKTGTLTQNDMQLRKIHLGTVSYTMETMDMV-TDYIQTLTSPA 561

Query: 599  EVGYRKFDDLKKKLNDPSDEDSPIINDFLTLLATCHTVIPEFQSDGSIKYQAASPDEGAL 658
             +G          +     E S  + D +  LATCH V P F+ D  + YQAASPDE A+
Sbjct: 562  NMGAAGV-----AVTGSRKEVSQRVRDLVVTLATCHNVTPNFE-DNELAYQAASPDEIAI 615

Query: 659  VQGGADLGYKFIIRKGNSVTVLLEETGEEKEYQLLNICEFNSTRKRMSAIFR-FPDGSIK 717
            V+    +G     R  +S+T+  E +G   +Y +L++  F S  KRM  I R      I 
Sbjct: 616  VKFTERVGLSLFKRDRHSLTLFHEYSGVNLQYDILHVFPFTSDTKRMGIIVRDRTKNEIW 675

Query: 718  LFCKGADTVILERLDDEANQYVEATMRHLEDYASEGLRTLCLAMRDISEGEYEEWNSIYN 777
               KGADTV+ + +  ++N ++E     + + A EGLRTL +A + +S   YE+++  Y 
Sbjct: 676  FLQKGADTVMSKIV--QSNDWLE---EEVSNMAREGLRTLVIARKKLSTRLYEQFSKEYK 730

Query: 778  EAATTLDNRAEKLDEAANL-IEKNLILIGATAIEDKLQDGVPETIHTLQEAGIKIWVLTG 836
            +A+ ++ NR E ++E     +E NL L+G T +EDKLQ  V  +I  L+ AG+KIW+LTG
Sbjct: 731  DASLSMLNRDEAMNEVVKRHLEHNLELLGLTGVEDKLQKDVKTSIELLRNAGVKIWMLTG 790

Query: 837  DRQETAINIGMSCRLLSEDMNLLIINEETRDDTERNLLEKINALNEHQLSTHDMKSLALV 896
            D+ ETA  + +S +L+S    +  I + TR D   + LE + A           ++  L+
Sbjct: 791  DKVETARCVCVSAKLISRGQYVHTITKLTRRDGALSRLEYLKA----------NRNSCLL 840

Query: 897  IDGKSLGFALEPELEDYLLTVAKLCKAVICCRVSPLQKALVVKMVKRKXXXXXXAIASGA 956
            IDG SL   +     ++   V  L   VI CR +P QKA V  +++         I  G 
Sbjct: 841  IDGDSLAIYMSHYRAEFFEIVICL-PVVIACRCTPQQKADVALLIREMTGKRVCCIGDGG 899

Query: 957  NDVSMIQAAHVGVGISGMEGMQAARSADIALGQXXXXXXXXXVHGSWSYQRISVAILYSF 1016
            NDVSMIQ A VGVGI G EG QA+ +AD ++ Q          HG  SY+R +    +  
Sbjct: 900  NDVSMIQCADVGVGIVGKEGKQASLAADYSITQFCHLTKLLLWHGRNSYKRSAKLSQFVI 959

Query: 1017 YKNTALYMTQFWYVFANAFSGQSIMESWTMSFYNLFFTVWPPFVIGVFDQFVSSRLLERY 1076
            ++   + + Q  Y  ++     ++ + W M  Y   +T+ P F +   D  +   L + Y
Sbjct: 960  HRGLLISVCQAVYSISSNLKPIALYQGWLMVGYATCYTMAPVFSL-TLDHDIDESLTKTY 1018

Query: 1077 PQLYKLGQKGQFFSVYIFWGWIINGFFHSAIV------FIG 1111
            P+LYK   +G+  S   F+ W+I   F  A++      FIG
Sbjct: 1019 PELYKELTEGRSLSYKTFFVWVILSLFQGAVIQGFSQLFIG 1059

>Kwal_23.5789
          Length = 1133

 Score =  399 bits (1024), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 312/1067 (29%), Positives = 506/1067 (47%), Gaps = 88/1067 (8%)

Query: 183  RVIHINDSLANSSFGYSDNHISTTKYNFATFLPKFLFQEFSKYANLFFLCTSAIQQVPHV 242
            R IH + +     + Y+ N IS  KYN  TF+PK L+++F  + NL+FL  +  Q +P +
Sbjct: 141  REIHPSTTPVYDRYKYAPNAISNAKYNPVTFIPKILYEQFKFFFNLYFLLVALSQAIPAL 200

Query: 243  SPTNRYTTIGTLLVVLIVSAMKECIEDIKRANSDKELNNSTAEIFSEAHDDFVEKRWIDI 302
                  + I  L  VL V+  KE ++DI+R   D+E NN   E+ S++    V  +  D+
Sbjct: 201  RIGYLSSYIVPLAFVLTVTMSKEALDDIQRRRRDRESNNELYEVLSKSQ--LVPSK--DL 256

Query: 303  RVGDIIRVKSEEPIPADTIILSSSEPEGLCYIETANLDGETNLKIKQSRVETAKFIDVKT 362
            +VGD+I++      PAD ++L SSEP G  +I+T  LDGET+ K++ +   T        
Sbjct: 257  KVGDLIKIGKGARAPADLVLLQSSEPSGEIFIKTDQLDGETDWKLRIACPLTQHLSQDDL 316

Query: 363  LKNMNGKVVSEQPNSSLYTYEGTMTLNDRQI-PLSPDQMILRGATLRNTAWIFGLVIFTG 421
            L  ++  + +  P  S+  + G +T  + Q  PLS D  +       +       V++TG
Sbjct: 317  LYRIS--ITASVPEKSINNFLGKLTFGEIQSQPLSVDNTMWANTVFASAGTAIACVVYTG 374

Query: 422  HETKLLRNATATPIKRTAVEKIINRQXXXXXXXXXXXXXXXXXXXXXMSTADAKHLSYLY 481
             +T+   N + + +K   +E  IN                        +      ++ + 
Sbjct: 375  ADTRQAMNTSMSSVKTGLLELEIN-----------------SLSKILCACVFILSVALVA 417

Query: 482  LEGTNKAGLFFKDFLTFWILFSNLVPISLFVTVELIKYYQAFMIGSDLDLYYEKTDTPTV 541
              G N    ++ D + + ILFS ++P+SL V ++L K   A  I  D       T   T+
Sbjct: 418  FAGFNNND-WYVDIMRYLILFSTIIPVSLRVNLDLGKSVYAHQIEHD------STIPETI 470

Query: 542  VRTSSLVEELGQIEYIFSDKTGTLTRNIMEFKSCSIAGHCYIDKIPEDKTATVEDGIEVG 601
            VRTS++ E+LG+IEY+ SDKTGTLT+N ME K   +    Y      D    V D +   
Sbjct: 471  VRTSTIPEDLGRIEYLLSDKTGTLTQNDMELKKLHLGTVSYT----MDTMDIVTDYVRAM 526

Query: 602  YRKFDDLKKKLNDPSDEDSP-IINDFLTLLATCHTVIPEFQSDGSIKYQAASPDEGALVQ 660
                +     +   S +D P  + D +  LA CH V P F+ DG + YQAASPDE A+V+
Sbjct: 527  SDNLN--SSAVPSASKKDLPGRVRDLVLTLALCHQVTPTFE-DGELTYQAASPDEIAIVK 583

Query: 661  GGADLGYKFIIRKGNSVTVLLEETGEEKEYQLLNICEFNSTRKRMS-AIFRFPDGSIKLF 719
                +G     R  +S+T+L +++G   EY +L++  FNS  KRM   IF          
Sbjct: 584  FTESVGLTLFRRDRHSITLLHDQSGTNFEYDILHVFPFNSDNKRMGIVIFDKQKDEYWFL 643

Query: 720  CKGADTVILERLDDEANQYVEATMRHLEDYASEGLRTLCLAMRDISEGEYEEWNSIYNEA 779
             KGAD V+ + +  + N ++E    +L   A EGLRTL +  + +S+   + +   Y +A
Sbjct: 644  QKGADVVMSKIV--QKNDWLEEETGNL---AREGLRTLVIGRKRLSKKLLQTFTKDYEDA 698

Query: 780  ATTLDNRAEKLDEA-ANLIEKNLILIGATAIEDKLQDGVPETIHTLQEAGIKIWVLTGDR 838
            +  + NR   +    +  +E +L ++G T +EDKLQ+ V  +I  L+ AGIKIW+LTGD+
Sbjct: 699  SLMMLNREVTMSNVISKHLEHDLEILGLTGVEDKLQEDVKSSIELLRNAGIKIWMLTGDK 758

Query: 839  QETAINIGMSCRLLSEDMNLLIINEETRDDTERNLLE--KINALNEHQLSTHDMKSLALV 896
             ETA  + +S +L+S    +  + +  + +     LE  KIN             +  L+
Sbjct: 759  VETARCVSISAKLVSRGQYVHTVTKVNKPEGALTHLELLKINT------------NSCLL 806

Query: 897  IDGKSLGFALEPELEDYLLTVAKLCKAVICCRVSPLQKALVVKMVKRKXXXXXXAIASGA 956
            IDG+SLG  LE   + +   V  L  AVI CR +P QKA V   ++         I  G 
Sbjct: 807  IDGESLGLYLEYYRQQFFEIVVNL-PAVIACRCTPQQKADVATFIREVTGKRVCCIGDGG 865

Query: 957  NDVSMIQAAHVGVGISGMEGMQAARSADIALGQXXXXXXXXXVHGSWSYQRISVAILYSF 1016
            NDVSMIQ+A VGVGI G EG QA+ +AD ++ Q          HG  SY+R +    +  
Sbjct: 866  NDVSMIQSADVGVGIVGKEGKQASLAADFSITQFCHLSKLLLWHGRNSYKRSAKLAQFVI 925

Query: 1017 YKNTALYMTQFWYVFANAFSGQSIMESWTMSFYNLFFTVWPPFVIGVFDQFVSSRLLERY 1076
            ++   + + Q  Y  ++ F   ++ + W M  Y   +T+ P F +   D  +   L + Y
Sbjct: 926  HRGLLISVCQAVYSISSKFEPIALYQGWLMVGYATCYTMAPVFSL-TLDHDIDESLTKTY 984

Query: 1077 PQLYKLGQKGQFFSVYIFWGWIINGFFHSAIVFIGTILIYRYGFALNMHGELADHWSWGV 1136
            P+LYK    G+  S   F+ W++   F   ++             L+      D   +  
Sbjct: 985  PELYKELTAGKSLSYKTFFVWVVLSLFQGCVI-----------QGLSQGFTSLDELDFKR 1033

Query: 1137 TVYTTSVIIVLGKAALVTNQ---WTKFTLIAIPGSLLFWLIFFPIYASIFPHANISREYY 1193
             V  +  +++L +  +V  +   W K  +++   + L ++   P+    F    +SR  Y
Sbjct: 1034 LVALSFTVLILNELIMVAIEIYTWNKTMVVSEVVTFLIFVGSVPLLEEYFDLTYMSRPEY 1093

Query: 1194 GVVKHTYGSGVFWLTLIVLPIFALVRDFLWKYYKRMYEPETYHVIQE 1240
                  YG     L+L ++P++A       K   R   P +Y  +Q+
Sbjct: 1094 ------YGKLAIILSLSIIPVWAA------KALHRRLNPPSYAKVQQ 1128

>KLLA0C08393g 734655..738101 highly similar to sp|P40527 Saccharomyces
            cerevisiae YIL048w NEO1 ATPase whose overproduction
            confers neomycin resistance, start by similarity
          Length = 1148

 Score =  399 bits (1025), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 300/999 (30%), Positives = 479/999 (47%), Gaps = 73/999 (7%)

Query: 198  YSDNHISTTKYNFATFLPKFLFQEFSKYANLFFLCTSAIQQVPHVSPTNRYTTIGTLLVV 257
            Y  N IS  KYN  TF+P  L+++F  + NL+FL  +  Q +P +      + I  L  V
Sbjct: 173  YPSNVISNAKYNPFTFIPLILYEQFKFFFNLYFLIVALSQAIPQLRIGYLSSYIVPLAFV 232

Query: 258  LIVSAMKECIEDIKRANSDKELNNSTAEIFSEAHDDFVEKRWIDIRVGDIIRVKSEEPIP 317
            L V+  KE ++DI R   D+E NN   E+ ++     +  +  D++VGDII++K    +P
Sbjct: 233  LTVTMSKEAMDDINRRKRDREANNELYEVVNKPCP--IPSK--DLKVGDIIKLKKGARVP 288

Query: 318  ADTIILSSSEPEGLCYIETANLDGETNLKIKQSRVETAKFIDVKTLKNMNGKVVSEQPNS 377
            AD ++L ++EP G  +I+T  LDGET+ K++ +   T    +   L N+   + +  P  
Sbjct: 289  ADVVVLQTNEPNGESFIKTDQLDGETDWKLRLACSLTQSLTENDLLNNIT--ITASAPEH 346

Query: 378  SLYTYEGTMTLNDR-QIPLSPDQMILRGATLRNTAWIFGLVIFTGHETKLLRNATATPIK 436
            S++ + G +T  D    PLS D  +     L ++A     +++TG ET+   N T +  K
Sbjct: 347  SIHNFLGKITYKDSTSSPLSVDNTMWENTVLASSAACICCIVYTGRETRQALNTTKSKAK 406

Query: 437  RTAVEKIINRQXXXXXXXXXXXXXXXXXXXXXMSTADAKHLSYLYLEGTNKAGL----FF 492
               +E  IN                       +S      +  L +     AG     ++
Sbjct: 407  TGLLELEIN----------------------GLSKILCACVFLLSIMLVAFAGFNNNDWY 444

Query: 493  KDFLTFWILFSNLVPISLFVTVELIKYYQAFMIGSDLDLYYEKTDTPTVVRTSSLVEELG 552
             D + + ILFS ++P+SL V ++L K   A+ I  D      K    T+VRTS++ E+LG
Sbjct: 445  VDIMRYLILFSTIIPVSLRVNLDLGKSVYAYKIEHD------KQIEDTIVRTSTIPEDLG 498

Query: 553  QIEYIFSDKTGTLTRNIMEFKSCSIAGHCYIDKIPEDKTATVEDGIEVGYRKFDDLKKKL 612
            +IEY+ SDKTGTLT+N M+ K   +    Y ++  +     V D I+    +  +     
Sbjct: 499  RIEYLLSDKTGTLTQNDMQLKKIHLGTVSYTNETMD----IVTDFIQSMNSRTSNSTPTT 554

Query: 613  NDPSDEDSPIINDFLTLLATCHTVIPEFQSDGSIKYQAASPDEGALVQGGADLGYKFIIR 672
               +  D  I  D +T LA CH V P F+ DG + YQAASPDE A+V+    +G     R
Sbjct: 555  TRKNISDRVI--DLVTTLAICHNVTPTFE-DGELTYQAASPDEIAIVKFTESVGLSLFRR 611

Query: 673  KGNSVTVLLEETGEEKEYQLLNICEFNSTRKRMSAI-FRFPDGSIKLFCKGADTVILERL 731
              +S+++  + +G + EY +  +  FNS  KRM  I F           KGADTV+   +
Sbjct: 612  DRHSISLFHDHSGMKLEYDIKILFPFNSDSKRMGVIIFDKLKQEYWFLQKGADTVMSSIV 671

Query: 732  DDEANQYVEATMRHLEDYASEGLRTLCLAMRDISEGEYEEWNSIYNEAATTLDNRAEKLD 791
                N ++E    ++   A+EGLRTL +  + +S   +E++   Y+EA+ T+ +R   + 
Sbjct: 672  --VRNDWLEEETSNM---ATEGLRTLVIGRKKLSTNLFEQFEKEYSEASLTMMDREVHMQ 726

Query: 792  EAA-NLIEKNLILIGATAIEDKLQDGVPETIHTLQEAGIKIWVLTGDRQETAINIGMSCR 850
                  +E +L L+G T +EDKLQ  V  +I  L+ AGIKIW+LTGD+ ETA  + +S +
Sbjct: 727  NVVRKFLENDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAK 786

Query: 851  LLSEDMNLLIINEETRDDTERNLLEKINALNEHQLSTHDMKSLALVIDGKSLGFALEPEL 910
            L+S       ++  T+ +     L  +  L  +Q S        L+IDG+SLG  L+   
Sbjct: 787  LISRGQ---YVHTVTKVNKPEGALHHLEYLQVNQNS-------CLLIDGESLGLYLQYFP 836

Query: 911  EDYLLTVAKLCKAVICCRVSPLQKALVVKMVKRKXXXXXXAIASGANDVSMIQAAHVGVG 970
            +++   V  L   V+ CR +P QKA V   +++        I  G NDVSMIQ A VGVG
Sbjct: 837  DEFFDIVVNL-PTVVACRCTPQQKADVAVFIRQATGKRVCCIGDGGNDVSMIQCADVGVG 895

Query: 971  ISGMEGMQAARSADIALGQXXXXXXXXXVHGSWSYQRISVAILYSFYKNTALYMTQFWYV 1030
            I G EG QA+ +AD ++ Q          HG  SY+  +    +  ++   + + Q  Y 
Sbjct: 896  IVGKEGKQASLAADFSITQFCHLTKLLLWHGRNSYKSSAKLSQFVIHRGLIISVCQAVYS 955

Query: 1031 FANAFSGQSIMESWTMSFYNLFFTVWPPFVIGVFDQFVSSRLLERYPQLYKLGQKGQFFS 1090
              + F   ++ + W M  Y   +T+ P F +   D  +   L   YP+LYK    G+  S
Sbjct: 956  ICSMFEPLALYQGWLMVGYATCYTMAPVFSL-TLDHDIDESLTTLYPELYKELTLGKSLS 1014

Query: 1091 VYIFWGWIINGFFHSAIVFIGTILIYRYGFALNMHGELADHWSWGVTVYTTSVIIVLGKA 1150
               F+ W+    F   ++ + +    ++  +LN     +D        +T  V+  L   
Sbjct: 1015 FKTFFVWVALSVFQGCVIQMAS----QFFTSLND----SDFTKMVAISFTALVLNELIMV 1066

Query: 1151 ALVTNQWTKFTLIAIPGSLLFWLIFFPIYASIFPHANIS 1189
             L  N W K   I    +LL +L   P     F  + +S
Sbjct: 1067 GLEINTWNKIMAITEVVTLLIYLGSIPFLGEYFDLSYVS 1105

>CAGL0L00715g 86810..90244 highly similar to sp|P40527 Saccharomyces
            cerevisiae YIL048w NEO1 ATPase whose overproduction
            confers neomycin resistance, hypothetical start
          Length = 1144

 Score =  395 bits (1015), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 288/935 (30%), Positives = 466/935 (49%), Gaps = 64/935 (6%)

Query: 183  RVIHINDSLANSSFGYSDNHISTTKYNFATFLPKFLFQEFSKYANLFFLCTSAIQQVPHV 242
            R +H   +       +  N +S  KYN  TFLP  L+++F  + NL+FL  +  Q +P +
Sbjct: 149  REVHPGTTQVYDRHRFPSNEVSNAKYNAVTFLPTLLYEQFKFFFNLYFLLVALSQAIPAL 208

Query: 243  SPTNRYTTIGTLLVVLIVSAMKECIEDIKRANSDKELNNSTAEIFSEAHDDFVEKRWIDI 302
                  + +  L  VL V+  KE  +DI+R   D+E N    E+        V  +  D+
Sbjct: 209  RIGYLSSYVVPLAFVLTVTMAKEASDDIQRRRRDRESNMELYEVLGRPRP--VASK--DL 264

Query: 303  RVGDIIRVKSEEPIPADTIILSSSEPEGLCYIETANLDGETNLKIKQSRVETAKFIDVKT 362
            +VGD+I++     +PAD I+L SSEP G  +I+T  LDGET+ K++ +   T    +   
Sbjct: 265  KVGDLIKISKGARVPADLILLQSSEPSGEAFIKTDQLDGETDWKLRIACTLTQNLNEDDL 324

Query: 363  LKNMNGKVVSEQPNSSLYTYEGTMTLNDRQIP-LSPDQMILRGATLRNTAWIFGLVIFTG 421
            L+ +   + +  P  S++++ G +T  D     L+ D  +     L ++ +  G VI+TG
Sbjct: 325  LEKIT--ITASAPEKSIHSFLGRVTYKDTNTSGLTIDNTLWANTVLASSGFCIGCVIYTG 382

Query: 422  HETKLLRNATATPIKRTAVEKIINRQXXXXXXXXXXXXXXXXXXXXXMSTADAKHLSYLY 481
             +T+   N T+  +K   +E  IN                       +  A    LS L 
Sbjct: 383  RDTRQAMNTTSAKVKTGLLELEIN-------------------DISKILCACVFILSILL 423

Query: 482  LEGTNKAGL----FFKDFLTFWILFSNLVPISLFVTVELIKYYQAFMIGSDLDLYYEKTD 537
            +     AGL    ++ D + + ILFS ++P+SL V ++L K   A  I  D      KT 
Sbjct: 424  VVF---AGLHNDDWYVDIMRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHD------KTI 474

Query: 538  TPTVVRTSSLVEELGQIEYIFSDKTGTLTRNIMEFKSCSIAGHCYIDKIPEDKTATVEDG 597
              T+VRTS++ E+LG+IEY+ SDKTGTLT+N M+ K   +    Y  +  +  +  ++  
Sbjct: 475  PETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKVHLGNVSYTTETADIVSDYIQGM 534

Query: 598  IEVGYRKFDDLKKKLNDPSDEDSPIINDFLTLLATCHTVIPEFQSDGSIKYQAASPDEGA 657
            IE       +L  +     D  + +I D +T LA CH V P F+ D  + YQAASPDE A
Sbjct: 535  IESKNDSVTNLGPRSTTRKDAATHVI-DLITTLAICHNVTPTFEDD-ELTYQAASPDEIA 592

Query: 658  LVQGGADLGYKFIIRKGNSVTVLLEETGEEKEYQLLNICEFNSTRKRMSAIFRFPDGSIK 717
            +V+    +G     R  +S+++L E +G    Y +L +  FNS  KRM  I         
Sbjct: 593  IVKFTESVGLSLFKRDRHSMSLLHEHSGTILNYDVLTMFPFNSDTKRMGIIVYDKQKDQY 652

Query: 718  LFC-KGADTVILERLDDEANQYVEATMRHLEDYASEGLRTLCLAMRDISEGEYEEWNSIY 776
             F  KGADTV+   + +  N ++E    ++   A EGLRTL +  + +++  YE++   Y
Sbjct: 653  WFLQKGADTVMNRIVAN--NDWLEEETGNM---AREGLRTLVIGRKKLTKKIYEQFKKEY 707

Query: 777  NEAATTLDNRAEKL-DEAANLIEKNLILIGATAIEDKLQDGVPETIHTLQEAGIKIWVLT 835
             E + ++ NR +++ +  +  +E +L L+G T +EDKLQ  V  +I  L+ AGIKIW+LT
Sbjct: 708  EEVSASMYNREQEMANTISKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLT 767

Query: 836  GDRQETAINIGMSCRLLSEDMNLLIINEETRDDTERNLLE--KINALNEHQLSTHDMKSL 893
            GD+ ETA  + +S +L+S    + ++ + ++ +   N LE  K+N            K+ 
Sbjct: 768  GDKVETARCVSISAKLISRGQYVHVVTKLSKPEGAFNQLEYLKVN------------KNA 815

Query: 894  ALVIDGKSLGFALEPELEDYLLTVAKLCKAVICCRVSPLQKALVVKMVKRKXXXXXXAIA 953
             L+IDG+SLG  L+   +++   V  L   VI CR +P QKA V  +++         I 
Sbjct: 816  CLLIDGESLGMFLKYYRQEFFDVVVHL-PTVIACRCTPQQKADVALIIRELTGKRVCCIG 874

Query: 954  SGANDVSMIQAAHVGVGISGMEGMQAARSADIALGQXXXXXXXXXVHGSWSYQRISVAIL 1013
             G NDVSMIQ A VGVGI G EG QA+ +AD ++ Q          HG  SY+R +    
Sbjct: 875  DGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQFCHLTELLLWHGRNSYKRSAKLAQ 934

Query: 1014 YSFYKNTALYMTQFWYVFANAFSGQSIMESWTMSFYNLFFTVWPPFVIGVFDQFVSSRLL 1073
            +  ++   + + Q  +   + F   ++ + W M  Y   +T+ P F +   D  +   L 
Sbjct: 935  FVMHRGLIIAICQAVFSVCSQFEPIALYQGWLMVGYATCYTMAPVFSL-TLDHDIDESLT 993

Query: 1074 ERYPQLYKLGQKGQFFSVYIFWGWIINGFFHSAIV 1108
            + YP+LYK   +G+  S   F+ W+   F+   ++
Sbjct: 994  KMYPELYKDLTEGKSLSYKTFFVWVALSFYQGLVI 1028

>CAGL0H04477g 421857..426737 similar to sp|Q12674 Saccharomyces
            cerevisiae YMR162c, start by similarity
          Length = 1626

 Score =  318 bits (814), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 181/514 (35%), Positives = 286/514 (55%), Gaps = 26/514 (5%)

Query: 739  VEATMRHLEDYASEGLRTLCLAMRDISEGEYEEWNSIYNEAATTLDNRAEKLDEAANLIE 798
            +E T+  +E +++EGLRTL  A + IS  ++E+W + Y+EA T+L  R +K+DE    IE
Sbjct: 958  LEKTLEDIESFSTEGLRTLLFAHKWISNEDFEQWRTRYHEAKTSLSERKQKIDEVGAQIE 1017

Query: 799  KNLILIGATAIEDKLQDGVPETIHTLQEAGIKIWVLTGDRQETAINIGMSCRLLSEDMNL 858
              L L+GATAIEDKLQ+GV E I  ++ AGIK+W+LTGD++ETAINIG SC+L+ +   +
Sbjct: 1018 DELYLLGATAIEDKLQEGVSEAIEKIRRAGIKMWMLTGDKRETAINIGYSCKLIHDYSTV 1077

Query: 859  LIINEETRDDTERNLLEKINALNEHQLSTHDMKSLALVIDGKSLG-FALEPELEDYLLTV 917
            +I+       ++ N++ K+NA+++ ++ + ++    +VIDG +L  F   P L      +
Sbjct: 1078 VILTT-----SDENIISKMNAISQ-EVDSGNVAHCVIVIDGATLAMFEDNPTLMSVFTEL 1131

Query: 918  AKLCKAVICCRVSPLQKALVVKMVKR-KXXXXXXAIASGANDVSMIQAAHVGVGISGMEG 976
                 +V+CCR SP QKAL+V  ++         AI  GAND++MIQ+A +GVGI+G EG
Sbjct: 1132 CTKTDSVVCCRASPAQKALMVSNIRNTDKSIVTLAIGDGANDIAMIQSADIGVGIAGKEG 1191

Query: 977  MQAARSADIALGQXXXXXXXXXVHGSWSYQRISVAILYSFYKNTALYMTQFWYVFANAFS 1036
            +QA+RSAD ++GQ         VHG ++Y R +  IL +FYK    Y+TQ  Y     FS
Sbjct: 1192 LQASRSADYSIGQFRFILKLLLVHGRYNYIRTAKFILCTFYKELTFYLTQLIYQRYTMFS 1251

Query: 1037 GQSIMESWTMSFYNLFFTVWPPFVIGVFDQFVSSRLLERYPQLYKLGQKGQFFSVYIFWG 1096
            G S+ E W++S YN  FT  P   +G+F++ +    L   P+LY +G+  + F+  IF  
Sbjct: 1252 GTSLYEPWSLSMYNTLFTSLPVLCVGMFEKDLKPVTLLTVPELYSMGRLSKAFNWSIFAE 1311

Query: 1097 WIINGFFHSAIVFIGTIL-IYRYGFALNMHGELADH--WSWGVTVYTTSVIIVLGKAALV 1153
            W+   F  +A   I T L I  +G        L+D+  +  G   ++ +V ++  KA  +
Sbjct: 1312 WV---FLGTANALIITFLNIVAWG-----ETSLSDNTLYPLGFVNFSATVALINVKAQFI 1363

Query: 1154 ---TNQWTKFTLIAIP-GSLLFWLIFFPIYASIFPHANISREYYGVVKHTYGSGVFWLTL 1209
                  W  FT + +  G  L W    PI   +     I    YG+  H      FW T 
Sbjct: 1364 EMRNRNWLAFTSVILSCGGWLVWCCALPI---LNRSDGIYDVTYGLYHHFGRDITFWCTS 1420

Query: 1210 IVLPIFALVRDFLWKYYKRMYEPETYHVIQEMQK 1243
            ++L +  ++ D ++K +K M  P    +  E+++
Sbjct: 1421 LILAVLPIIVDVVYKTFKIMLAPSDSDIFAELEQ 1454

 Score =  249 bits (637), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 148/444 (33%), Positives = 228/444 (51%), Gaps = 56/444 (12%)

Query: 196 FGYSDNHISTTKYNFATFLPKFLFQEFSKYANLFFLCTSAIQQVPHVSPTNRYTTIGTLL 255
           + Y +N I++++Y   +F P+ L+ +FSK AN++F   + +Q +P  S T  YTTI  L 
Sbjct: 121 YAYCNNLITSSRYTIISFFPRQLYAQFSKLANVYFFIVAILQMIPGWSTTGTYTTIVPLC 180

Query: 256 VVLIVSAMKECIEDIKRANSDKELNNSTAEIFSEAHDD---------------------- 293
           V + +S  +E  +D +R   DKE NN   ++    H+                       
Sbjct: 181 VFMAISMAREAYDDYRRHKLDKEENNKLTKVLQILHEREDNDLDLENNAQHSANNPESIS 240

Query: 294 -----------------FVEKRWIDIRVGDIIRVKSEEPIPADTIILSSSEPEGLCYIET 336
                             VEK+W DIRVGD + ++ ++ +PAD +IL+S       +IET
Sbjct: 241 NLYFNNFDLLAKKYNVRIVEKKWKDIRVGDFVLLQQDDWVPADILILTSDGDNSEVFIET 300

Query: 337 ANLDGETNLKIKQSRVETAKFIDVKT-LKNMNGKVVSEQPNSSLYTYEGTMTLND----- 390
             LDGETNLK K    E  K     + L N+N +V  E PN+ LY +EG + LN      
Sbjct: 301 MALDGETNLKGKVPHPEINKLTKSASGLANINAQVTVEDPNNDLYNFEGNLELNSGSSSK 360

Query: 391 RQIPLSPDQMILRGATLRNTAWIFGLVIFTGHETKLLRNATATPIKRTAVEKIINRQXXX 450
           ++ PL PD +I RG+ +RNT    G+VIFTG E+K+  NA   P  RT   K+  +    
Sbjct: 361 KKYPLGPDNVIYRGSIIRNTRNCVGMVIFTGEESKIRMNALRNP--RTKAPKLQRKINMI 418

Query: 451 XXXXXXXXXXXXXXXXXXMSTADAKHLS-----YLYLEGTNKAGLFFKDFLTFWILFSNL 505
                              +    ++++     YL  E    A       ++F I+++ +
Sbjct: 419 VVFMVFVVACMSLFSYLGHTIQIKRYVNNNKAWYLLQEDAGTA----PTIMSFIIMYNTI 474

Query: 506 VPISLFVTVELIKYYQAFMIGSDLDLYYEKTDTPTVVRTSSLVEELGQIEYIFSDKTGTL 565
           +P+SL+VT+ELIK  Q+ M+  D+D+Y+ ++DTP  VRT++++EELGQ+ YIFSDKTGTL
Sbjct: 475 IPLSLYVTMELIKVAQSRMMEWDIDMYHAESDTPCAVRTATILEELGQVSYIFSDKTGTL 534

Query: 566 TRNIMEFKSCSIAGHCYIDKIPED 589
           T N M F+  S  G  ++    +D
Sbjct: 535 TDNKMLFRKLSFCGTSWVHNATQD 558

 Score = 89.4 bits (220), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 49/118 (41%), Positives = 69/118 (58%), Gaps = 12/118 (10%)

Query: 626 FLTLLATCHTVIPEFQSDGS-----IKYQAASPDEGALVQGGADLGYKFIIRKGNSVTVL 680
           F+  LA CH  +P+   +G+     I+YQ++SPDE ALV    D+GY    R  N +T+ 
Sbjct: 678 FILSLAICHICLPKRTEEGNDEDDIIEYQSSSPDELALVTAARDMGYIVYNRNANILTLK 737

Query: 681 -----LEETGEEKEYQLLNICEFNSTRKRMSAIFRFPD--GSIKLFCKGADTVILERL 731
                 +E    + +++L + +FNS RKRMS I R P+    + LFCKGAD VILERL
Sbjct: 738 TFPDGFDELPRFENFEILELVDFNSQRKRMSVIVRVPEEKDRVLLFCKGADNVILERL 795

>YMR162C (DNF3) [4117] chr13 complement(578950..583920) Member of the
            Drs2p-like family of the P-type ATPase superfamily of
            membrane transporters [4971 bp, 1656 aa]
          Length = 1656

 Score =  314 bits (804), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 190/537 (35%), Positives = 298/537 (55%), Gaps = 37/537 (6%)

Query: 724  DTVILERLDDEA----NQYV-EATMRHLEDYASEGLRTLCLAMRDISEGEYEEWNSIYNE 778
            DT ILE +  +      +YV E T++ ++++++EGLRTL  A + I  G+YE WN  Y++
Sbjct: 998  DTEILEHIGSDELILNEEYVIERTLQAIDEFSTEGLRTLVYAYKWIDIGQYENWNKRYHQ 1057

Query: 779  AATTLDNRAEKLDEAANLIEKNLILIGATAIEDKLQDGVPETIHTLQEAGIKIWVLTGDR 838
            A T+L +R  K+DEA   IE  L L+G TAIEDKLQDGV E I  ++ AGIK+W+LTGD+
Sbjct: 1058 AKTSLTDRKIKVDEAGAEIEDGLNLLGVTAIEDKLQDGVSEAIEKIRRAGIKMWMLTGDK 1117

Query: 839  QETAINIGMSCRLLSEDMNLLIINEETRDDTERNLLEKINALNEHQLSTHDMKSLALVID 898
            +ETAINIG SC L+ +   ++I+       T+ N++ K+NA+++ ++ + ++    +VID
Sbjct: 1118 RETAINIGYSCMLIKDYSTVVILTT-----TDENIISKMNAVSQ-EVDSGNIAHCVVVID 1171

Query: 899  GKSLG-FALEPELEDYLLTVAKLC---KAVICCRVSPLQKALVVKMVKRKX-XXXXXAIA 953
            G ++  F   P    Y+    +LC    +VICCR SP QKAL+V  ++         AI 
Sbjct: 1172 GATMAMFEGNPT---YMSVFVELCTKTDSVICCRASPSQKALMVSNIRNTDPNLVTLAIG 1228

Query: 954  SGANDVSMIQAAHVGVGISGMEGMQAARSADIALGQXXXXXXXXXVHGSWSYQRISVAIL 1013
             GAND++MIQ+A +GVGI+G EG+QA+R +D ++GQ         VHG ++Y R S  +L
Sbjct: 1229 DGANDIAMIQSADIGVGIAGKEGLQASRVSDYSIGQFRFLLKLLFVHGRYNYIRTSKFML 1288

Query: 1014 YSFYKNTALYMTQFWYVFANAFSGQSIMESWTMSFYNLFFTVWPPFVIGVFDQFVSSRLL 1073
             +FYK    Y TQ  Y     FSG S+ E W++S +N  FT  P   IG+F++ +    L
Sbjct: 1289 CTFYKEITFYFTQLIYQRYTMFSGSSLYEPWSLSMFNTLFTSLPVLCIGMFEKDLKPMTL 1348

Query: 1074 ERYPQLYKLGQKGQFFSVYIFWGWIINGFFHSAIV-FIGTILIYRYGFALNMHGELADH- 1131
               P+LY  G+  Q F+  IF  W+I    +S I+ F+  ++   +G +      L+D+ 
Sbjct: 1349 LTVPELYSYGRLSQGFNWLIFMEWVILATTNSLIITFLNVVM---WGMS-----SLSDNT 1400

Query: 1132 -WSWGVTVYTTSVIIVLGKAALV---TNQWTKFTLIAIP-GSLLFWLIFFPIYASIFPHA 1186
             +  G+  +T  V ++  K+  V      W  FT + +  G  L W    PI  +     
Sbjct: 1401 MYPLGLINFTAIVALINVKSQFVEMHNRNWLAFTSVVLSCGGWLVWCCALPILNNTDQIY 1460

Query: 1187 NISREYYGVVKHTYGSGVFWLTLIVLPIFALVRDFLWKYYKRMYEPETYHVIQEMQK 1243
            +++   YG   H      FW T +VL +  +  D ++K +K M  P    +  E+++
Sbjct: 1461 DVA---YGFYNHFGKDITFWCTSLVLALLPITLDIVYKTFKVMIWPSDSDIFAELEQ 1514

 Score =  232 bits (592), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 164/537 (30%), Positives = 256/537 (47%), Gaps = 94/537 (17%)

Query: 132 ESFEMNHYNAVTNN-----ELDDNYLDSRNKFNIKILFNRYI---LRKNVGDAEGNGEPR 183
           E +EM  Y +   +     ++ D  LD R  F+ K    R+I   L  N  + +     R
Sbjct: 68  EDYEMEEYGSPDVSYSIITKILDTILDRRRTFHSKD--GRHIPIILDHNAIEYKQAATKR 125

Query: 184 VIHINDSLANSSFGYSDNHISTTKYNFATFLPKFLFQEFSKYANLFFLCTSAIQQVPHVS 243
             H+ D   N    Y DN I++++Y F +FLP+ L+ +FSK AN +F   + +Q +P  S
Sbjct: 126 DGHLIDERFNKP--YCDNRITSSRYTFYSFLPRQLYAQFSKLANTYFFIVAVLQMIPGWS 183

Query: 244 PTNRYTTIGTLLVVLIVSAMKECIEDIKRANSD------------KELNNSTAEIF---- 287
            T  YTTI  L V + +S  +E  +D +R   D            K+ NN   E++    
Sbjct: 184 TTGTYTTIIPLCVFMGISMTREAWDDFRRHRLDKEENNKPVGVLVKDGNNDAQEVYTLPS 243

Query: 288 ---------------------------SEAH------DDFV-----------EKRWIDIR 303
                                      S+ H      ++F            +K+W  +R
Sbjct: 244 SVVSSTAYLTKSAAAENNPPLNDDRNSSQGHFLDTHFNNFELLKNKYNVHIHQKKWEKLR 303

Query: 304 VGDIIRVKSEEPIPADTIILSSSEPEGLCYIETANLDGETNLKIKQSRVETAKFIDVKT- 362
           VGD + +  ++ +PAD ++L+       C++ET  LDGETNLK KQ   E  K     + 
Sbjct: 304 VGDFVLLTQDDWVPADLLLLTCDGENSECFVETMALDGETNLKSKQPHPELNKLTKAASG 363

Query: 363 LKNMNGKVVSEQPNSSLYTYEGTMTLNDR------QIPLSPDQMILRGATLRNTAWIFGL 416
           L N+N +V  E PN  LY +EG + L +       + PL PD +I RG+ LRNT  + G+
Sbjct: 364 LANINAQVTVEDPNIDLYNFEGNLELKNHRNDTIMKYPLGPDNVIYRGSILRNTQNVVGM 423

Query: 417 VIFTGHETKLLRNATATPIKRTAVEKIINRQXXXXXXXXXXXXXXXXXXXXXMSTADAKH 476
           VIF+G ETK+  NA   P  RT   K+  +                            K+
Sbjct: 424 VIFSGEETKIRMNALKNP--RTKAPKLQRKINMIIVFMVFVVATISLFSYLGHVLHKKKY 481

Query: 477 LSYLYLEGTNKAGLFFK-------DFLTFWILFSNLVPISLFVTVELIKYYQAFMIGSDL 529
           +        NKA   F+         ++F I+++ ++P+SL+VT+E+IK  Q+ M+  D+
Sbjct: 482 ID------QNKAWYLFQADAGVAPTIMSFIIMYNTVIPLSLYVTMEIIKVVQSKMMEWDI 535

Query: 530 DLYYEKTDTPTVVRTSSLVEELGQIEYIFSDKTGTLTRNIMEFKSCSIAGHCYIDKI 586
           D+Y+ +T+TP   RT++++EELGQ+ YIFSDKTGTLT N M F+  S+ G  ++  +
Sbjct: 536 DMYHAETNTPCESRTATILEELGQVSYIFSDKTGTLTDNKMIFRKFSLCGSSWLHNV 592

 Score = 90.9 bits (224), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 55/157 (35%), Positives = 81/157 (51%), Gaps = 25/157 (15%)

Query: 626 FLTLLATCHTVIP-----EFQSDGSIKYQAASPDEGALVQGGADLGYKFIIRKGNSVTVL 680
           F   LA CH+ +P     E   + SI+YQ++SPDE ALV    DLGY  + R    +T+ 
Sbjct: 731 FFLSLALCHSCLPKKTHNESIGEDSIEYQSSSPDELALVTAARDLGYIVLNRNAQILTIK 790

Query: 681 LEETGEEKE-----YQLLNICEFNSTRKRMSAIFRFPD--GSIKLFCKGADTVILERLDD 733
               G + E     Y++LN  +FNS RKRMS + R P+    + L CKGAD VI+ERL  
Sbjct: 791 TFPDGFDGEAKLENYEILNYIDFNSQRKRMSVLVRMPNQPNQVLLICKGADNVIMERL-- 848

Query: 734 EANQYVEATMRHLEDYASEGLRTLCLAMRDISEGEYE 770
                      H  + A++ +  +C + ++  + E E
Sbjct: 849 -----------HDRELAAKKMADICTSTKERKDAEAE 874

>KLLA0E01650g complement(155975..160627) similar to sp|Q12674
            Saccharomyces cerevisiae YMR162c, start by similarity
          Length = 1550

 Score =  310 bits (795), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 179/512 (34%), Positives = 290/512 (56%), Gaps = 22/512 (4%)

Query: 739  VEATMRHLEDYASEGLRTLCLAMRDISEGEYEEWNSIYNEAATTLDNRAEKLDEAANLIE 798
            +E T+  ++++++EGLRTL  + + I   EY+ W + Y+EA T+L NR+ ++ E    IE
Sbjct: 937  LEKTLNAIDEFSTEGLRTLLYSYKWIPAEEYKAWEAKYHEAKTSLTNRSTQIAEVGGHIE 996

Query: 799  KNLILIGATAIEDKLQDGVPETIHTLQEAGIKIWVLTGDRQETAINIGMSCRLLSEDMNL 858
             +L L+GATAIEDKLQ+GVPE I  ++ AGIK+W+LTGD++ETAINIG +C+L+ +   +
Sbjct: 997  TDLELLGATAIEDKLQEGVPEAIQKIRRAGIKMWMLTGDKRETAINIGYACKLIYDYSTV 1056

Query: 859  LIINEETRDDTERNLLEKINALNEHQLSTHDMKSLALVIDGKSLG-FALEPELEDYLLTV 917
            +I+ +   DD   NL+ K+ AL E +L T  +    LVIDG SL  F   P +    + +
Sbjct: 1057 VILKKN--DD---NLISKMTALGE-ELDTGKIAHCVLVIDGASLAVFENNPTMMSVFIEL 1110

Query: 918  AKLCKAVICCRVSPLQKALVVKMVKRKXX-XXXXAIASGANDVSMIQAAHVGVGISGMEG 976
                 +VICCR SP QKAL+V  ++ K       AI  GAND++MIQ+A +GVGI+G EG
Sbjct: 1111 CTKTDSVICCRASPSQKALIVTNIRLKNKDLVTLAIGDGANDIAMIQSADIGVGITGKEG 1170

Query: 977  MQAARSADIALGQXXXXXXXXXVHGSWSYQRISVAILYSFYKNTALYMTQFWYVFANAFS 1036
            +QA+RS+D ++ Q         VHG ++Y R S  +L +FYK    Y+TQ  Y     FS
Sbjct: 1171 LQASRSSDYSIAQFRYLLKLLFVHGRYNYVRTSKFVLCTFYKEVLFYLTQMIYQRQTMFS 1230

Query: 1037 GQSIMESWTMSFYNLFFTVWPPFVIGVFDQFVSSRLLERYPQLYKLGQKGQFFSVYIFWG 1096
            G S+ E W++S +N  FT  P   IG+F++ +    L   P+LY +GQK Q F++ IF  
Sbjct: 1231 GTSLYEPWSLSMFNTLFTSLPVICIGMFEKDLKPMTLLAVPELYTMGQKCQAFNLKIFLV 1290

Query: 1097 WIINGFFHSAIVFIGTILIYR-YGFALNMHGELADHWSWGVTVYTTSVIIVLGKAALVTN 1155
            W++     + I  + T L +  +GF       +   +  GV  +T+   ++  K   +  
Sbjct: 1291 WMLTA---AGISVLITFLNFEIWGFTAQSDNSI---YPIGVINFTSICFLINVKCQFIET 1344

Query: 1156 Q---WTKFTLIAIPGSLLFWLIFFPIYASIFPHANISREYYGVVKHTYGSGV-FWLTLIV 1211
            +   W  F  + I  S + W+++  +   I+    I     G+  H +G  + +W + ++
Sbjct: 1345 RNRNWLAFASLLI--SCIGWILWCCLLPGIYGENAIYDVLIGLY-HQFGRDITWWASCLI 1401

Query: 1212 LPIFALVRDFLWKYYKRMYEPETYHVIQEMQK 1243
            L +F ++ D + + ++ M  P    +  E+++
Sbjct: 1402 LIMFPMMIDIVCQTFRAMIWPTDGDIFAELEQ 1433

 Score =  231 bits (589), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 147/451 (32%), Positives = 228/451 (50%), Gaps = 73/451 (16%)

Query: 198 YSDNHISTTKYNFATFLPKFLFQEFSKYANLFFLCTSAIQQVPHVSPTNRYTTIGTLLVV 257
           Y DN I++++Y   +FLP+ L+ +FSK AN +FL  + +Q +P  S T  YTTI  L + 
Sbjct: 116 YRDNVITSSRYTVYSFLPRQLYAQFSKLANAYFLLVAILQMIPSWSTTGTYTTIVPLSIF 175

Query: 258 LIVSAMKECIEDIKRANSDKELNNSTAEI------------------------------- 286
           L +S  +E  +D KR   DKE NN + ++                               
Sbjct: 176 LSISMAREAWDDFKRHRLDKEENNKSTKVLTMGKDHDELESDSIYSLSNVSARSTDAILS 235

Query: 287 -FSEAH-----------DDFV--------------EKRWIDIRVGDIIRVKSEEPIPADT 320
            F+  H           D F               +K W D++VG+ + + S++ +PAD 
Sbjct: 236 DFNSMHNLNDVTEPSYTDHFTNLNLLRSQFDIHIKKKEWKDLKVGEFVLLNSDDWVPADI 295

Query: 321 IILSSSEPEGLCYIETANLDGETNLKIKQSRVETAKFIDVKTLKNMNGKVVS-EQPNSSL 379
           ++LS+       ++ET  LDGETNLK K    E AK +   T  +M+    + E PN+ L
Sbjct: 296 LLLSTDGENNEAFVETMALDGETNLKSKNPLPELAKRMTSATGLSMHSATTTLEDPNNDL 355

Query: 380 YTYEGTMTLNDRQIPLSPDQMILRGATLRNTAWIFGLVIFTGHETKLLRNATATPIKRTA 439
           Y +EGT+ ++    PL  D ++ RG+ LRNT  I G+VIFTG ETK+  NA   P  RT 
Sbjct: 356 YNFEGTVEIDGELYPLGSDNVVYRGSILRNTQSIVGIVIFTGEETKIRMNAIKNP--RTK 413

Query: 440 VEKIINRQXXXXXXXXXXXXXXXXXXXXXMSTADAKHLSYLYLEGTNKAGLFFKD----- 494
             K+  +                      M +   +H+        N+A   F++     
Sbjct: 414 APKLQGK------INLIVLFMVFVVAAMAMFSYLGQHILKKNYVDNNRAWYLFQEDAGTA 467

Query: 495 --FLTFWILFSNLVPISLFVTVELIKYYQAFMIGSDLDLYYEKTDTPTVVRTSSLVEELG 552
              ++F I+++ L+P+SL+VT E+IK  Q+ ++  D+D+Y+ ++DTP   RT++++EELG
Sbjct: 468 PTIMSFIIMYNTLIPLSLYVTTEIIKAMQSKLMEWDIDMYHIESDTPCESRTATILEELG 527

Query: 553 QIEYIFSDKTGTLTRNIMEFKSCSIAGHCYI 583
           Q+ YIFSDKTGTLT N M F+  SI G  ++
Sbjct: 528 QVSYIFSDKTGTLTDNKMIFRKFSICGSSWL 558

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 47/115 (40%), Positives = 67/115 (58%), Gaps = 9/115 (7%)

Query: 626 FLTLLATCHTVIPEFQSDG--SIKYQAASPDEGALVQGGADLGYKFIIRKGNSVTVLLEE 683
           F+  LA CHT +P+   DG  SI YQ++SPDE ALV    D+G+    R  +++++    
Sbjct: 672 FILSLALCHTCLPKKTHDGTDSILYQSSSPDELALVTAARDMGFVVTNRNSSTLSIATYP 731

Query: 684 TGEE-----KEYQLLNICEFNSTRKRMSAIFRFP--DGSIKLFCKGADTVILERL 731
            G +     ++Y++L    F+S RKRMS   + P  D  + L CKGAD VILERL
Sbjct: 732 NGFDDQPIVEDYEVLEYINFDSQRKRMSVAVKMPNDDDRVLLICKGADNVILERL 786

>Kwal_23.3556
          Length = 1597

 Score =  292 bits (747), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 174/515 (33%), Positives = 290/515 (56%), Gaps = 28/515 (5%)

Query: 739  VEATMRHLEDYASEGLRTLCLAMRDISEGEYEEWNSIYNEAATTLDNRAEKLDEAANLIE 798
            +E T++ +ED+++ GLRTL  + + I   +YE+W+  Y+ A T+L+NR EK+     L+E
Sbjct: 957  LERTLQAIEDFSTSGLRTLLYSYKWIPSEDYEKWSKKYHAAKTSLENRKEKMHSVGELVE 1016

Query: 799  KNLILIGATAIEDKLQDGVPETIHTLQEAGIKIWVLTGDRQETAINIGMSCRLLSEDMNL 858
             +L L+GATAIEDKLQ+GV + I  ++ AGIK+W+LTGD++ETAINIG SC L+ +   +
Sbjct: 1017 TSLHLLGATAIEDKLQEGVADAIDKIRRAGIKMWMLTGDKRETAINIGYSCNLIHDYSTV 1076

Query: 859  LIINEETRDDTERNLLEKINALNEHQLSTHDMKSLALVIDGKSL-GFALEPELEDYLLTV 917
            +I++ +     + N+  K+ A+++ ++   ++    +VIDG +L  F   P L    + +
Sbjct: 1077 VILSAK-----DENISSKLTAVSQ-EIERGNIAHCVVVIDGSTLTTFESNPTLMSVFVEL 1130

Query: 918  AKLCKAVICCRVSPLQKALVVKMVKR-KXXXXXXAIASGANDVSMIQAAHVGVGISGMEG 976
                 +VICCR SP QKAL+V  ++         AI  GAND++MIQ+A +GVGI+G EG
Sbjct: 1131 CTKTDSVICCRASPSQKALMVTHIRNTDKKLVTLAIGDGANDIAMIQSADIGVGIAGKEG 1190

Query: 977  MQAARSADIALGQXXXXXXXXXVHGSWSYQRISVAILYSFYKNTALYMTQFWYVFANAFS 1036
            +QA+RS+D ++ Q         VHG ++Y R +  +L +FYK    Y+TQ  Y     FS
Sbjct: 1191 LQASRSSDYSIAQFRFLLKLLLVHGRYNYVRTTKFVLCTFYKELLFYLTQMIYQRHTMFS 1250

Query: 1037 GQSIMESWTMSFYNLFFTVWPPFVIGVFDQFVSSRLLERYPQLYKLGQKGQFFSVYIFWG 1096
            G S+ E W++S +N  FT  P   IG+F++ +    L   P+LY +G+  Q F++ +F  
Sbjct: 1251 GTSLYEPWSLSMFNTLFTSLPVLCIGMFEKDLKPMTLLAIPELYSIGRLSQSFNLRVFLY 1310

Query: 1097 WIINGFFHSAIVFIGTILIYRYGFALNMHGELADH--WSWGVTVYTTSVIIVLGKAALV- 1153
            W+     +S I+   T L ++  +A++    L+D+  +  GV  +T  + +V  K  L+ 
Sbjct: 1311 WMFLAALNSLII---TFLNWKI-WAVS---SLSDNTVYPIGVINFTAIITLVNVKCQLLE 1363

Query: 1154 ---TNQWTKFTLIAIPGSLLFWLIFFP-IYASIFPHANISREYYGVVKHTYGSGV-FWLT 1208
                N     +L+   G  L W    P IY+    +  ++  Y+      +G+ + FW  
Sbjct: 1364 THNRNVLAICSLVISVGGWLLWCCLLPGIYSEDGMYDVLTGLYF-----QFGNDITFWCA 1418

Query: 1209 LIVLPIFALVRDFLWKYYKRMYEPETYHVIQEMQK 1243
             +VL +  L+ D ++K  K M  P    +  E+++
Sbjct: 1419 CLVLVVLPLIIDVVFKTVKIMIFPSDSEISMELEQ 1453

 Score =  243 bits (621), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 151/474 (31%), Positives = 241/474 (50%), Gaps = 78/474 (16%)

Query: 178 GNGEPRVIHINDSLANSSFGYSDNHISTTKYNFATFLPKFLFQEFSKYANLFFLCTSAIQ 237
           G+G  +   + D    S   Y  N I++++Y   TFLP+ L+ +FS+ AN +F   + +Q
Sbjct: 90  GDGGSQTAKLTDE--RSGKPYISNLITSSRYTIYTFLPRQLYAQFSRLANAYFFLVAVLQ 147

Query: 238 QVPHVSPTNRYTTIGTLLVVLIVSAMKECIEDIKRANSDKELNN---------------- 281
            +P  S T  YTTI  LL+ + +S  +E  +D +R   D+E N+                
Sbjct: 148 MIPGWSTTGTYTTIVPLLIFMGISMSREAWDDFRRHKLDREENDKTARVLVKSSSPHTEF 207

Query: 282 ----------------------------STAEIFSEAHDDF--------------VEKRW 299
                                       STAE  +  +DD               VEK+W
Sbjct: 208 SRPNSLYSLPQWQQSATSTSMLTNPTLESTAEAATSQNDDHTNWDLLKSKYGVEAVEKKW 267

Query: 300 IDIRVGDIIRVKSEEPIPADTIILSSSEPEGLCYIETANLDGETNLKIKQSRVETAKFID 359
            DI+VGD + ++ +E +PAD ++L+ S+ +  C++ET  LDGETNLK KQ   E ++ + 
Sbjct: 268 KDIKVGDYVVLEQDEWVPADMLVLTCSDEKNECFVETMALDGETNLKNKQPLTEVSEVMK 327

Query: 360 VKT-LKNMNGKVVSEQPNSSLYTYEGTMTL--NDRQIPLSPDQMILRGATLRNTAWIFGL 416
               L     KV  E PN  L+ +EG + L   +R++ + PD +I RG+ +RNT+   G+
Sbjct: 328 TAAGLTEFKAKVTVEDPNIDLHNFEGNLELLGENRKLTIGPDHIIYRGSIIRNTSNAVGM 387

Query: 417 VIFTGHETKLLRNATATP-IKRTAVEKIINRQXXXXXXXXXXXXXXXXXXXXXMSTADAK 475
           V+FTG ETK+  NA   P IK   +++ IN                        S    +
Sbjct: 388 VVFTGEETKIRMNAIKNPRIKAPKLQRAIN--------LIVLFMVFVVASMALFSLLGQR 439

Query: 476 HLSYLYLEGTNKAGLFFKD------FLTFWILFSNLVPISLFVTVELIKYYQAFMIGSDL 529
            +   Y++      LF  D       ++F I+++ L+P+SL+VT+E+IK  Q+ ++  D+
Sbjct: 440 IIKKKYVDNNRAWYLFNSDAGLAPTVMSFIIMYNTLIPLSLYVTMEIIKAMQSKLMEWDI 499

Query: 530 DLYYEKTDTPTVVRTSSLVEELGQIEYIFSDKTGTLTRNIMEFKSCSIAGHCYI 583
           D+Y+ +T+TP   RT++++EELGQ+ YIFSDKTGTLT N M F++ S+ G  +I
Sbjct: 500 DMYHAETNTPCESRTATILEELGQVSYIFSDKTGTLTDNKMVFRALSVCGSSWI 553

 Score = 95.1 bits (235), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 64/173 (36%), Positives = 92/173 (53%), Gaps = 16/173 (9%)

Query: 581 CYIDKIPEDKTATVEDGIEVGYRKFDDLKKKLN-DPSDEDSPIINDFLTLLATCHTVIPE 639
           C  DK P  K    E   + G R   +L + +  +P+   +  ++ F+  LA CH  +P+
Sbjct: 624 CEEDKNP--KKIEPEKSSKTGLRSSTELIRYIQQNPNTHFAKKVSFFILSLALCHACLPK 681

Query: 640 FQS----DGSIKYQAASPDEGALVQGGADLGYKFIIRKGNSVTVLLEETGEEKE-----Y 690
             S    +  ++YQA+SPDE ALV    D+GY  + R  + +T+     G + E     Y
Sbjct: 682 SSSGVEGEDCVEYQASSPDELALVTAARDMGYAVMNRNSDVLTIKTYPNGFDAEPHLDKY 741

Query: 691 QLLNICEFNSTRKRMSAIFRFP--DGSIKLFCKGADTVILERL--DDEANQYV 739
           ++LN  EF+S RKRMS + R P  +  I L CKGAD VILERL   D ANQ +
Sbjct: 742 EILNNIEFSSHRKRMSVLVRLPHEENRILLICKGADNVILERLHNSDLANQKI 794

>Scas_669.3
          Length = 1638

 Score =  286 bits (731), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 169/516 (32%), Positives = 285/516 (55%), Gaps = 30/516 (5%)

Query: 739  VEATMRHLEDYASEGLRTLCLAMRDISEGEYEEWNSIYNEAATTLDNRAEKLDEAANLIE 798
            +E T++ ++++++EGLRTL  + + +   EY++W   Y++A  +L NR  K+ E    IE
Sbjct: 992  IEKTIQAIDEFSTEGLRTLVYSYKWVDLQEYQQWEDRYHDAKISLTNRKSKIAEVGEEIE 1051

Query: 799  KNLILIGATAIEDKLQDGVPETIHTLQEAGIKIWVLTGDRQETAINIGMSCRLLSEDMNL 858
            ++L L+GATAIEDKLQ+GV E I  ++ AGIKIW+LTGD++ETAINIG SC+L+ +   +
Sbjct: 1052 QDLQLLGATAIEDKLQEGVSEAIEKIRRAGIKIWMLTGDKRETAINIGYSCKLIYDYSTV 1111

Query: 859  LIINEETRDDTERNLLEKINALNEHQLSTHDMKSLALVIDGKSLG-FALEPELEDYLLTV 917
            +I+ +      + N++ K+NA+++ ++ + ++    ++IDG +L  F   P L    + +
Sbjct: 1112 VILAK-----GDENIISKMNAISQ-EVDSGNVAHCVIIIDGSTLAMFEGNPTLMSVFIEL 1165

Query: 918  AKLCKAVICCRVSPLQKALVVKMVKRKXXXXXX-AIASGANDVSMIQAAHVGVGISGMEG 976
                 +VICCR SP QK+L+V  ++         AI  GAND++MIQ+A +G+GI G EG
Sbjct: 1166 CTKTDSVICCRASPSQKSLMVTNIRNSNKNLVTLAIGDGANDIAMIQSADIGIGIGGKEG 1225

Query: 977  MQAARSADIALGQXXXXXXXXXVHGSWSYQRISVAILYSFYKNTALYMTQFWYVFANAFS 1036
            +QA+R+AD ++ Q         VHG ++Y R +  IL +F+K    Y+TQ  +     FS
Sbjct: 1226 LQASRTADYSIAQFRFILKLLLVHGRYNYIRTAKFILCTFFKEITFYLTQLIFQRYTMFS 1285

Query: 1037 GQSIMESWTMSFYNLFFTVWPPFVIGVFDQFVSSRLLERYPQLYKLGQKGQFFSVYIFWG 1096
            G S+ E W++S +N  FT  P   IG+F++ +    L   P+LY +G+  Q F++ IF  
Sbjct: 1286 GSSLYEPWSLSMFNTLFTSLPVLCIGMFEKDLKPMTLLTIPELYSMGRLSQGFNLIIFGE 1345

Query: 1097 WIINGFFHSAIVFIGTILIYRYGFALNMHGE--LADH--WSWGVTVYTTSVIIVLGKAAL 1152
            W+I    ++ ++    I+I+         GE  L+DH  +  GV  +T  V +V  K   
Sbjct: 1346 WVIQAAAYALLITFLNIIIW---------GETALSDHTMYPLGVINFTAIVALVNVKCQF 1396

Query: 1153 V---TNQWTKFTLIAIP-GSLLFWLIFFPIYASIFPHANISREY-YGVVKHTYGSGVFWL 1207
            +      W  FT + +  G  L W    P    I   +++  +  YG   H      +W 
Sbjct: 1397 IEMNNRNWVVFTSVILSCGGWLVWCCALP----ILNRSDVIYDVPYGFFYHFGKDITWWC 1452

Query: 1208 TLIVLPIFALVRDFLWKYYKRMYEPETYHVIQEMQK 1243
            +  VL +  +  D +++ +K M  P    +   +++
Sbjct: 1453 SCFVLAVLPITIDIVYQTFKTMIWPSDADIFSVLEQ 1488

 Score =  239 bits (609), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 145/440 (32%), Positives = 225/440 (51%), Gaps = 58/440 (13%)

Query: 198 YSDNHISTTKYNFATFLPKFLFQEFSKYANLFFLCTSAIQQVPHVSPTNRYTTIGTLLVV 257
           Y +N+I++++Y   +F PK L+ +FSK AN++F   + +Q +P  S T  YTTI  L + 
Sbjct: 140 YCNNNITSSRYTIYSFFPKQLYAQFSKVANVYFFVVAILQMIPGWSTTGTYTTIVPLCIF 199

Query: 258 LIVSAMKECIEDIKRANSDKELNNSTAEIFSEAH------DD------------------ 293
           + +S  +E  +D +R   DKE NN T  I ++        DD                  
Sbjct: 200 MGISMAREAWDDFRRHRLDKEENNKTCSILTKEFSNKPMPDDAQLPSRQNIDNLSNDSNT 259

Query: 294 -----------FVEKR---------WIDIRVGDIIRVKSEEPIPADTIILSSSEPEGLCY 333
                      F+E+R         W ++ VGD + +K +  +PAD ++L+S      C+
Sbjct: 260 DYLNTKFNNFPFLEERHGVRIQETTWSNLHVGDFVLLKQDNWVPADILVLTSDGDNNECF 319

Query: 334 IETANLDGETNLKIKQSRVETAKF-IDVKTLKNMNGKVVSEQPNSSLYTYEGTMTLND-- 390
           +ET  LDGETNLK+KQ   E  K       L N+N  +  E PNS LY +EG + L D  
Sbjct: 320 VETMALDGETNLKVKQPHPELNKLACSASGLANINALITVEDPNSDLYNFEGNLELTDNN 379

Query: 391 ----RQIPLSPDQMILRGATLRNTAWIFGLVIFTGHETKLLRNATATP-IKRTAVEKIIN 445
               ++ P+ PD +  RG+ +RNT  + G+VI+TG ETK+  NA   P  K   ++K IN
Sbjct: 380 NNSLKKYPVGPDNVAYRGSIIRNTDNVIGMVIYTGKETKIRMNALNNPRTKAPKLQKNIN 439

Query: 446 --RQXXXXXXXXXXXXXXXXXXXXXMSTADAKHLSYLYLEGTNKAGLFFKDFLTFWILFS 503
                                        D     YL  +    A       ++F I+++
Sbjct: 440 IIITFMVFVVAVISLFSYLGHVLQNKKAIDENQAWYLLTKDAGAA----PTIMSFIIMYN 495

Query: 504 NLVPISLFVTVELIKYYQAFMIGSDLDLYYEKTDTPTVVRTSSLVEELGQIEYIFSDKTG 563
            ++P+SL+VT+E+IK  Q+ M+  D+D+Y+ +T+TP   RT++++EELGQ+ Y+FSDKTG
Sbjct: 496 TIIPLSLYVTMEIIKAMQSKMMEWDIDMYHSETNTPCESRTATILEELGQVSYMFSDKTG 555

Query: 564 TLTRNIMEFKSCSIAGHCYI 583
           TLT N M F+  SI G  ++
Sbjct: 556 TLTDNKMIFRKFSICGSSWL 575

 Score = 92.8 bits (229), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 54/125 (43%), Positives = 71/125 (56%), Gaps = 12/125 (9%)

Query: 626 FLTLLATCHTVIPE---FQSDGS--IKYQAASPDEGALVQGGADLGYKFIIRKGNSVTVL 680
           F+  LA CHT +P+   F   G   I+YQ++SPDE ALV    DLGY  + +  + +T+ 
Sbjct: 702 FILSLALCHTCLPKKSNFPEGGEDVIEYQSSSPDELALVTAARDLGYVVLNKNADVLTIK 761

Query: 681 LEETGEEKE-----YQLLNICEFNSTRKRMSAIFRFPD--GSIKLFCKGADTVILERLDD 733
               G E E     YQ+LN  +FNS RKRMS + + PD    + L CKGAD +ILERL D
Sbjct: 762 TYPDGFENEPIFEDYQILNYIDFNSQRKRMSVLVKTPDEPNKVLLICKGADNMILERLQD 821

Query: 734 EANQY 738
               Y
Sbjct: 822 RDLAY 826

>AFL191W [3004] [Homologous to ScYMR162C (DNF3) - SH]
            complement(79156..83883) [4728 bp, 1575 aa]
          Length = 1575

 Score =  278 bits (710), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 167/480 (34%), Positives = 260/480 (54%), Gaps = 28/480 (5%)

Query: 739  VEATMRHLEDYASEGLRTLCLAMRDISEGEYEEWNSIYNEAATTLDNRAEKLDEAANLIE 798
            +E T++ ++ + +EGLRTL  + + I   EYE WNS Y+ A   L NR E++D    +IE
Sbjct: 938  IERTLQDMDAFTTEGLRTLLYSFKWIGNQEYETWNSRYSAAKAALVNRREQMDTVGEIIE 997

Query: 799  KNLILIGATAIEDKLQDGVPETIHTLQEAGIKIWVLTGDRQETAINIGMSCRLLSEDMNL 858
            ++L L+G   IEDKLQ+GVP+ I  L+ AGIK+W+LTGD++ETAINIG SCRL+ +   +
Sbjct: 998  RDLTLLGTIGIEDKLQEGVPDAIDKLRRAGIKMWMLTGDKRETAINIGYSCRLIHDYSTV 1057

Query: 859  LIINEETRDDTERNLLEKINALNEHQLSTHDMKSLALVIDGKSLG-FALEPELEDYLLTV 917
            +I+        + N+  KI  + + ++   ++    +VIDG +L  F     L    + +
Sbjct: 1058 IILAP-----NDENMASKITTITQ-EIEAGNVAHCVVVIDGATLTIFEGNLTLMTLFIEL 1111

Query: 918  AKLCKAVICCRVSPLQKALVV-KMVKRKXXXXXXAIASGANDVSMIQAAHVGVGISGMEG 976
                 +VICCR SP QKAL+V K+ K        AI  GAND++MIQ+A +GV I+G EG
Sbjct: 1112 CTKTDSVICCRSSPSQKALMVTKIRKTDKKLVTLAIGDGANDIAMIQSADIGVDITGKEG 1171

Query: 977  MQAARSADIALGQXXXXXXXXXVHGSWSYQRISVAILYSFYKNTALYMTQFWYVFANAFS 1036
            +QA+RS+D ++ Q         VHG ++Y R S  +L +FYK    Y+TQ  +     FS
Sbjct: 1172 LQASRSSDYSIAQFRYLLKLLLVHGRYNYIRTSKFVLCTFYKEFVFYLTQLIFQINTMFS 1231

Query: 1037 GQSIMESWTMSFYNLFFTVWPPFVIGVFDQFVSSRLLERYPQLYKLGQKGQFFSVYIFWG 1096
            G S  E W ++ +N  FT  P   IG+F++ + S  L   P+LY  G++ Q F++ IF  
Sbjct: 1232 GTSQYEPWCLTVFNTLFTSLPVLCIGMFEKDLKSVTLLSIPELYTTGRQSQAFNLVIFLR 1291

Query: 1097 WIINGFFHSAIVFIGTILIYRYGFALNMHGELADH--WSWGVTVYTTSVIIVLGKAALV- 1153
            W+       AI  + +++I    +        +D+  +  G+  YT  V++V  K  L+ 
Sbjct: 1292 WM-------AIAALSSVIICFTNWQCWSLTAQSDNTLYPIGLINYTAVVVLVNVKCQLLE 1344

Query: 1154 --TNQWTKFT--LIAIPGSLLFWLIFFPIYASIFPHANISREYYGVVKHTYGSGV-FWLT 1208
                 W  F    I++ G L + L+   IY     + ++    Y    H +G  + FW T
Sbjct: 1345 MANRNWLAFASFFISVCGWLCWCLLLPAIYKETLVY-DVREGLY----HQFGPDITFWAT 1399

 Score =  219 bits (558), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 138/426 (32%), Positives = 217/426 (50%), Gaps = 39/426 (9%)

Query: 194 SSFGYSDNHISTTKYNFATFLPKFLFQEFSKYANLFFLCTSAIQQVPHVSPTNRYTTIGT 253
           S   Y  N I++++Y+  +FLP+ L  +FSK  N +F   + +Q VP+ S T +YTTI  
Sbjct: 106 SGLPYIGNAITSSRYSVYSFLPRQLCAQFSKVVNSYFFGMAILQMVPNWSTTGQYTTIVP 165

Query: 254 LLVVLIVSAMKECIEDIKRANSDKELNNSTAEIFSEAHD-------------------DF 294
           L + + +S  +E  ED +R   D+E NN   ++ ++AHD                   DF
Sbjct: 166 LSIFMGISIAREGWEDFRRHKLDREENNKLVKVLAQAHDSEFGDNKDISAEARAASFTDF 225

Query: 295 -----------VEKRWIDIRVGDIIRVKSEEPIPADTIILSSSEPEGLCYIETANLDGET 343
                      VEK+W D+ VG+ + +  ++ +PAD  +L++      CY+ET  LDGET
Sbjct: 226 ETLQANHGVAVVEKQWKDVEVGEFVLLNQDDWVPADLFLLATDGDNNECYVETMALDGET 285

Query: 344 NLKIKQSRVETAKFIDVKT-LKNMNGKVVSEQPNSSLYTYEGTMTL-----NDRQIPLSP 397
           NLK K    + A      + L    G    E PN  LY +EG + +       +   +  
Sbjct: 286 NLKCKHVLPKIASQTRTASGLATFRGMTTVEDPNIDLYNFEGKIEVETDSGEQQAYSIGL 345

Query: 398 DQMILRGATLRNTAWIFGLVIFTGHETKLLRNATATP-IKRTAVEKIINRQXXXXXXXXX 456
           D ++ RG+ +RNT  + G+V+FTG ETK+  NA   P IK   ++  IN           
Sbjct: 346 DNVLFRGSIIRNTQTVVGMVVFTGEETKIRMNAIKNPRIKSPKLQTQINLIVLFMILVVA 405

Query: 457 XXXXXXXXXXXXMSTADAKHLSYLYLEGTNKAGLFFKDFLTFWILFSNLVPISLFVTVEL 516
                           +       YL   + AGL     ++F I+++ L+P+SL+VT+E+
Sbjct: 406 IFSFLSFGLQRFFKNREVDSDRAWYLMKVD-AGL-APTIMSFIIMYNTLIPLSLYVTMEI 463

Query: 517 IKYYQAFMIGSDLDLYYEKTDTPTVVRTSSLVEELGQIEYIFSDKTGTLTRNIMEFKSCS 576
           IK  Q+ ++  D+D+Y+ +T+T    RT++++EELGQ+ YIFSDKTGTLT N M F+  S
Sbjct: 464 IKDMQSRLMEWDIDMYHLETNTGCTSRTATILEELGQVSYIFSDKTGTLTDNRMIFRKFS 523

Query: 577 IAGHCY 582
             G  +
Sbjct: 524 FCGTAW 529

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 49/120 (40%), Positives = 71/120 (59%), Gaps = 15/120 (12%)

Query: 626 FLTLLATCHTVIPEFQSDG------SIKYQAASPDEGALVQGGADLGYKFIIRKGNSVTV 679
           F+  LA CHT +P+ +         S++YQ++SPDE ALV    D+GY  + R G+ +T+
Sbjct: 653 FILALALCHTCLPKKRQGADSGDFDSVEYQSSSPDELALVTAARDMGYVVLNRNGDELTI 712

Query: 680 LLEETGEE-----KEYQLLNICEFNSTRKRMSAIFRF---PDGSIKLFCKGADTVILERL 731
                G E     ++Y++LN  +F+S RKRMS + R    P+  + L CKGAD VILERL
Sbjct: 713 KTYPDGFEADCVLEKYEVLNTIDFSSDRKRMSVLVRMHQHPE-KVLLICKGADNVILERL 771

>Scas_89.1
          Length = 271

 Score =  144 bits (362), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 94/271 (34%), Positives = 142/271 (52%), Gaps = 16/271 (5%)

Query: 769  YEEWNSIYNEAATTLDNRAEKLDEA-ANLIEKNLILIGATAIEDKLQDGVPETIHTLQEA 827
            Y+++   Y++A+ ++ N  E +       +E NL L+G T +EDKLQ+ V  +I  L+ A
Sbjct: 2    YDKFEKEYHDASLSMLNXDETMSSVIKKHLEHNLELLGLTGVEDKLQNDVKSSIELLRNA 61

Query: 828  GIKIWVLTGDRQETAINIGMSCRLLSEDMNLLIINEETRDDTERNLLE--KINALNEHQL 885
            G+KIW+LTGD+ ETA  + +S +L+S    +  + + +R +   N LE  KIN       
Sbjct: 62   GVKIWMLTGDKVETARCVSISAKLISRGQYVHTVTKLSRPEGALNALEYLKIN------- 114

Query: 886  STHDMKSLALVIDGKSLGFALEPELEDYLLTVAKLCKAVICCRVSPLQKALVVKMVKRKX 945
                 KS  L+IDG+SLG  L    +++   V  L  AVI CR +P QKA V  +++   
Sbjct: 115  -----KSSCLLIDGESLGMFLTYYKQEFFDIVVDL-PAVIACRCTPQQKADVALLIREIT 168

Query: 946  XXXXXAIASGANDVSMIQAAHVGVGISGMEGMQAARSADIALGQXXXXXXXXXVHGSWSY 1005
                  I  G NDVSMIQ A VGVGI G EG QA+ +AD ++ Q          HG  SY
Sbjct: 169  GKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSVTQFCHLTKLLLWHGRNSY 228

Query: 1006 QRISVAILYSFYKNTALYMTQFWYVFANAFS 1036
            +R +    +  ++   + + Q  Y   +  S
Sbjct: 229  KRSAKLAQFVIHRGLIISVCQAVYSVCSKLS 259

>AFL011W [3182] [Homologous to ScYGL006W (PMC1) - SH]
           complement(415265..418993) [3729 bp, 1242 aa]
          Length = 1242

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 126/597 (21%), Positives = 228/597 (38%), Gaps = 82/597 (13%)

Query: 301 DIRVGDIIRVKSEEPIPADTIILSSSEPEGLCYIETANLDGETNLKIKQSRVETAKFIDV 360
           D+ VGD++ +++ + +P D I++     EG C  + + + GE+         +T K + +
Sbjct: 200 DLLVGDLLSLQTGDVVPVDCILV-----EGKCECDESGITGES---------DTIKKVSL 245

Query: 361 KTLKNMNGKVVSEQPNSSLYTYEGTMTLNDRQIPLSPDQMILRGATLRNTAWIFGLVIFT 420
                +   V ++ P++ + +       +D    L PD M++ G+ L +      +    
Sbjct: 246 AMSLQVYRTVAADNPSADIGS-------SDNGHSLVPDPMLISGSKLLSGIGHAVVTAVG 298

Query: 421 GHET--KLLRNATATPIKRTAVEKIINRQXXXXXXXXXXXXXXXXXXXXXMSTADAKHLS 478
            H    K++    + P      E++                           +   K   
Sbjct: 299 PHSVHGKMMLALKSEPETTPLQERLNTLADDISIYGSVAAFLLFVVLFLRFLSYLPKGRL 358

Query: 479 YLYLEGTNKAGLFFKDFLTFWILFSNLVPISLFVTVELIKYYQAFMIGSDLDLYYEKTDT 538
           Y  L    K   F   F+T   +    VP  L + V L   +    +  D +L       
Sbjct: 359 YHDLPSARKGSRFMDIFITAVTVIVVAVPEGLPLAVTLALAFATTRMTKDGNL------- 411

Query: 539 PTVVRTSSLVEELGQIEYIFSDKTGTLTRNIMEFKSCSIAGHCYIDKIPEDKTATVEDGI 598
              VR     E +G    + SDKTGTLT+N M        G  + D I ED      D +
Sbjct: 412 ---VRVLRACETMGSATTVCSDKTGTLTQNKMVVVK-GFLGSSHFDDISEDSNCAQSDAL 467

Query: 599 --EVGYRKFDDL------------KKKLNDPSDEDSPIINDFLTLLATCHTVIPEFQSDG 644
             ++     +D+             K++ DP   ++P      +L        P++ +  
Sbjct: 468 RQDMSQHTLNDILANIALNSTAFENKQVADPVITENPYHKPRRSLFPWSRNNKPKYPAPK 527

Query: 645 SIKYQAA-----SPDEGALVQ-GGADLGYKFIIRKGNSVTVLLEETGEEKEYQLLNICEF 698
               Q+A     S  E AL+      LG +       S+  L ++        ++ +  F
Sbjct: 528 DSSVQSAEFFIGSKTEAALLSLAKGSLGLE-------SLQALRDDPHHIGIASIVQMIPF 580

Query: 699 NSTRKRMSAIFRFPDGSIKLFCKGADTVILER---LDDEANQYVE-ATMRHLE------D 748
            S+RK    + R  DG+ + F KGA   I +    +    +  ++ +  +H E      +
Sbjct: 581 ESSRKWAGLVVRLVDGNYRFFIKGASETIFKSCHYMRSSNDDVIKLSPQKHGEIFGLINN 640

Query: 749 YASEGLRTLCLAMRDISE------GEYEEWNSIYNEAATTL--DNRAEKLDEAANLIEKN 800
            AS+ LRT+ LA +D ++       E  + +     +   L  D       +  ++I  N
Sbjct: 641 LASDALRTISLAHKDFTDISSWPPAELRDASDPSTASPDLLLGDEYVPTATDRPSIITNN 700

Query: 801 ---LILIGATAIEDKLQDGVPETIHTLQEAGIKIWVLTGDRQETAINIGMSCRLLSE 854
              LIL G   I D L+ GV E++   Q++G+ + ++TGD   T   I  +C +LSE
Sbjct: 701 NSGLILDGVVGIHDPLRPGVKESVKNCQQSGVTVRMITGDNITTGRAIARACGILSE 757

>Kwal_47.17547
          Length = 1240

 Score = 73.9 bits (180), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 164/793 (20%), Positives = 299/793 (37%), Gaps = 148/793 (18%)

Query: 254 LLVVLIVSAMKECIEDIKRANSDKELNNSTAEIFSEAHDDFVEKRWIDIRVGDIIRVKSE 313
           +LVV++V +  +  ++++ +  + + N+    +     +  +     DI VGDI+ +++ 
Sbjct: 158 VLVVILVGSANDYQKELQFSKLNDKKNDREVIVLRNGDEHLISIH--DILVGDILSLQTG 215

Query: 314 EPIPADTIILSSSEPEGLCYIETANLDGETNLKIKQSRVETAKFIDVKTLKNMNGKVVSE 373
           + +PAD I++     +G C  + + L GE+   IK++ ++   +   K L   +  +   
Sbjct: 216 DVVPADCILV-----KGSCECDESALTGESA-TIKKAAIDVC-YEKYKQLSATDAAIDIG 268

Query: 374 QPNSSLYTYEGTMTLNDRQIPLSPDQMILRGATLRNTAWIFGLVIFTGHETKLLRNATAT 433
            P +                   PD M++ G+ L +     G  + T      +   T  
Sbjct: 269 TPGAEKV----------------PDPMLISGSKLLSG---LGRAVVTSVGVNSMHGRTLM 309

Query: 434 PIK----RTAVEKIINRQXXXXXXXXXXXXXXXXXXXXXMSTADAKHLSYLY-LEGTNKA 488
            +K     T +++ ++                          A+ K    L+ L    K 
Sbjct: 310 ALKVEAETTPLQERLDSLANSISVYGSAAALLLFFILFMRFLANLKKGGELHDLTPAQKG 369

Query: 489 GLFFKDFLTFWILFSNLVPISLFVTVELIKYYQAFMIGSDLDLYYEKTDTPTVVRTSSLV 548
             F   F+    +    VP  L + V L   +    +  D +L          VR     
Sbjct: 370 SRFMNIFIVGITVIVVAVPEGLPLAVTLALAFATTRMAKDGNL----------VRVLRAC 419

Query: 549 EELGQIEYIFSDKTGTLTRNIMEFKSCSIAGHCYIDKI----PEDKTATVEDGIEVGYRK 604
           E +G    + SDKTGTLT N M        G  + D+     P D    V+  + +    
Sbjct: 420 ETMGSATAVCSDKTGTLTENRMTVVK-GFLGSTFFDEAESVGPSDSETDVD--LAIANEC 476

Query: 605 FDDLKKKL------------NDPSDED-----SPIINDFLTLL-----------ATCHTV 636
            ++LKK +            N  ++ED     +P      +L            AT   +
Sbjct: 477 SEELKKDVLTNITLNSTAFENKENEEDKVSNENPFHKPRKSLFPWSRNNKSKKPATAKEL 536

Query: 637 IPEFQSDGSIKYQAASPDEGALVQ-GGADLGYKFIIRKGNSVTVLLEETGEEKEYQLLNI 695
           +    +D   +    S  E AL+     +LG + +    +    L    G EK   ++ I
Sbjct: 537 VENAAADQPKEPFLGSKTETALLAFAQKNLGMQNLHHYRDEPDCL----GIEK---IVQI 589

Query: 696 CEFNSTRKRMSAIFRFPDGSIKLFCKGADTVILERLDDEANQYVEATMRHLEDY------ 749
             F S+RK    + ++ +G  + + KGA  ++L R   +     + T+   +D+      
Sbjct: 590 IPFESSRKWGGIVVKYKNGLHRFYIKGAAELLLRRCMQKRASDSKLTLISQKDFDEESQT 649

Query: 750 ----ASEGLRTLCLAMRDISEGE----YEEWNSIYNEAATT------LDNRAEKLDEAAN 795
               A+E LR + LA RD          E  + +  EAA+         +R++ + E A 
Sbjct: 650 ITNLAAEALRAISLAHRDYPNCPNWPPSELQDEVEPEAASPDLLFGDEVSRSDSVSEPAQ 709

Query: 796 LIEKNLILIGATAIEDKLQDGVPETIHTLQEAGIKIWVLTGDRQETAINIGMSCRLLSED 855
            +   ++L G   I+D L+ GV +++   Q+AG+ + ++TGD   TA  I   C +LSE+
Sbjct: 710 ELVSPMVLDGIVGIQDPLRKGVRKSVEQCQKAGVTVRMVTGDNILTATAIAKKCSILSEE 769

Query: 856 MNLLIINEETRDDTERNLLEKINALNEHQLSTHDMKSLALVIDGKSLGFALEPELEDYLL 915
                  E      E     K++  N+ ++                    + P L     
Sbjct: 770 Q-----AENPESSMEGPRFRKLS--NKERVR-------------------ILPNLR---- 799

Query: 916 TVAKLCKAVICCRVSPLQKALVVKMVKRKXXXXXXAIASGANDVSMIQAAHVGVGISGME 975
                    +  R SP  K ++V+ +K K          G ND   ++ A VG  + G+ 
Sbjct: 800 ---------VLARSSPEDKRILVETLK-KMGDVVAVTGDGTNDAPALKLADVGFSM-GIA 848

Query: 976 GMQAARSA-DIAL 987
           G + AR A DI L
Sbjct: 849 GTEVAREASDIIL 861

>KLLA0A08910g complement(779526..783368) similar to sp|P38929
           Saccharomyces cerevisiae YGL006w PMC1 Ca2+-transporting
           P-type ATPase, start by similarity
          Length = 1280

 Score = 73.2 bits (178), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 156/731 (21%), Positives = 274/731 (37%), Gaps = 132/731 (18%)

Query: 301 DIRVGDIIRVKSEEPIPADTIILSSSEPEGLCYIETANLDGETNLKIKQSRVETAKFIDV 360
           D+ VGD+I +++ + +PAD +++S     G C  + + L GE+         +T K + +
Sbjct: 256 DLLVGDVISLQTGDVVPADAVLIS-----GSCECDESALTGES---------DTIKKVAL 301

Query: 361 KTLKNMNGKVVSEQPNSSLYTYEGTMTLNDRQIPLSPDQMILRGATLRNTAWIFGLVIFT 420
           K       ++  + P   +    G+  + ++     PD +++ G+ L   + I   VI +
Sbjct: 302 KPALEKYKQIFEKDPTIDI----GSHGVGEK----VPDPLLISGSKL--LSGIGNAVITS 351

Query: 421 GHETK--------LLRNATATPIKRTAVEKIINRQXXXXXXXXXXXXXXXXXXXXXMSTA 472
             E          L   + +TP++    E++ N                         T 
Sbjct: 352 VGENSVNGRIMMALKTESESTPLQ----ERLSNLADNISIYGCMAALVLFIILFIRFLTY 407

Query: 473 DAKHLSYLYLEGTNKAGLFFKDFLTFWILFSNLVPISLFVTVELIKYYQAFMIGSDLDLY 532
                 Y  L    K   F   F+T   +    VP  L + V L   +    +  D +L 
Sbjct: 408 LPNGKKYHDLPPAQKGSKFMNIFITAVTVIVVAVPEGLPLAVTLALAFATTRMTKDGNL- 466

Query: 533 YEKTDTPTVVRTSSLVEELGQIEYIFSDKTGTLTRNIMEFKSCSIAGHCYIDKI-----P 587
                    VR     E +G    I SDKTGTLT N M       AG+   D        
Sbjct: 467 ---------VRVLRACETMGSATAICSDKTGTLTENRMTVVK-GFAGNLGFDDTTHAENK 516

Query: 588 EDKTATV-------------EDGIEVGYRKFDDLKKKLNDPSDEDSPIINDFLTLLA--- 631
           E K+A V                I +    F++ + +  D   +++P      +L     
Sbjct: 517 EIKSAVVLRSNCDASLLTDILSNISLNSTAFENKESQHKDKDVDENPYHKSRKSLFPWSR 576

Query: 632 --TCHTVIPEFQSDGSIKYQAASPDEGALVQGGADLGYKFIIRKGNSVTVLLEETGEEKE 689
                 +I +   +   ++  +  +   L      LG K +    + +     + G +K 
Sbjct: 577 NNRTSQLIADAMKENDEQFLGSKTETALLAFAQKSLGMKDV----HKLRTKPSDLGIDKV 632

Query: 690 YQLLNICEFNSTRKRMSAIFRFPDG-SIKLFCKGADTVILERLDDEANQ----------Y 738
            Q++    F S+RK  +   +  D    + + KGA  ++L+   ++ N            
Sbjct: 633 VQVI---PFESSRKWGAIAVQLADNKGYRFYAKGAAEILLKVCSNQRNSDNSIVPMNQDL 689

Query: 739 VEATMRHLEDYASEGLRTLCLAMRDISEGEYEEWNSIYNEAATTLD-NRAEKLDEAANLI 797
            + + + ++D AS  LRT+ L  RD  E   +E+    + +  + D     +LD   NL 
Sbjct: 690 YDESFKKIQDMASHALRTISLVHRDFKEWPPKEFADSTDPSIASPDLVMGHELDH-KNLS 748

Query: 798 EKNLILIGATAIEDKLQDGVPETIHTLQEAGIKIWVLTGDRQETAINIGMSCRLLSEDMN 857
            + + L     ++D L++GV E++   Q AG+ + ++TGD   TA  I  +C +LS    
Sbjct: 749 SEGMTLDAMVGLQDPLREGVKESVEQCQRAGVTVRMVTGDNILTARAISRNCNILS---- 804

Query: 858 LLIINEETRDDTERNLLEKINALNEHQLSTHDMKSLALVIDGKSLGFALEPELEDYLLTV 917
                EE  +D E        A+          K +  VI          P+L       
Sbjct: 805 -----EEGYNDPE-------CAMEGPTFRKLPYKKMLRVI----------PKLR------ 836

Query: 918 AKLCKAVICCRVSPLQKALVVKMVKRKXXXXXXAIASGANDVSMIQAAHVGVGISGMEGM 977
                  +  R SP  K ++V+ +K K          G ND   ++ A VG  + G+ G 
Sbjct: 837 -------VLARSSPEDKRILVETLK-KMGEVVAVTGDGTNDAPALKLADVGFSM-GISGT 887

Query: 978 QAARSA-DIAL 987
           + AR A DI L
Sbjct: 888 EVAREASDIIL 898

>Scas_665.30
          Length = 1439

 Score = 73.2 bits (178), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 78/299 (26%), Positives = 132/299 (44%), Gaps = 39/299 (13%)

Query: 697 EFNSTRKRMSAIFRFPDGSIK-LFCKGADTVILERLDDEANQYVEATMRHLEDYAS-EGL 754
           EF S  +RMS I +  +  +   F KGA  VI +  +      + A    + +Y + +G 
Sbjct: 709 EFLSELRRMSVIVKPSNEDVYWAFTKGAPEVITQICNKAT---LPANFEEMLNYYTHKGY 765

Query: 755 RTLCLAMRDISEGEYEEWNSIYNEAATTLDNRAEKLDEAANLIEKNLILIGATAIEDKLQ 814
           R +  A R +    +     +Y++  +    R E        +E N+  +G    E+KL+
Sbjct: 766 RVIACAGRVLPRNTW-----LYSQKVS----REE--------VESNMEFLGFIIFENKLK 808

Query: 815 DGVPETIHTLQEAGIKIWVLTGDRQETAINIGMSCRLLSEDMNLLIINEETRDDTER--- 871
               +T+ TLQEA I+  + TGD   TAI++G  C L+ +   + + + E  D T +   
Sbjct: 809 KETAKTLQTLQEASIRTVMCTGDNVLTAISVGRQCNLI-KSKKVYVPSLEEIDSTGQTSI 867

Query: 872 ------NLLEKINALNEHQLSTHDMKSLALVIDGKSLGFALEPE----LEDYLLTVAKLC 921
                 N+ + +++     ++     S  L I G         E     EDY+ TV  L 
Sbjct: 868 IWRDVDNMDDTLDSRTLLPINNSSSTSYTLAITGDIFRIIFGDENNSISEDYINTV--LL 925

Query: 922 KAVICCRVSPLQKALVVKMVKRKXXXXXXAIASGANDVSMIQAAHVGVGISGMEGMQAA 980
           K  I  R+SP +K  +++ ++R           GAND   ++AA VG+ +S  E   AA
Sbjct: 926 KGTIYARMSPDEKHELMEQLQRLNYTVGFC-GDGANDCGALKAADVGISLSEAEASVAA 983

>KLLA0B08217g complement(724364..728683) similar to sp|Q12697
            Saccharomyces cerevisiae YOR291w, start by similarity
          Length = 1439

 Score = 67.4 bits (163), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 84/303 (27%), Positives = 132/303 (43%), Gaps = 49/303 (16%)

Query: 697  EFNSTRKRMSAIFR-FPDGSIKLFCKGADTVILERLDDEANQYVEATMRH--LEDYASEG 753
            EF S  +RMS I + F + +   F KGA  VI     D  N        H  L  Y   G
Sbjct: 908  EFLSELRRMSVIVKGFKENTYWSFTKGAPEVIA----DICNPATIPKDFHELLHHYTHNG 963

Query: 754  LRTLCLAMRDISEGEYEEWNSIYNEAATTLDNRAEKLDEAANLIEKNLILIGATAIEDKL 813
             R +  A + + +  +     +Y++  +    R E        +E NL  +G    E+KL
Sbjct: 964  FRIIACAGKTLPKSSW-----LYSQKVS----REE--------VEDNLEFLGFIVFENKL 1006

Query: 814  QDGVPETIHTLQEAGIKIWVLTGDRQETAINIGMSCRLL-SEDMNLLIIN---EETRD-- 867
            +      +  LQ A I+  + TGD   TA+++G    L+ SE + +  +N   EE+R   
Sbjct: 1007 KSRTKAALKELQNANIRTVMCTGDNVLTAVSVGRDSGLISSERVFIPFLNDNLEESRHLL 1066

Query: 868  -----DTERNLLEKIN--ALNEHQLSTHDMKSLALVIDGKSLGFAL---EPELEDYLLTV 917
                 D E ++L+ +    LN+ +      KS  L I G          E   +DY+ TV
Sbjct: 1067 SWRDVDEEGSVLDAVTLKPLNDPE------KSYTLAITGDIFRILFRNDEILPDDYISTV 1120

Query: 918  AKLCKAVICCRVSPLQKALVVKMVKRKXXXXXXAIASGANDVSMIQAAHVGVGISGMEGM 977
              L K  I  R+SP +K  +V+ ++ K          GAND   ++AA++G+ +S  E  
Sbjct: 1121 --LMKGSIYARMSPDEKHELVEQLQ-KLDYNVGFCGDGANDCGALKAANIGISLSEAEAS 1177

Query: 978  QAA 980
             AA
Sbjct: 1178 VAA 1180

>AFR567W [3759] [Homologous to ScYOR291W - SH]
            complement(1455295..1459644) [4350 bp, 1449 aa]
          Length = 1449

 Score = 67.4 bits (163), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 77/297 (25%), Positives = 129/297 (43%), Gaps = 36/297 (12%)

Query: 697  EFNSTRKRMSAIFR-FPDGSIKLFCKGADTVILERLDDEANQY-VEATMRHLEDYASEGL 754
            EF S  +RMS I + F +     F KGA  VI E    +      EA + H   Y   G 
Sbjct: 917  EFLSNLRRMSVIVKPFSENVFMSFTKGAPEVIFELCSKQTLPLDYEALLHH---YTHNGY 973

Query: 755  RTLCLAMRDISEGEYEEWNSIYNEAATTLDNRAEKLDEAANLIEKNLILIGATAIEDKLQ 814
            R +  A + ++    + W  +Y++  +    R E        IE NL  +G    E+KL+
Sbjct: 974  RVIACAGKKLTR---QSW--LYSQKVS----REE--------IESNLEFLGFIIFENKLK 1016

Query: 815  DGVPETIHTLQEAGIKIWVLTGDRQETAINIGM------SCRLLSEDMNLLIINEETRDD 868
                ET+ +L  A I+  + TGD   TAI++G       S R+    +N +  ++E    
Sbjct: 1017 GTTKETLESLHRADIRTIMCTGDNVLTAISVGREAGLVESPRVFVSVINDIDTSQEGDII 1076

Query: 869  TERNLLEKINALNEHQLS--THDMKSLALVIDGKSLGFAL---EPELEDYLLTVAKLCKA 923
            T +N+    + L+   L   + D     L + G+         + ++E+ +  +  L K 
Sbjct: 1077 TWQNVANSSDTLDSVTLRPLSGDTDDYTLAVTGEVFRLLFKTDKSQIEEVINNI--LLKT 1134

Query: 924  VICCRVSPLQKALVVKMVKRKXXXXXXAIASGANDVSMIQAAHVGVGISGMEGMQAA 980
             I  R+SP +K  +V+ ++            GAND   ++AA +G+ +S  E   AA
Sbjct: 1135 SIYARMSPDEKHELVERLQ-SIGYQVGFCGDGANDCGALKAADIGISLSEAEASVAA 1190

>CAGL0M11308g 1110211..1114569 similar to sp|Q12697 Saccharomyces
            cerevisiae YOR291w, hypothetical start
          Length = 1452

 Score = 66.6 bits (161), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 94/385 (24%), Positives = 164/385 (42%), Gaps = 59/385 (15%)

Query: 697  EFNSTRKRMSAIFRFPDGSIK-LFCKGADTVILERLDDEA--NQYVEATMRHLEDYASEG 753
            EF S  +RMS I +  + ++   + KGA  VI++  +     + Y +     L  Y   G
Sbjct: 921  EFLSELRRMSVIVKPNNENVYWAYTKGAPEVIIDICNPATLPSDYDDI----LNFYTHSG 976

Query: 754  LRTLCLAMRDISEGEYEEWNSIYNEAATTLDNRAEKLDEAANLIEKNLILIGATAIEDKL 813
             R +  A + + +  +     +Y++       R E+       +E N+  +G    ++KL
Sbjct: 977  YRVIACAGKTLPKNTW-----LYSQKV-----RREE-------VESNMEFLGFIIFQNKL 1019

Query: 814  QDGVPETIHTLQEAGIKIWVLTGDRQETAINIGMSCRLLSEDMNLLIINEETRDDTERNL 873
            +D    T+  L+ A I+  + TGD   TAI++G  C+L++ED  + +      D T + +
Sbjct: 1020 KDATSPTLSKLKTANIRTVMCTGDNVLTAISVGKECQLITED-RVYVPTVAYSDMTVQPV 1078

Query: 874  L---EKINALNEHQLSTHDMKSL-------ALVIDGKSLGFALEPE---LEDYLLTVAKL 920
            +   E  NA  EH L T  ++ +        L I G+        +    E+Y+  +  L
Sbjct: 1079 IHWNEISNA--EHILDTFTLQPIDDYSGPYTLAITGEVFRIIFSNQDNYSEEYVNEI--L 1134

Query: 921  CKAVICCRVSPLQKALVVKMVKRKXXXXXXAIASGANDVSMIQAAHVGVGISGMEGMQAA 980
             K  I  R+SP +K  +V+ ++ K          GAND   ++AA VG+ +S  E   AA
Sbjct: 1135 LKGSIFARMSPDEKHELVEQLQ-KMDYTVGFCGDGANDCGALKAADVGISLSEAEASVAA 1193

Query: 981  ----RSADIALGQXXXXXXXXXVHGSW----------SYQRISVAILYSFYKNTALYMTQ 1026
                +  DI             +  S+          + Q IS+ ILYS   N   +  Q
Sbjct: 1194 PFTSKIFDITCVLDVIKEGRASLVTSFACFQYMSLYSAIQFISITILYSRGSNLGDF--Q 1251

Query: 1027 FWYVFANAFSGQSIMESWTMSFYNL 1051
            F Y+        ++  SW+  ++ L
Sbjct: 1252 FLYIDLLLIIPIAVTMSWSKPYHEL 1276

>KLLA0F20658g 1919851..1923099 similar to sp|Q12691 Saccharomyces
           cerevisiae YDR038c ENA5 P-type ATPase involved in Na+
           efflux, start by similarity
          Length = 1082

 Score = 65.9 bits (159), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 121/510 (23%), Positives = 201/510 (39%), Gaps = 143/510 (28%)

Query: 541 VVRTSSLVEELGQIEYIFSDKTGTLTRNIMEFKSCSIAGHCYIDKIPEDKTATVEDGIE- 599
           +VR    +E LG +  I SDKTGTLT+  M      IA   +I   P+  T TV++  E 
Sbjct: 350 IVRKLDSLEALGAVNDICSDKTGTLTQGKM------IAKQVWI---PQFGTITVQESNEP 400

Query: 600 ----VG----YRKFDDLKKKLNDPSDEDSPIINDF-------------LTLL------AT 632
               +G      KF   + K +D  +ED  II DF             ++L       AT
Sbjct: 401 FNPTIGEIHLIPKFSPYQYKHDD--EEDVGIIPDFKSKYLAGELGPLNVSLFDQWLYTAT 458

Query: 633 CHTVIPEFQSDGSIKYQA-ASPDEGALVQGGADLGYKFIIRKGNSVTVLLEETGEEKE-- 689
              +   FQ   +  ++A   P E A+          F  R      VL   TGE+K+  
Sbjct: 459 LANIATVFQDSETQDWKAHGDPTEIAI--------QVFATRMDLPRHVL---TGEDKDDE 507

Query: 690 --------YQLLNICEFNSTRKRMSAIFRF---PDGSI-KLFCKGADTVILERLDD---- 733
                   ++ +    F+S+ KRMSAI++    P   I ++F KGA   +L+  D     
Sbjct: 508 KDARANSSFEHVAEFPFDSSVKRMSAIYKNTEDPATPIYEVFTKGAFERVLQCCDSWYTT 567

Query: 734 -------EANQYVEATMRHLEDYASEGLRTLCLAMRDISEGEYEEWNSIYNEAATTLDNR 786
                   + + +E   ++++  +SEGLR L  A +  +E E+              +  
Sbjct: 568 PDGKPSPLSKEDLETIQKNVDTLSSEGLRVLAFAKKSFNESEF--------------NAN 613

Query: 787 AEKLDEAANLIEKNLILIGATAIEDKLQDGVPETIHTLQEAGIKIWVLTGDRQETAINIG 846
            +KL +  + +E  L  +G   I D  +      +    +AGI + +LTGD   TA +I 
Sbjct: 614 KDKLLKERDFVECKLTFLGLIGIYDPPRQESLAAVKKCHQAGINVHMLTGDFPGTAKSIA 673

Query: 847 MSCRLLSEDM--------NLLIINEETRDDTERNLLEKINALNEHQLSTHDMKSLALVID 898
               +L  ++        N +++     D           AL++ ++   D++ L LVI 
Sbjct: 674 QEVGILPHNLYHYPKEVVNFMVMAATDFD-----------ALSDQEID--DLRVLPLVI- 719

Query: 899 GKSLGFALEPELEDYLLTVAKLCKAVICCRVSPLQKALVVKMVKRKXXXXXXAIASGAND 958
                                        R +P  K  +++ + R+          G ND
Sbjct: 720 ----------------------------ARCAPQTKVRMIEALHRRSKFCAMT-GDGVND 750

Query: 959 VSMIQAAHVGVGISGMEGMQAARSA-DIAL 987
              ++ A+VG+ + G+ G   A+ A DI L
Sbjct: 751 SPSLKIANVGIAM-GINGSDVAKDASDIVL 779

>Kwal_26.9207
          Length = 1469

 Score = 65.9 bits (159), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 116/494 (23%), Positives = 185/494 (37%), Gaps = 107/494 (21%)

Query: 539  PTVVRTSSLVEELGQIEYIFSDKTGTLTRNIMEFKSCSIAGHCYIDKIPEDKTATVEDGI 598
            PT V  S      G+I+ +  DKTGTLT + ++     +A        P+         +
Sbjct: 772  PTRVNVS------GKIDVMCFDKTGTLTEDGLDVLGVHVAE-------PQGHQNFRFGAL 818

Query: 599  EVGYRKFDDLKKKLND---PSDEDSPIINDFLTLLATCHT---VIPEFQSDGSIKYQAAS 652
                R   + K  LND   P D  S    +FL  L TCH+   V  E   D  + ++   
Sbjct: 819  ITNVRGLFN-KYSLNDCGSPIDFKS---RNFLVSLLTCHSLRVVDGELLGD-PLDFKMFQ 873

Query: 653  PDEGALVQGGADLGYKFIIRKGNSVTVLLEETG------------------EEKEYQLLN 694
                +  +   D  +  +  + N+ + L E  G                  E   + LL 
Sbjct: 874  FTNWSYAEDFQDFKFHSLNEERNNKSTLPENAGIAPAVVHPNAESTENKFTENDPHNLLG 933

Query: 695  IC---EFNSTRKRMSAIFR-FPDGSIKLFCKGADTVILERLDDEANQYVEATMRH-LEDY 749
            +    EF S  +RMS I + + +     F KGA  VI E  +      + A     L+ Y
Sbjct: 934  VIRSFEFVSELRRMSVIVKPYGENVFWGFTKGAPEVISEICNKST---LPANYEQILQQY 990

Query: 750  ASEGLRTLCLAMRDISEGEYEEWNSIYNEAATTLDNRAEKLDEAANLIEKNLILIGATAI 809
               G R +  A + + +  +     +  E                  +E N+  +G    
Sbjct: 991  THNGYRVIACAGKTLPKRTWRFAQKVSREE-----------------VESNMEFLGFVVF 1033

Query: 810  EDKLQDGVPETIHTLQEAGIKIWVLTGDRQETAINIGMSCRLLSEDMNLLIINEETRDDT 869
            E+KL+     T+ +LQ+AGI+  + TGD   TAI++G    L++E     +   +  D+ 
Sbjct: 1034 ENKLKPSTTPTLASLQDAGIRSIMCTGDNVLTAISVGRESGLITESH---VFVPQINDNM 1090

Query: 870  ERNLLEKINALNEHQLSTHDMKSLALVIDGKSLGFALEP--ELEDYLLTVAK-------- 919
            +          NE  +   D+    L++D    G  LEP     DY + V          
Sbjct: 1091 DP---------NEDLIIWRDVDDCDLILD----GVTLEPMNGSSDYTIAVTGDVFRLLFK 1137

Query: 920  -------------LCKAVICCRVSPLQKALVVKMVKRKXXXXXXAIASGANDVSMIQAAH 966
                         L K+ I  R+SP +K  +V  ++            GAND   ++AA 
Sbjct: 1138 NNEVLPESYINMVLLKSSIYARMSPDEKHELVGQLQ-GLDYVVGFCGDGANDCGALKAAD 1196

Query: 967  VGVGISGMEGMQAA 980
            VGV +S  E   AA
Sbjct: 1197 VGVSLSEAEASVAA 1210

>YGL006W (PMC1) [1966] chr7 (485923..489444) Vacuolar
           Ca2+-transporting P-type ATPase, member of the cation
           transporting (E1-E2) P-type ATPase superfamily,
           functions to pump Ca2+ into the vacuole [3522 bp, 1173
           aa]
          Length = 1173

 Score = 65.1 bits (157), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 128/564 (22%), Positives = 205/564 (36%), Gaps = 124/564 (21%)

Query: 482 LEGTNKAGLFFKDFLTFWILFSNLVPISLFVTVELIKYYQAFMIGSDLDLYYEKTDTPTV 541
           L+   K   F   F+T   +    VP  L + V L   +    +  D +L          
Sbjct: 377 LDPAQKGSKFMNIFITSITVIVVAVPEGLPLAVTLALAFATTRMTKDGNL---------- 426

Query: 542 VRTSSLVEELGQIEYIFSDKTGTLTRNIMEFKSCSIAGHCYIDKIPEDKTATVEDGIEVG 601
           VR     E +G    + SDKTGTLT N+M      + G     K  + K+  V +  ++ 
Sbjct: 427 VRVLRSCETMGSATAVCSDKTGTLTENVMTV----VRGFPGNSKFDDSKSLPVSEQRKLN 482

Query: 602 YRK------------------------FDDLKKKLNDPSDEDSPIINDFLTLLATCHTVI 637
            +K                        F++   K ND +   S  ++  L+ L  C + +
Sbjct: 483 SKKVFEENCSSSLRNDLLANIVLNSTAFENRDYKKNDKNTNGSKNMSKNLSFLDKCKSRL 542

Query: 638 PEFQSDGSIKYQAASPDEGAL---VQGGAD---LGYKFIIRKGNSVTVLLEETGEEKEY- 690
             F      K      DE  L   V  G     +G K      +   + L     E +Y 
Sbjct: 543 SFF------KKGNREDDEDQLFKNVNKGRQEPFIGSKTETALLSLARLSLGLQPGELQYL 596

Query: 691 -----------QLLNICEFNSTRKRMSAIFRFPDGSIK-----LFCKGADTVILERL--- 731
                      +++    F S+RK    + ++ +G  K      F KGA  ++ +     
Sbjct: 597 RDQPMEKFNIEKVVQTIPFESSRKWAGLVVKYKEGKNKKPFYRFFIKGAAEIVSKNCSYK 656

Query: 732 ---DDEANQYVEATMRHLED----YASEGLRTLCLAMRDISEGEYEEWNSIYNEAATTLD 784
              DD   +  E   +  +D     AS+ LR + +A +D  E +      + ++ +  + 
Sbjct: 657 RNSDDTLEEINEDNKKETDDEIKNLASDALRAISVAHKDFCECDSWPPEQLRDKDSPNI- 715

Query: 785 NRAEKLDEAANLIEKNLILIGATAIEDKLQDGVPETIHTLQEAGIKIWVLTGDRQETAIN 844
                LD   N  +K LIL G   I+D L+ GV E++   Q AG+ + ++TGD   TA  
Sbjct: 716 ---AALDLLFN-SQKGLILDGLLGIQDPLRAGVRESVQQCQRAGVTVRMVTGDNILTAKA 771

Query: 845 IGMSCRLLSEDMNLLIINEETRDDTERNLLEKINALNEHQLSTHDMKSLALVIDGKSLGF 904
           I  +C +LS D     I+ E     E     K+   NE      +++ LA          
Sbjct: 772 IARNCAILSTD-----ISSEAYSAMEGTEFRKLTK-NERIRILPNLRVLA---------- 815

Query: 905 ALEPELEDYLLTVAKLCKAVICCRVSPLQKALVVKMVKRKXXXXXXAIASGANDVSMIQA 964
                                  R SP  K L+V+ +K            G ND   ++ 
Sbjct: 816 -----------------------RSSPEDKRLLVETLK-GMGDVVAVTGDGTNDAPALKL 851

Query: 965 AHVGVGISGMEGMQAARSA-DIAL 987
           A VG  + G+ G + AR A DI L
Sbjct: 852 ADVGFSM-GISGTEVAREASDIIL 874

 Score = 34.3 bits (77), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 21/91 (23%), Positives = 49/91 (53%), Gaps = 7/91 (7%)

Query: 254 LLVVLIVSAMKECIEDIKRANSDKELNNSTAEIFSEAHDDFVEKRWIDIRVGDIIRVKSE 313
           + VV++VSA  +  ++++ A  +K+  N    +     +  +      + VGD+I +++ 
Sbjct: 164 VFVVVLVSAANDYQKELQFAKLNKKKENRKIIVIRNDQEILISIH--HVLVGDVISLQTG 221

Query: 314 EPIPADTIILSSSEPEGLCYIETANLDGETN 344
           + +PAD +++S     G C  + +++ GE+N
Sbjct: 222 DVVPADCVMIS-----GKCEADESSITGESN 247

>Kwal_23.3160
          Length = 1100

 Score = 64.3 bits (155), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 175/775 (22%), Positives = 283/775 (36%), Gaps = 159/775 (20%)

Query: 541  VVRTSSLVEELGQIEYIFSDKTGTLTRNIMEFKSCSIAGHCYI----DKIPEDKTATVED 596
            VVR    +E LG +  + SDKTGTLT+  M  K   +     I       P D T   + 
Sbjct: 356  VVRKLDSLEALGAVNDVCSDKTGTLTQGKMIVKQAWVPSFGTITVSNSSNPFDPT---DG 412

Query: 597  GIEVGYRKFDDLKKKLNDPSDEDSPII--------ND----------FLTLLATCH--TV 636
            GIE+  R F   + K +  S ED  II        ND          FL  L T     +
Sbjct: 413  GIELIPR-FSPHQYKHD--STEDVGIITSFKNKFYNDKLPAGLNSKLFLNWLKTAALANI 469

Query: 637  IPEFQSDGSIKYQA-ASPDEGAL--VQGGADLGYKFIIRKGNSVT------VLLEETGE- 686
               +Q   + +++A   P E A+       D+    +  +  S +       L E+T   
Sbjct: 470  AHVYQDPETEEWKAHGDPTEIAIQVFAHKLDMPRNALTAEDKSDSESDEDAALGEKTSSV 529

Query: 687  EKEYQLLNICEFNSTRKRMSAIFRF--PDGSIKLFCKGADTVILERLDDEANQYV----- 739
            E  Y+ +    F+S+ KRMSA++     D + ++F KGA     ER+ D   +++     
Sbjct: 530  EPHYKHIAEFPFDSSIKRMSAVYVSLDEDNAHRVFTKGA----FERVLDCCTKWLPDGCN 585

Query: 740  ------------EATMRHLEDYASEGLRTLCLAMRDISEGEYEEWNSIYNEAATTLDNRA 787
                        E   +++E  +SEGLR L  A +  +E +  +               +
Sbjct: 586  ESDAKPMTEEDKEEVFKNVETLSSEGLRVLAFATKSFTESQALK--------------VS 631

Query: 788  EKLDEAANLIEKNLILIGATAIEDKLQDGVPETIHTLQEAGIKIWVLTGDRQETAINIGM 847
            E L +  + +E +LI  G   I D  +      +    +AGI + +LTGD   TA  I  
Sbjct: 632  EDLRKNRDFVESDLIFQGLVGIYDPPRQETAGAVKQFHKAGINVHMLTGDFPGTAKAIAQ 691

Query: 848  SCRLLSEDMNLLIINEETRDDTERNLLEKINALNEHQLSTHDMKSLALVIDGKSLGFALE 907
               +L    NL    +E  D         + A    QL+  ++ +L L+           
Sbjct: 692  EVGILPR--NLYHYPKEVVDSM------VMTAAQFDQLTDEEIDNLLLL----------- 732

Query: 908  PELEDYLLTVAKLCKAVICCRVSPLQKALVVKMVKRKXXXXXXAIASGANDVSMIQAAHV 967
                            ++  R +P  K  ++  + R+          G ND   ++ A+V
Sbjct: 733  ---------------PLVIARCAPQTKVRMIDALHRREKFCAMT-GDGVNDSPSLKKANV 776

Query: 968  GVGISGMEGMQAARSA-DIALGQXXXXXXXXXV-HGSWSYQRISVAILYSFYKNTALYMT 1025
            G+ + G+ G   A+ A DI L           V  G      I   +L    +N A    
Sbjct: 777  GIAM-GINGSDVAKDASDIVLSDDNFASILNAVEEGRRMSDNIQKFVLQLLAENVA---Q 832

Query: 1026 QFWYVFANAFSGQSIMESWTMSFYNLFFTV-----WPPFVIGVFDQFVSSRLLERYPQLY 1080
              + +    F  +  +  + +S   + + +     +P   +G+  +  +  ++E+ PQ  
Sbjct: 833  ALYLMIGLCFLDEDRLSVFPLSPVEVLWIIVVTSCFPAMGLGL--EKSAPDIMEKEPQDS 890

Query: 1081 KLGQKGQFFSVYIFWGWIINGFFHSAIVFIGTI-LIYRYG---FALNM------------ 1124
            K G     F+  I    +I G + +A      I +IY  G     +N             
Sbjct: 891  KAG----IFTWEIILDMLIYGTWMAACCLACFITVIYGKGNGELGINCNNSYSESCDNVY 946

Query: 1125 HGELADHWS---------WGVTVYTTSVIIVLGKAALVTNQWTKFTLIAIPGSLLFWLIF 1175
            HG  A   S         W V     S   +  +      QW K          LFW + 
Sbjct: 947  HGRAATFASMTWCALILAWEVIDMRRSFFKMQPETDTPYTQWMKDIW---SNQFLFWSVI 1003

Query: 1176 FPIYASIFPHANISREYYGVVKHTYGSGVFWLTLIVLPIFALVRDFLWKYYKRMY 1230
            F  + S+FP   I      V KH  G G  W   +   I   +   L+KY+KR Y
Sbjct: 1004 FG-FVSVFPVVYIPVINKDVFKHK-GIGYEWGLAVAYTIAFWIGAELYKYFKRCY 1056

>YOR291W (YOR291W) [5075] chr15 (861172..865590) Member of the
            cation-translocating P-type ATPase superfamily of
            membrane transporters [4419 bp, 1472 aa]
          Length = 1472

 Score = 63.9 bits (154), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 99/389 (25%), Positives = 163/389 (41%), Gaps = 65/389 (16%)

Query: 697  EFNSTRKRMSAIFRFPDGSIKL-FCKGADTVILERLDDEANQYVEATMRH-LEDYASEGL 754
            EF S  +RMS I +  +  +   F KGA  VI E  +      + A     L  Y   G 
Sbjct: 933  EFLSELRRMSVIVKTNNDDVYWSFTKGAPEVISEICNKST---LPADFEEVLRCYTHNGY 989

Query: 755  RTLCLAMRDISEGEYEEWNSIYNEAATTLDNRAEKLDEAANLIEKNLILIGATAIEDKLQ 814
            R +  A + + +  +     +Y++  +    R E        +E NL  +G    ++KL+
Sbjct: 990  RVIACAGKTLPKRTW-----LYSQKVS----REE--------VESNLEFLGFIIFQNKLK 1032

Query: 815  DGVPETIHTLQEAGIKIWVLTGDRQETAINIG-----MSC-RLLSEDMNLLIINEET--- 865
                ET+ +LQ+A I+  + TGD   TAI++G     + C R+    +N   ++ E    
Sbjct: 1033 KETSETLKSLQDANIRTIMCTGDNILTAISVGREAGLIQCSRVYVPSINDTPLHGEPVIV 1092

Query: 866  -RDDTERNLLEKINALNEHQLSTHDMKSL-----ALVIDGK--SLGFALEPEL-EDYLLT 916
             RD  E + +     L   +L  + ++SL      L + G    L F  E E+ E+YL  
Sbjct: 1093 WRDVNEPDKILDTKTLKPVKLGNNSVESLRECNYTLAVSGDVFRLLFRDENEIPEEYLNE 1152

Query: 917  VAKLCKAVICCRVSPLQK-ALVVKMVKRKXXXXXXAIASGANDVSMIQAAHVGVGISGME 975
            +  L  + I  R+SP +K  L++++  +K          GAND   ++AA VG+ +S  E
Sbjct: 1153 I--LLNSSIYARMSPDEKHELMIQL--QKLDYTVGFCGDGANDCGALKAADVGISLSEAE 1208

Query: 976  GMQAA----------------RSADIALGQXXXXXXXXXVHGSWSYQRISVAILYSFYKN 1019
               AA                R    AL           ++   + Q I++ ILYS   N
Sbjct: 1209 ASVAAPFTSKIFNISCVLDVIREGRAALVTSFACFQYMSLYS--AIQFITITILYSRGSN 1266

Query: 1020 TALYMTQFWYVFANAFSGQSIMESWTMSF 1048
               +  QF Y+        +I  SW+ S+
Sbjct: 1267 LGDF--QFLYIDLLLIVPIAICMSWSKSY 1293

>CAGL0I04312g complement(382354..385209) highly similar to sp|P13586
           Saccharomyces cerevisiae YGL167c PMR1 Ca2+-transporting
           P-type ATPase, start by similarity
          Length = 951

 Score = 60.8 bits (146), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 107/464 (23%), Positives = 163/464 (35%), Gaps = 126/464 (27%)

Query: 541 VVRTSSLVEELGQIEYIFSDKTGTLTRNIMEFKSCSIAGHCYIDKIPEDKTATVEDGIEV 600
           +VR    VE LG +  I SDKTGTLT N M        G            A   + + +
Sbjct: 360 IVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKIWCLGS----------MANKLNVLSL 409

Query: 601 GYRKFDDLKKKLNDPSDEDSPIINDFLTLLATCHTVIPEFQSDGSIKYQAASPDEGALVQ 660
              K  +LK  L D          D  T L   +       S    KY     D   L Q
Sbjct: 410 DKNKGGNLKNYLTD----------DVKTTLLCGNLCNNASYSQEHAKYLGNPTDVALLEQ 459

Query: 661 GGADLGYKFIIRKGNSVTVLLEETGEEKEYQLLNICEFNSTRKRMSAIFRFPDGSIKLFC 720
                     ++K        E      EY  +    FNS RK M+   +  +    LF 
Sbjct: 460 ----------LQK-------FELADVRSEYTKVKELSFNSKRKMMATKIQDNEKKTTLFI 502

Query: 721 KGADTVILERLDDEANQYV-------EATMRHLED-------YASEGLRTLCLAMRDISE 766
           KGA     ER+ D+++ Y+       + T  H E         ASEGLR L  A R ++ 
Sbjct: 503 KGA----FERILDKSSSYLTEKGKIEKLTAGHRETIIDCANTLASEGLRVLAFAKRAMT- 557

Query: 767 GEYEEWNSIYNEAATTLDNRAEKLDEAANLIE---KNLILIGATAIEDKLQDGVPETIHT 823
                                   D ++ L+E    +L+  G   + D  +  V   I  
Sbjct: 558 ------------------------DSSSKLVEDDISDLVFTGLIGMNDPPRSSVKFAIDQ 593

Query: 824 LQEAGIKIWVLTGDRQETAINIGMSCRLLSEDMNLLIINEETRDDTERNLLEKINALNEH 883
             + GI I ++TGD + TA+NI     +   D  L +++            +K+N + + 
Sbjct: 594 FLQGGIHIIMITGDSENTAVNIARQIGIPVIDPKLSVLSG-----------DKLNEMTDD 642

Query: 884 QLSTHDMKSLALVIDGKSLGFALEPELEDYLLTVAKLCKAVICCRVSPLQKALVVKMVKR 943
           QL+         VID  +                       I  R +P  K  +V+ ++R
Sbjct: 643 QLAN--------VIDHVN-----------------------IFARATPEHKLNIVRALRR 671

Query: 944 KXXXXXXAIASGANDVSMIQAAHVGVGISGMEGMQAARSADIAL 987
           +          G ND   ++ A +GV +  M    A  ++D+ L
Sbjct: 672 RGDVVAMT-GDGVNDAPALKLADIGVSMGRMGTDVAKEASDMIL 714

>AEL301W [2204] [Homologous to ScYGL167C (PMR1) - SH]
            complement(75104..77977) [2874 bp, 957 aa]
          Length = 957

 Score = 60.1 bits (144), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 128/594 (21%), Positives = 213/594 (35%), Gaps = 132/594 (22%)

Query: 541  VVRTSSLVEELGQIEYIFSDKTGTLTRNIMEFKSCSIAGHCYIDKIPEDKTATVEDGIEV 600
            +VR    VE LG +  I SDKTGTLT N M          C      ++   ++E     
Sbjct: 358  IVRRLPSVETLGSVNVICSDKTGTLTANHMTASKI----WCLGSMANKNNVLSLEAKSSG 413

Query: 601  GYR-KFDDLKKKLNDPSDEDSPIINDFLTLLATCHTVIPEFQSDGSIKYQAA-SPDEGAL 658
            G   K  +LK  L+D              + AT           GSI   A+ S + G  
Sbjct: 414  GLPGKLPNLKNYLSD-------------DVKATLRI--------GSICNNASFSHEHGKY 452

Query: 659  VQGGADLGYKFIIRKGNSVTVLLEETGEEKEYQLLNICEFNSTRKRMSAIFRFPDGSIK- 717
            +    D+    +++K + V        E      ++   FNS RK M+     P  S K 
Sbjct: 453  LGNPTDIALLEVLQKFDLVD-------ERPTTTRVDELTFNSKRKYMAVKVDSPANSGKH 505

Query: 718  -LFCKGADTVILER-------------LDDEANQYVEATMRHLEDYASEGLRTLCLAMRD 763
             ++ KGA   ILER             L D     +    + L   ASEGLRTL  A  +
Sbjct: 506  IIYVKGAFERILERSASFIGGAGKVEKLSDSHKSLINDCAKSL---ASEGLRTLAFAQLE 562

Query: 764  ISEGEYEEWNSIYNEAATTLDNRAEKLDEAANLIEKNLILIGATAIEDKLQDGVPETIHT 823
             S       N   N++                   +NL  +G   ++D  +  V   I  
Sbjct: 563  CST------NKPMNDSTI-----------------QNLTFVGLIGMKDPPRSTVRPAIEE 599

Query: 824  LQEAGIKIWVLTGDRQETAINIGMSCRLLSEDMNLLIINEETRDDTERNLLEKINALNEH 883
            L + G+ + ++TGD + TA+NI       +  + + +IN E            I+ L   
Sbjct: 600  LLQGGVHVIMITGDAENTAVNI-------ARQIGIPVINPE------------ISVLTGD 640

Query: 884  QLSTHDMKSLALVIDGKSLGFALEPELEDYLLTVAKLCKAVICCRVSPLQKALVVKMVKR 943
            +L       LA VID  +                       I  R +P  K  +V+ +++
Sbjct: 641  RLDQMTDDQLAGVIDHVN-----------------------IFARATPEHKLNIVRALQK 677

Query: 944  KXXXXXXAIASGANDVSMIQAAHVGVGISGMEGMQAARSADIALGQXXXXXXXXXV-HGS 1002
            +          G ND   ++ A +GV +  M    A  ++D+ L           +  G 
Sbjct: 678  RGDIVAMT-GDGVNDAPALKLADIGVAMGHMGTDVAKEASDMVLTDDDFSTILTAIEEGK 736

Query: 1003 WSYQRISVAILYSFYKNTALYMTQFWYVFANAFSGQSIMESWTMSFYNLFFTVWPPFVIG 1062
              +  I   + +    + A          A AF  Q+ + +  + + N+     P   +G
Sbjct: 737  GIFNNIQSFLTFQLSTSVAALS---LVAIATAFKLQNPLNAMQILWINILMDGPPAQSLG 793

Query: 1063 VFDQFVSSRLLERYPQLYKLGQKGQFFSVYIFWGWIINGFFHSAIVFIGTILIY 1116
            V  + V   ++ + P+     +  +  +  +    +IN  F    +  GTI ++
Sbjct: 794  V--EPVDHEVMRKPPR----KRSDKILTPQVMRRLLINAAF----IIGGTIYVF 837

>Scas_583.14*
          Length = 875

 Score = 59.3 bits (142), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 123/498 (24%), Positives = 201/498 (40%), Gaps = 85/498 (17%)

Query: 479 YLYLEGTNKAGLFFKDFLTFWILFSNLVPISLFVTVELIKYYQAFMIGSDLDLYYEKTDT 538
           Y+++EGT    +  K  L   ++ + +VP  L   +EL     + +  + L  +Y     
Sbjct: 70  YVWVEGTKMGRIQSKLILDCILIITYVVPPEL--PMELTMAVNSSL--AALSKFYVYCTE 125

Query: 539 PTVVRTSSLVEELGQIEYIFSDKTGTLTRNIMEFKSCSIAGHCYIDKIPEDKTATVEDGI 598
           P  +  +      G+I+    DKTGTLT   + F                       +G+
Sbjct: 126 PFRIPLA------GRIDVCCFDKTGTLTGEDLVF-----------------------EGL 156

Query: 599 EVGYRKFDDLKKKLNDPSDEDSPIINDFLTLLATCHTVIPEFQSDGSIKYQAASPDEGAL 658
                K +D++      S ED+    + + ++   H ++     DG I      P E A 
Sbjct: 157 AGLSDKSEDVRHLF---SSEDAS--QETILVVGAAHALVK--LDDGEI---VGDPMEKAT 206

Query: 659 VQGGADLGYKFIIRKGNSVTVLLEETGEEKEYQLLNICEFNSTRKRMSAIFRFPDGSIKL 718
           ++    LG+K    +GN  T    +TG+    Q+L   +F+S  KR S++    D   KL
Sbjct: 207 LKA---LGWKV---EGNDFTSR-PKTGK---LQILRRFQFSSALKRSSSVASHKD---KL 253

Query: 719 F--CKGADTVILERLDDEANQYVEATMRHLEDYASEGLRTLCLAMRDISEGEYEEWNSIY 776
           F   KGA   I ERL      Y E      + +   G R L LA +           S+ 
Sbjct: 254 FTAVKGAPETIRERLAVVPKNYDEI----YKSFTRSGSRVLALASK-----------SLP 298

Query: 777 NEAATTLDNRAEKLDEAANLIEKNLILIGATAIEDKLQDGVPETIHTLQEAGIKIWVLTG 836
           N ++  LD+    LD   + IE  L   G       L+    ETI  L E+  +  ++TG
Sbjct: 299 NLSSKQLDD----LDR--DEIETGLTFNGFLVFHCPLKPDAVETIKMLNESAHRSIMITG 352

Query: 837 DRQETAINIGMSCRLLSEDMNLLIINEETRDDTER---NLLEKINALNEHQLSTHDMKSL 893
           D   TA+++     +++ +  L++   ET  D +    N+ E I    +      D + L
Sbjct: 353 DNPLTAVHVAKEVAIVTGE-TLILDKSETVGDGKLLFFNVEETIKIPFDPASDKFDHREL 411

Query: 894 ALVIDGKSLGFALEPELEDYLLTVAKLCKAVICCRVSPLQKALVVKMVKRKXXXXXXAIA 953
               D    G+AL   LED+      +    +  RVSP QK  ++  +K +         
Sbjct: 412 FDKYDIAVTGYALN-LLEDHSQLKDLIRHTWVYARVSPSQKEFILNNLK-EMGYQTLMCG 469

Query: 954 SGANDVSMIQAAHVGVGI 971
            G NDV  ++ AHVGV +
Sbjct: 470 DGTNDVGALKQAHVGVAL 487

>YDR040C (ENA1) [893] chr4 complement(535187..538462) P-type ATPase
           involved in Na+ and Li+ efflux, required for Na+
           tolerance [3276 bp, 1091 aa]
          Length = 1091

 Score = 58.2 bits (139), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 117/530 (22%), Positives = 210/530 (39%), Gaps = 108/530 (20%)

Query: 504 NLVPISLFVTVEL-IKYYQAFMIGSDLDLYYEKTDTPTVVRTSSLVEELGQIEYIFSDKT 562
           +++P SL V + + +    A M+  ++           +VR    +E LG +  I SDKT
Sbjct: 323 SMIPSSLVVVLTITMSVGAAVMVSRNV-----------IVRKLDSLEALGAVNDICSDKT 371

Query: 563 GTLTRNIM--------EFKSCSIAGH-----------CYIDKIPEDKTATVEDGIEVG-Y 602
           GTLT+  M         F + +I+               I +    + +  EDG +VG  
Sbjct: 372 GTLTQGKMLARQIWIPRFGTITISNSDDPFNPNEGNVSLIPRFSPYEYSHNEDG-DVGIL 430

Query: 603 RKFDDLKKKLNDPSDEDSPIINDFLTLLATCHTVIPEFQSDGSIKYQA-ASPDEGAL--V 659
           + F D   + + P D D  +   +L   AT   +   F+ D +  ++A   P E A+   
Sbjct: 431 QNFKDRLYEKDLPEDIDMDLFQKWLET-ATLANIATVFKDDATDCWKAHGDPTEIAIQVF 489

Query: 660 QGGADLGYKFIIRKG-------NSVTVLLEETGEEKEYQLLNICEF--NSTRKRMSAIF- 709
               DL +  +  +        N  + L +   +    Q  +I EF  +ST KRMS+++ 
Sbjct: 490 ATKMDLPHNALTGEKSTNQSNENDQSSLSQHNEKPGSAQFEHIAEFPFDSTVKRMSSVYY 549

Query: 710 RFPDGSIKLFCKGADTVILE-----------RLDDEANQYVEATMRHLEDYASEGLRTLC 758
              + +  ++ KGA   I+            ++    +  VE   +++   ++EGLR L 
Sbjct: 550 NNHNETYNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDVETIRKNVYSLSNEGLRVLG 609

Query: 759 LAMRDISEGEYEEWNSIYNEAATTLDNRAEKLDEAANLIEKNLILIGATAIEDKLQDGVP 818
            A +  ++ +  +     ++      NRA          E +L+ +G   I D  ++   
Sbjct: 610 FASKSFTKDQVND-----DQLKNITSNRATA--------ESDLVFLGLIGIYDPPRNETA 656

Query: 819 ETIHTLQEAGIKIWVLTGDRQETAINIGMSCRLLSEDMNLLIINEETRDDTERNLLEKIN 878
             +    +AGI + +LTGD   TA  I     +L    NL   ++E  D           
Sbjct: 657 GAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILP--TNLYHYSQEIVD----------- 703

Query: 879 ALNEHQLSTHDMKSLALVIDGKSLGFALEPELEDYLLTVAKLCKAVICCRVSPLQKALVV 938
                          ++V+ G       E E++D  L V  L    +  R SP  K  ++
Sbjct: 704 ---------------SMVMTGSQFDGLSEEEVDD--LPVLPL----VIARCSPQTKVRMI 742

Query: 939 KMVKRKXXXXXXAIASGANDVSMIQAAHVGVGISGMEGMQAARSA-DIAL 987
           + + R+          G ND   ++ A+VG+ + G+ G   ++ A DI L
Sbjct: 743 EALHRRKKFCTMT-GDGVNDSPSLKMANVGIAM-GINGSDVSKEASDIVL 790

 Score = 31.2 bits (69), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 47/106 (44%), Gaps = 16/106 (15%)

Query: 248 YTTIGTLLVVLIVSAMKECIED---IKRANSDKELNNSTAEIFSEAHDDFVEKRWIDIRV 304
           + T G +  V+ V+ +   +++    K  NS K L++  A +      + +  +  D+  
Sbjct: 91  WITGGVISFVIAVNVLIGLVQEYKATKTMNSLKNLSSPNAHVIRNGKSETINSK--DVVP 148

Query: 305 GDIIRVKSEEPIPADTIILSSSEPEGLCYIETANLDGETNLKIKQS 350
           GDI  VK  + IPAD           L  IET N D + +L   +S
Sbjct: 149 GDICLVKVGDTIPAD-----------LRLIETKNFDTDESLLTGES 183

>KLLA0E22352g 1984522..1988142 highly similar to sp|P39986
           Saccharomyces cerevisiae YEL031w SPF1 P-type ATPase,
           start by similarity
          Length = 1206

 Score = 58.2 bits (139), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 119/523 (22%), Positives = 204/523 (39%), Gaps = 105/523 (20%)

Query: 479 YLYLEGTNKAGLFFKDFLTFWILFSNLVPISLFVTVELIKYYQAFMIGSDLDLYYEKTDT 538
           Y++ EGT    +  K  L   ++ +++VP  L   +EL     + +  + L  +Y     
Sbjct: 415 YVWKEGTRMGRIQSKLILDCILIITSVVPPEL--PMELTMAVNSSL--AALSKFYVYCTE 470

Query: 539 PTVVRTSSLVEELGQIEYIFSDKTGTLTRNIMEFKSCSIAGHCYIDKIPEDKTATVEDGI 598
           P  +  +      G+I+    DKTGTLT   + F+                  A + DG 
Sbjct: 471 PFRIPYA------GRIDVCCFDKTGTLTAEDLVFEGL----------------AGLHDGS 508

Query: 599 EVGYRKFDDLKKKLNDPSDEDSPIINDFLTLLATCHTVIPEFQSDGSIKYQAASPDEGAL 658
           ++  R      K  ND S E        L+ +   H ++     DG I      P E A 
Sbjct: 509 DI--RTL----KSANDASQE-------VLSAIGAAHALVK--LDDGEI---VGDPMEKAT 550

Query: 659 VQGGA-DLGYKFIIRKGNSVTVLLEETGEEKEYQLLNICEFNSTRKRMSAIFRFPDGSIK 717
           ++  +  + +K ++++  +  +           ++L   +F+S+ KR ++I      S +
Sbjct: 551 LKASSWTVDFKDVVKRAGADNI-----------RILRRFQFSSSLKRSASI---ASQSNR 596

Query: 718 LFC--KGADTVILERLDDEANQYVEATMRHLEDYASEGLRTLCLAMRDISEGEYEEWNSI 775
            F   KGA   I ERL+   + Y +      + +   G R L LA +D+ +    + ++I
Sbjct: 597 FFAAVKGAPETIRERLNSVPSDYDDI----YKSFTRSGSRVLALAYKDLPKMSNSQIDNI 652

Query: 776 YNEAATTLDNRAEKLDEAANLIEKNLILIGATAIEDKLQDGVPETIHTLQEAGIKIWVLT 835
                    +R E        IE  L           L+D   ETI  L E+  +  ++T
Sbjct: 653 ---------DRDE--------IETGLTFGAFLVFHCPLKDDAIETIKMLNESSHRSIMIT 695

Query: 836 GDRQETAINIGMSCRLLSEDMNLLIINEETRDDTE----RNLLEKINALNEHQLSTHDMK 891
           GD   TA+++     ++  D   LI++E     +     R++ E I         T D K
Sbjct: 696 GDNPLTAVHVAKEVGIV--DRETLILDEPIDGSSHALVMRDVNETIVKPFNPDADTFDEK 753

Query: 892 SLALVIDGKSLGFALEPELEDYLLTVAKLCKAV-----ICCRVSPLQKALVVKMVKRKXX 946
            +    D    G AL+      LL   K  + V     I  RVSP QK  ++  +K    
Sbjct: 754 EIFQKYDLAVTGHALK------LLQGHKQLRDVIRHTWIYARVSPSQKEFILITLK-DMG 806

Query: 947 XXXXAIASGANDVSMIQAAHVGVGI-----SGMEGMQAARSAD 984
                   G NDV  ++ AHVG+ +       ++ +Q  R  D
Sbjct: 807 YQTLMCGDGTNDVGALKQAHVGIALLNGTEDSLKKLQEQRKID 849

>YDR038C (ENA5) [891] chr4 complement(527417..530692) Member of the
           Na[+]-transporting ATPases family in the superfamily of
           P-type ATPases [3276 bp, 1091 aa]
          Length = 1091

 Score = 57.8 bits (138), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 117/530 (22%), Positives = 210/530 (39%), Gaps = 108/530 (20%)

Query: 504 NLVPISLFVTVEL-IKYYQAFMIGSDLDLYYEKTDTPTVVRTSSLVEELGQIEYIFSDKT 562
           +++P SL V + + +    A M+  ++           +VR    +E LG +  I SDKT
Sbjct: 323 SMIPSSLVVVLTITMSVGAAVMVSRNV-----------IVRKLDSLEALGAVNDICSDKT 371

Query: 563 GTLTRNIM--------EFKSCSIAGH-----------CYIDKIPEDKTATVEDGIEVG-Y 602
           GTLT+  M         F + +I+               I +    + +  EDG +VG  
Sbjct: 372 GTLTQGKMLARQIWIPRFGTITISNSDDPFNPNEGNVSLIPRFSPYEYSHNEDG-DVGIL 430

Query: 603 RKFDDLKKKLNDPSDEDSPIINDFLTLLATCHTVIPEFQSDGSIKYQA-ASPDEGAL--V 659
           + F D   + + P D D  +   +L   AT   +   F+ D +  ++A   P E A+   
Sbjct: 431 QNFKDRLYEKDLPEDIDMDLFQKWLET-ATLANIATVFKDDATDCWKAHGDPTEIAIQVF 489

Query: 660 QGGADLGYKFIIRKG-------NSVTVLLEETGEEKEYQLLNICEF--NSTRKRMSAIF- 709
               DL +  +  +        N  + L +   +    Q  +I EF  +ST KRMS+++ 
Sbjct: 490 ATKMDLPHNALTGEKSTNQSNENDQSSLSQHNEKPGSAQFEHIAEFPFDSTVKRMSSVYY 549

Query: 710 RFPDGSIKLFCKGADTVILE-----------RLDDEANQYVEATMRHLEDYASEGLRTLC 758
              + +  ++ KGA   I+            ++    +  VE   +++   ++EGLR L 
Sbjct: 550 NNHNETYNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDVETIRKNVYSLSNEGLRVLG 609

Query: 759 LAMRDISEGEYEEWNSIYNEAATTLDNRAEKLDEAANLIEKNLILIGATAIEDKLQDGVP 818
            A +  ++ +  +     ++      NRA          E +L+ +G   I D  ++   
Sbjct: 610 FASKSFTKDQVND-----DQLKNITSNRATA--------ESDLVFLGLIGIYDPPRNETA 656

Query: 819 ETIHTLQEAGIKIWVLTGDRQETAINIGMSCRLLSEDMNLLIINEETRDDTERNLLEKIN 878
             +    +AGI + +LTGD   TA  I     +L    NL   ++E  D           
Sbjct: 657 GAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILP--TNLYHYSQEIVD----------- 703

Query: 879 ALNEHQLSTHDMKSLALVIDGKSLGFALEPELEDYLLTVAKLCKAVICCRVSPLQKALVV 938
                          ++V+ G       E E++D  L V  L    +  R SP  K  ++
Sbjct: 704 ---------------SMVMTGSQFDGLSEEEVDD--LPVLPL----VIARCSPQTKVRMI 742

Query: 939 KMVKRKXXXXXXAIASGANDVSMIQAAHVGVGISGMEGMQAARSA-DIAL 987
           + + R+          G ND   ++ A+VG+ + G+ G   ++ A DI L
Sbjct: 743 EALHRRKKFCAMT-GDGVNDSPSLKMANVGIAM-GINGSDVSKEASDIVL 790

 Score = 31.2 bits (69), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 47/106 (44%), Gaps = 16/106 (15%)

Query: 248 YTTIGTLLVVLIVSAMKECIED---IKRANSDKELNNSTAEIFSEAHDDFVEKRWIDIRV 304
           + T G +  V+ V+ +   +++    K  NS K L++  A +      + +  +  D+  
Sbjct: 91  WITGGVISFVIAVNVLIGLVQEYKATKTMNSLKNLSSPNAHVIRNGKSETINSK--DVVP 148

Query: 305 GDIIRVKSEEPIPADTIILSSSEPEGLCYIETANLDGETNLKIKQS 350
           GDI  VK  + IPAD           L  IET N D + +L   +S
Sbjct: 149 GDICLVKVGDTIPAD-----------LRLIETKNFDTDESLLTGES 183

>KLLA0E14630g complement(1297636..1300884) similar to sp|Q01896
           Saccharomyces cerevisiae YDR039c ENA2 P-type ATPase
           involved in Na+ efflux, hypothetical start
          Length = 1082

 Score = 57.8 bits (138), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 118/500 (23%), Positives = 201/500 (40%), Gaps = 123/500 (24%)

Query: 541 VVRTSSLVEELGQIEYIFSDKTGTLTRNIMEFKSCSIAGHCYIDKIPEDKTATVEDGIE- 599
           ++R    +E LG +  I SDKTGTLT+  M      IA   +I   P+  T  V++  E 
Sbjct: 350 IIRKLDSLEALGAVNDICSDKTGTLTQGKM------IAKQVWI---PQFGTINVQNSNEP 400

Query: 600 ----VG----YRKFDDLKKKLNDPSDEDSPIINDF-------------LTLL------AT 632
               +G      KF   + K +D  +ED  +I DF             ++L       AT
Sbjct: 401 FNPTIGEIQLIPKFSPYQYKHDD--EEDVGMITDFKSKYYADELGPLNVSLFTQWLYTAT 458

Query: 633 CHTVIPEFQSDGSIKYQA-ASPDEGAL--VQGGADLGYKFIIRKGNSVTVLLEETGEEKE 689
              +   F+   +  ++A   P E A+       DL  + +  + N      +E     +
Sbjct: 459 LANIATVFRDPETQDWKAHGDPTEIAIQVFATRMDLPRRVLTGEDND-----DEKNIHND 513

Query: 690 YQLLNICE--FNSTRKRMSAIFRF---PDGSI-KLFCKGADTVILERLDDEANQY----- 738
               ++ E  F+S+ KRMSAI++    P   I ++F KGA     ER+    N +     
Sbjct: 514 ITFEHVAEYPFDSSVKRMSAIYKNVEEPKAPIYEVFTKGA----FERVLQCCNSWYTTPD 569

Query: 739 ----------VEATMRHLEDYASEGLRTLCLAMRDISEGEYEEWNSIYNEAATTLDNRAE 788
                     +E   ++++  +SEGLR L  A +             +NE+  T++   +
Sbjct: 570 GSPQPLTEEDLETVQKNVDTLSSEGLRVLAFAKK------------TFNESQFTINK--D 615

Query: 789 KLDEAANLIEKNLILIGATAIEDKLQDGVPETIHTLQEAGIKIWVLTGDRQETAINIGMS 848
           KL +  + +E NL  +G   I D  +      +     AGI + +LTGD   TA +I   
Sbjct: 616 KLLKERDFVENNLTFLGLVGIYDPPRRESLAAVKKCHLAGINVHMLTGDFPGTAKSIAQE 675

Query: 849 CRLLSEDMNLLIINEETRDDTERNLLEKINALNEHQLSTHDMKSLALVIDGKSLGFALEP 908
             +L    NL    +E               +N   ++  D  +L+            + 
Sbjct: 676 VGILPH--NLYHYPKE--------------VVNFMVMTATDFDALS------------DK 707

Query: 909 ELEDYLLTVAKLCKAVICCRVSPLQKALVVKMVKRKXXXXXXAIASGANDVSMIQAAHVG 968
           E+++  L V  L    +  R +P  K  +++ + R+          G ND   ++ A+VG
Sbjct: 708 EIDE--LPVLPL----VIARCAPQTKVRMIEALHRRNRFCAMT-GDGVNDSPSLKIANVG 760

Query: 969 VGISGMEGMQAARSA-DIAL 987
           + + G+ G   A+ A DI L
Sbjct: 761 IAM-GINGSDVAKDASDIVL 779

>YDR039C (ENA2) [892] chr4 complement(531302..534577) Member of the
           Na[+]-transporting ATPases family in the superfamily of
           P-type ATPases [3276 bp, 1091 aa]
          Length = 1091

 Score = 57.8 bits (138), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 117/530 (22%), Positives = 210/530 (39%), Gaps = 108/530 (20%)

Query: 504 NLVPISLFVTVEL-IKYYQAFMIGSDLDLYYEKTDTPTVVRTSSLVEELGQIEYIFSDKT 562
           +++P SL V + + +    A M+  ++           +VR    +E LG +  I SDKT
Sbjct: 323 SMIPSSLVVVLTITMSVGAAVMVSRNV-----------IVRKLDSLEALGAVNDICSDKT 371

Query: 563 GTLTRNIM--------EFKSCSIAGH-----------CYIDKIPEDKTATVEDGIEVG-Y 602
           GTLT+  M         F + +I+               I +    + +  EDG +VG  
Sbjct: 372 GTLTQGKMLARQIWIPRFGTITISNSDDPFNPNEGNVSLIPRFSPYEYSHNEDG-DVGIL 430

Query: 603 RKFDDLKKKLNDPSDEDSPIINDFLTLLATCHTVIPEFQSDGSIKYQA-ASPDEGAL--V 659
           + F D   + + P D D  +   +L   AT   +   F+ D +  ++A   P E A+   
Sbjct: 431 QNFKDRLYEKDLPEDIDMDLFQKWLET-ATLANIATVFKDDATDCWKAHGDPTEIAIQVF 489

Query: 660 QGGADLGYKFIIRKG-------NSVTVLLEETGEEKEYQLLNICEF--NSTRKRMSAIF- 709
               DL +  +  +        N  + L +   +    Q  +I EF  +ST KRMS+++ 
Sbjct: 490 ATKMDLPHNALTGEKSTNQSNENDQSSLSQHNEKPGSAQFEHIAEFPFDSTVKRMSSVYY 549

Query: 710 RFPDGSIKLFCKGADTVILE-----------RLDDEANQYVEATMRHLEDYASEGLRTLC 758
              + +  ++ KGA   I+            ++    +  VE   +++   ++EGLR L 
Sbjct: 550 NNHNETYNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDVETIRKNVYSLSNEGLRVLG 609

Query: 759 LAMRDISEGEYEEWNSIYNEAATTLDNRAEKLDEAANLIEKNLILIGATAIEDKLQDGVP 818
            A +  ++ +  +     ++      NRA          E +L+ +G   I D  ++   
Sbjct: 610 FASKSFTKDQVND-----DQLKNITSNRATA--------ESDLVFLGLIGIYDPPRNETA 656

Query: 819 ETIHTLQEAGIKIWVLTGDRQETAINIGMSCRLLSEDMNLLIINEETRDDTERNLLEKIN 878
             +    +AGI + +LTGD   TA  I     +L    NL   ++E  D           
Sbjct: 657 GAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILP--TNLYHYSQEIVD----------- 703

Query: 879 ALNEHQLSTHDMKSLALVIDGKSLGFALEPELEDYLLTVAKLCKAVICCRVSPLQKALVV 938
                          ++V+ G       E E++D  L V  L    +  R SP  K  ++
Sbjct: 704 ---------------SMVMTGSQFDGLSEEEVDD--LPVLPL----VIARCSPQTKVRMI 742

Query: 939 KMVKRKXXXXXXAIASGANDVSMIQAAHVGVGISGMEGMQAARSA-DIAL 987
           + + R+          G ND   ++ A+VG+ + G+ G   ++ A DI L
Sbjct: 743 EALHRRKKFCAMT-GDGVNDSPSLKMANVGIAM-GINGSDVSKEASDIVL 790

 Score = 31.2 bits (69), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 47/106 (44%), Gaps = 16/106 (15%)

Query: 248 YTTIGTLLVVLIVSAMKECIED---IKRANSDKELNNSTAEIFSEAHDDFVEKRWIDIRV 304
           + T G +  V+ V+ +   +++    K  NS K L++  A +      + +  +  D+  
Sbjct: 91  WITGGVISFVIAVNVLIGLVQEYKATKTMNSLKNLSSPNAHVIRNGKSETINSK--DVVP 148

Query: 305 GDIIRVKSEEPIPADTIILSSSEPEGLCYIETANLDGETNLKIKQS 350
           GDI  VK  + IPAD           L  IET N D + +L   +S
Sbjct: 149 GDICLVKVGDTIPAD-----------LRLIETKNFDTDESLLTGES 183

>YGL167C (PMR1) [1823] chr7 complement(187620..190472)
           Ca2+-transporting P-type ATPase of Golgi membrane
           involved in Ca2+ and Mn2+ import into Golgi [2853 bp,
           950 aa]
          Length = 950

 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 88/359 (24%), Positives = 148/359 (41%), Gaps = 60/359 (16%)

Query: 541 VVRTSSLVEELGQIEYIFSDKTGTLTRNIMEFKS--C--SIAGHCYIDKIPEDKTATVED 596
           +VR    VE LG +  I SDKTGTLT N M      C  S++    +  + ++K     +
Sbjct: 352 IVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKLWCLDSMSNKLNVLSLDKNKKTKNSN 411

Query: 597 GIEVGYRKFDDLKKKLNDPSDEDSPIINDFLTLLATCHTVIPEFQSDGSIKYQAASPDEG 656
           G         +LK  L     ED   + + LT+   C+     F  + +I     +P + 
Sbjct: 412 G---------NLKNYLT----ED---VRETLTIGNLCNNA--SFSQEHAIFL--GNPTDV 451

Query: 657 ALVQGGADLGYKFIIRKGNSVTVLLEETGEEKEYQLLNICEFNSTRKRMSAIFRFP-DGS 715
           AL++  A+     I                    Q +    FNS RK M+     P D  
Sbjct: 452 ALLEQLANFEMPDI----------------RNTVQKVQELPFNSKRKLMATKILNPVDNK 495

Query: 716 IKLFCKGADTVILERLDDEANQYVEATMRHLEDYASEGLRTLCLAMRDISEGEYEEWNSI 775
             ++ KGA     ER+ + +  Y+++  +  E        T+     + +     E   +
Sbjct: 496 CTVYVKGA----FERILEYSTSYLKSKGKKTEKLTEAQKATI----NECANSMASEGLRV 547

Query: 776 YNEAATTLDNRAEKLDEAANLIEKNLILIGATAIEDKLQDGVPETIHTLQEAGIKIWVLT 835
           +  A  TL + +  L E  +LI K+L   G   + D  +  V   I  L + G+ I ++T
Sbjct: 548 FGFAKLTLSDSSTPLTE--DLI-KDLTFTGLIGMNDPPRPNVKFAIEQLLQGGVHIIMIT 604

Query: 836 GDRQETAINIGMSCRLLSEDMNLLIIN----EETRDDTERNLLEKIN----ALNEHQLS 886
           GD + TA+NI     +   D  L +++    +E  DD   N+++ +N    A  EH+L+
Sbjct: 605 GDSENTAVNIAKQIGIPVIDPKLSVLSGDKLDEMSDDQLANVIDHVNIFARATPEHKLN 663

>YEL031W (SPF1) [1394] chr5 (90258..93905) Putative
           Ca2+-transporting ATPase, member of the P-type ATPase
           superfamily of membrane transporters [3648 bp, 1215 aa]
          Length = 1215

 Score = 54.3 bits (129), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 70/280 (25%), Positives = 113/280 (40%), Gaps = 32/280 (11%)

Query: 697 EFNSTRKRMSAIFRFPDGSIKLFC--KGADTVILERLDDEANQYVEATMRHLEDYASEGL 754
           +F+S  KR ++I    D    LF   KGA   I ERL D    Y E      + +   G 
Sbjct: 581 QFSSALKRSASIASHNDA---LFAAVKGAPETIRERLSDIPKNYDEI----YKSFTRSGS 633

Query: 755 RTLCLAMRDISEGEYEEWNSIYNEAATTLDNRAEKLDEAANLIEKNLILIGATAIEDKLQ 814
           R L LA + + +    + + +         NR +        +E  L   G       L+
Sbjct: 634 RVLALASKSLPKMSQSKIDDL---------NRDD--------VESELTFNGFLIFHCPLK 676

Query: 815 DGVPETIHTLQEAGIKIWVLTGDRQETAINIGMSCRLLSEDMNLLIINEETRDDTE---R 871
           D   ETI  L E+  +  ++TGD   TA+++     ++  +  L++      DD +   R
Sbjct: 677 DDAIETIKMLNESSHRSIMITGDNPLTAVHVAKEVGIVFGE-TLILDRAGKSDDNQLLFR 735

Query: 872 NLLEKINALNEHQLSTHDMKSLALVIDGKSLGFALEPELEDYLLTVAKLCKAVICCRVSP 931
           ++ E ++   +    T D   L    D    G+AL   LE +      L    +  RVSP
Sbjct: 736 DVEETVSIPFDPSKDTFDHSKLFDRYDIAVTGYALN-ALEGHSQLRDLLRHTWVYARVSP 794

Query: 932 LQKALVVKMVKRKXXXXXXAIASGANDVSMIQAAHVGVGI 971
            QK  ++  +K            G NDV  ++ AHVG+ +
Sbjct: 795 SQKEFLLNTLK-DMGYQTLMCGDGTNDVGALKQAHVGIAL 833

>Kwal_56.23467
          Length = 280

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 52/238 (21%), Positives = 103/238 (43%), Gaps = 24/238 (10%)

Query: 1094 FWGWIINGFFHSAIVFIGTILIYRYGFALNMHGELADHWSWGVTVYTTSVIIVLGKAALV 1153
            FW ++++G + S I F    L Y     ++ +G   DH  W V +   S+  V     ++
Sbjct: 10   FWLYMVDGLYQSVISFFFPFLAYYKTGMVSPNGLGLDHRYW-VGILVGSIASVSCNLYIL 68

Query: 1154 TNQ--WTKFTLIAIPGSLLFWLIFFPIYASIFPHANISREYYGVVKHTYGSGVFWLTLIV 1211
             +Q  W  F+ + I  S L  +++   +  I+     S E+Y    H YGS ++W    V
Sbjct: 69   IHQFRWDWFSTLFIALSCL--VVY--GWTGIWSTFTTSGEFYKSAAHVYGSPIYWAIFFV 124

Query: 1212 LPIFALVRDFLWKYYKRMYEPETYHVIQEM----------QKYNISD-SRPHVQQFQNAI 1260
              +F L+  F +  +++M+ P+   +I+E           + Y+ +D +RP + +    +
Sbjct: 125  GVLFCLLPRFTFDVFQKMFFPKDIDIIREFWVQGHFDQYPEDYDPTDPNRPQIAKADTKL 184

Query: 1261 RKVRQVQRMKKQRGFAFSQAEEGGQEKIVRMYDTTQKRGKYGELQDASANPFNDNNGL 1318
               R V+        A + A  G ++ +     T +    + E  D +  PF+  + +
Sbjct: 185  HP-RYVEE-GSDYAHAITTANHGSRDTVY----TEEIPMTFMEADDNNPEPFHPRSNI 236

>CAGL0A00517g 58830..62198 similar to sp|P38929 Saccharomyces
           cerevisiae YGL006w PMC1, hypothetical start
          Length = 1122

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 125/578 (21%), Positives = 210/578 (36%), Gaps = 136/578 (23%)

Query: 474 AKHLSYLYLEG--------TNKAGLFFKDFLTFWILFSNLVPISLFVTVELIKYYQAFMI 525
           A++LSY+   G          K   F   F+T   +    VP  L + V L   +    +
Sbjct: 324 ARYLSYILPSGGKYHDLPPAEKGSKFMDIFITAITVIVVAVPEGLPLAVTLALAFATTRM 383

Query: 526 GSDLDLYYEKTDTPTVVRTSSLVEELGQIEYIFSDKTGTLTRNIMEFKSCSIAGHCYIDK 585
             D +L          VR     E +G    + SDKTGTLT NIM     ++ G    D 
Sbjct: 384 TKDGNL----------VRVLRSCETMGSATAVCSDKTGTLTENIMTVVRGTL-GRAGFDD 432

Query: 586 IPEDKTAT---------------VEDGIEVGYRKFDDLKKKLNDPSD----EDSPIINDF 626
           I  D + +               + D I +    F++  K   DP++    +DS      
Sbjct: 433 IGADPSKSNLVFKKKCSDLLRTVIYDNIVLNSTAFEN--KDYKDPNNYNSIDDSQPRRLI 490

Query: 627 LTLLATCHTVIPEFQ-------SDGSIKYQAASPDEGALVQ-GGADLGYKFIIR---KGN 675
             +  T     P+ +       ++G  +    S  E AL+       G KF      +G+
Sbjct: 491 RRITQTLQKKKPDDEENLLAHAAEGRQEPYIGSKTETALLSLARKSFGLKFGALQSFRGH 550

Query: 676 SVTVLLEETGEEKEYQLLNICEFNSTRKRMSAIFRFPDGS------IKLFCKGADTVI-- 727
              +   ET       ++ I  F S+RK  + + +            +L+ KGA  ++  
Sbjct: 551 PEKLPTVET-------IVQIIPFESSRKWSAIVVKLNSNKENEGKKFRLYVKGAAEIVAK 603

Query: 728 -----------LERLDDEANQYVEATMRHLEDYASEGLRTLCLAMRDISEGEY------E 770
                      +  +D ++   +E  +  L   A + LR + LA  D    E+      +
Sbjct: 604 ACTLKNVCNEGISEIDQKSKDDIEEQIFSL---AKDALRAISLAHMDFDVNEWPPKELAD 660

Query: 771 EWNSIYNEAATTLDNRAEKLDEAANLIEKNLILIGATAIEDKLQDGVPETIHTLQEAGIK 830
             NS    A   +D +   L+         L L     I+D L++ V  ++   Q+AG+ 
Sbjct: 661 PENSHEALAVKLIDPKKPHLE--------GLTLDAIVGIQDPLRENVKNSVAQCQKAGVT 712

Query: 831 IWVLTGDRQETAINIGMSCRLLSEDMNLLIINEETRDDTERNLLEKINALNEHQLSTHDM 890
           + ++TGD   TA  I  +C +LS                         +LN+        
Sbjct: 713 VRMVTGDNLLTAKAIARNCGILSS-----------------------KSLNDS------- 742

Query: 891 KSLALVIDGKSLGFALEPELEDYLLTVAKLCKAVICCRVSPLQKALVVKMVKRKXXXXXX 950
              A  ++G +     + E +        L K  +  R SP  K ++V+ +K +      
Sbjct: 743 ---ACAMEGPAFRKLSDSERKRI------LPKLRVLARSSPEDKKILVRALK-EMGEVVA 792

Query: 951 AIASGANDVSMIQAAHVGVGISGMEGMQAARSA-DIAL 987
               G ND   ++ A VG  + G+ G + AR A DI L
Sbjct: 793 VTGDGTNDAPALKLADVGFSM-GITGTEVAREASDIIL 829

>CAGL0L01419g 156123..159767 highly similar to sp|P39986
           Saccharomyces cerevisiae YEL031w SPF1 P-type ATPase,
           hypothetical start
          Length = 1214

 Score = 51.2 bits (121), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 117/502 (23%), Positives = 197/502 (39%), Gaps = 93/502 (18%)

Query: 479 YLYLEGTNKAGLFFKDFLTFWILFSNLVPISLFVTVELIKYYQAFMIGSDLDLYYEKTDT 538
           Y+++EGT    +  K  L   ++ +++VP  L   +EL     + +  S L  +Y     
Sbjct: 414 YVWVEGTKMGRVQSKLILDCILIITSVVPPEL--PMELTMAVNSSL--SALSKFYVYCTE 469

Query: 539 PTVVRTSSLVEELGQIEYIFSDKTGTLTRNIMEFKSCSIAGHCYIDKIPEDKTATVEDGI 598
           P  +  +      G+I+    DKTGTLT   + F+   +AG   +   P+D        I
Sbjct: 470 PFRIPFA------GRIDVCCFDKTGTLTGEDLVFEG--LAG---LSSDPKD--------I 510

Query: 599 EVGYRKFDDLKKKLNDPSDEDSPIINDFLTLLATCHTVIPEFQSDGSIKYQAASPDEGAL 658
              Y             S  D P  N    ++   H ++     DG I      P E A 
Sbjct: 511 RHLY-------------SATDCP--NSTSLVVGAAHALVR--LEDGEI---VGDPMEKAT 550

Query: 659 VQGGADLGYKFIIRKGNSVTVLLEETGEEKEYQLLNICEFNSTRKRMSAIFRFPDGSIKL 718
           ++       K+ + KG+ V    E+ G+     +L   +F+S  KR S++    DG +  
Sbjct: 551 LKA-----LKWTVEKGDKV--FNEKNGQ---VTILRRFQFSSALKRSSSVATH-DGKLYS 599

Query: 719 FCKGADTVILERLDDEANQYVEATMRHLEDYASEGLRTLCLAMRDISEGEYEEWNSIYNE 778
             KGA   I ERL      Y E      + +   G R L LA + + +            
Sbjct: 600 AVKGAPETIRERLFTIPANYDEI----YKSFTRSGSRVLALASKKLEKM----------- 644

Query: 779 AATTLDNRAEKLDEAANLIEKNLILIGATAIEDKLQDGVPETIHTLQEAGIKIWVLTGDR 838
                 ++++  D      E++L   G       L+    ETI  L E+  +  ++TGD 
Sbjct: 645 ------SQSQIEDADREHFERDLEFNGFLIFHCPLKHDAIETIQMLNESAHRCVMITGDN 698

Query: 839 QETAINIGMSCRLLSEDMNLLIINEETRDD--TERNLLEKINALNEHQLSTHDMKSLALV 896
             TA+++     ++  +  ++ + +   DD    RN+ E ++   E  +S    +   + 
Sbjct: 699 PLTAVHVAKEVGIVKGETLIVDMVDNGNDDKLVFRNVEETLSF--EFVVSKDSFEKYGIF 756

Query: 897 --IDGKSLGFALEP-----ELEDYLLTVAKLCKAVICCRVSPLQKALVVKMVKRKXXXXX 949
              D    G ALE      +L+D +        A I  RVSP QK  ++  +K       
Sbjct: 757 DKYDLAVTGHALEALKGHHQLQDLIR------HAWIYARVSPAQKEFILNNLK-DMGYQT 809

Query: 950 XAIASGANDVSMIQAAHVGVGI 971
                G NDV  ++ AHVGV +
Sbjct: 810 LMCGDGTNDVGALKQAHVGVAL 831

>CAGL0K12034g complement(1161299..1164562) highly similar to
           sp|P13587 Saccharomyces cerevisiae YDR040c ENA1 or
           sp|Q01896 Saccharomyces cerevisiae YDR039c ENA2 or
           sp|Q12691 Saccharomyces cerevisiae YDR038c ENA5,
           hypothetical start
          Length = 1087

 Score = 50.4 bits (119), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 70/303 (23%), Positives = 122/303 (40%), Gaps = 62/303 (20%)

Query: 698 FNSTRKRMSAIFRFPD-GSIKLFCKGADTVILE-------RLDDEANQYVEATM----RH 745
           F+ST KRMS+++   D  + +++ KGA   +L        R  + A    +A +     +
Sbjct: 532 FDSTIKRMSSVYESRDYKTYEIYTKGAFESVLNCCTHWYGRDPNTATVMTDADVDTIKEN 591

Query: 746 LEDYASEGLRTLCLAMRDISEGEYEEWNSIYNEAATTLDNRAEKLDEAANLIEKNLILIG 805
           ++  +SEGLR L  A +   + +  E              + +K+ +  +  E  L  +G
Sbjct: 592 IDSMSSEGLRVLAFANKSYPKSDVNE-------------EKLQKILKERDYAETGLTFLG 638

Query: 806 ATAIEDKLQDGVPETIHTLQEAGIKIWVLTGDRQETAINIGMSCRLLSEDMNLLIINEET 865
              I D  ++     +    +AGI + +LTGD   TA  I     +L    NL   ++E 
Sbjct: 639 LIGIYDPPREETAGAVKKFHQAGINVRMLTGDFPGTAKAIAQEVGILP--TNLYHYSKEV 696

Query: 866 RDDTERNLLEKINALNEHQLSTHDMKSLALVIDGKSLGFALEPELEDYLLTVAKLCKAVI 925
            D                           +V+ GK      E E+++  L V  L    +
Sbjct: 697 VD--------------------------IMVMTGKQFDNLSEDEIDN--LPVLPL----V 724

Query: 926 CCRVSPLQKALVVKMVKRKXXXXXXAIASGANDVSMIQAAHVGVGISGMEGMQAARSA-D 984
             R SP  K  +++ + R+          G ND   ++ A+VG+ + G+ G   A+ A D
Sbjct: 725 IARCSPQTKVRMIEALHRREKFCAMT-GDGVNDSPSLKMANVGIAM-GINGSDVAKDASD 782

Query: 985 IAL 987
           I L
Sbjct: 783 IVL 785

>Kwal_14.1498
          Length = 939

 Score = 50.4 bits (119), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 100/461 (21%), Positives = 170/461 (36%), Gaps = 119/461 (25%)

Query: 541 VVRTSSLVEELGQIEYIFSDKTGTLTRNIMEFKSCSIAGHCYIDKI-PEDKTATVEDGIE 599
           ++R    VE LG +  I SDKTGTLT           A H  ++K+      +   + ++
Sbjct: 347 IIRRLPSVETLGSVNVICSDKTGTLT-----------ANHMSVNKVWCLGSMSNKSNILK 395

Query: 600 VGYRKFDDLKKKLNDPSDEDSPIINDFLTLLATCHTVIPEFQSDGSIKYQAASPDEGALV 659
           +        KK L +          D    L T +       S    KY   +P + AL+
Sbjct: 396 LDKATSGSFKKNLTE----------DLRATLRTGNLCNNSTYSHEHAKY-LGNPTDIALL 444

Query: 660 QGGADLGYKFIIRKGNSVTVLLEETGEEKEYQLLNICEFNSTRKRMSAIFRFPDGSIKLF 719
           +    + +KF +              E  +    +   FNS RK M+   +  +G   + 
Sbjct: 445 E----VLHKFGLED------------ERPQVTRSDEISFNSKRKFMAVKVKEANGKFVVH 488

Query: 720 CKGADTVILER-------------LDDEANQYVEATMRHLEDYASEGLRTLCLAMRDISE 766
            KGA   ILE+             LD    Q +  +   L   AS+GLRTL  A  ++S 
Sbjct: 489 VKGAYEKILEKSTHFINAENKVVKLDSNLRQAITDSADAL---ASDGLRTLAFAQLELSN 545

Query: 767 GEYEEWNSIYNEAATTLDNRAEKLDEAANLIEKNLILIGATAIEDKLQDGVPETIHTLQE 826
           G         N    T D+               L   G   + D  +  V   +  L E
Sbjct: 546 G---------NSKKLTEDDI------------NGLTFAGLLGMNDPPRPSVKAAVERLSE 584

Query: 827 AGIKIWVLTGDRQETAINIGMSCRLLSEDMNLLIINEETRDDTERNLLEKINALNEHQLS 886
             + I ++TGD + TA++I       +  + + ++N ET   T     +K++ ++E QL+
Sbjct: 585 GSVHIIMITGDAENTAVSI-------ARQIGIPVVNPETAVLTG----DKLDHMSEDQLA 633

Query: 887 THDMKSLALVIDGKSLGFALEPELEDYLLTVAKLCKAVICCRVSPLQKALVVKMVKRKXX 946
           +        +ID  +                       I  R +P  K  +V+ ++++  
Sbjct: 634 S--------IIDHVN-----------------------IFARATPEHKLNIVRALQKRGD 662

Query: 947 XXXXAIASGANDVSMIQAAHVGVGISGMEGMQAARSADIAL 987
                   G ND   ++ A +GV +  M    A  ++D+ L
Sbjct: 663 IVAMT-GDGVNDAPALKLADIGVSMGKMGTDVAKEASDMVL 702

>AGL097C [4215] [Homologous to ScYDR039C (ENA2 ) - NSH]
            (520915..524205) [3291 bp, 1096 aa]
          Length = 1096

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 171/780 (21%), Positives = 281/780 (36%), Gaps = 176/780 (22%)

Query: 541  VVRTSSLVEELGQIEYIFSDKTGTLTRNIMEFKSCSIA--GHCYIDK--IPEDKTA---- 592
            +VR    +E LG +  I SDKTGTLT+  M  K   +   G   +++  +P D T     
Sbjct: 352  IVRRLDSLEALGAVNDICSDKTGTLTQGKMILKQLWVPEFGTVVVNRSNVPFDPTVGDVS 411

Query: 593  -------------TVED-GIEVGYRK---FDDLKKKLNDPSDEDSPIINDFLTLLATCHT 635
                           ED GI   +++    + L K LN P   +S +    L  +AT   
Sbjct: 412  LIPRFSPWEYQHDEEEDVGIIANFKQRWQSNSLPKGLN-PRKFESWLHTATLANIATV-- 468

Query: 636  VIPEFQSDGSIKYQA-ASPDEGALVQGGADLGYKFIIRKGNSVTVLLEETGEE------- 687
                F+   S +++A   P E A+          F  R  +    L  E  EE       
Sbjct: 469  ----FKDSDSKEWRAHGDPTEIAI--------QVFATRMDHPHHALTTEQDEEDSDSSQQ 516

Query: 688  ----KEYQLLNICEFNSTRKRMSAIF-RFPDGSIK-LFCKGADTVILE-----RLDDEAN 736
                + Y+      F+S+ KRMSA++    D + + +F KGA   +L+     +LD    
Sbjct: 517  NDAARIYEHAAEFPFDSSIKRMSAVYINLRDKNTRHVFTKGAFERVLKCCTRWKLDPGTG 576

Query: 737  -------QYVEATMRHLEDYASEGLRTLCLAMRDISEGEYEEWNSIYNEAATTLDNRAEK 789
                     +E   ++++  ++EGLR L  A + I   E E              +  E+
Sbjct: 577  VTHPLTEDDLEIIQKNVDTLSNEGLRVLAFATKTIPAEEAE--------------SLGER 622

Query: 790  LDEAANLIEKNLILIGATAIEDKLQDGVPETIHTLQEAGIKIWVLTGDRQETAINIGMSC 849
            L +  + +E +LI  G   I D  +      +     AGI + +LTGD   TA  I    
Sbjct: 623  LTKDRDFVESDLIFQGLVGIYDPPRVETAGAVKKCHRAGINVHMLTGDFPGTAKAIAQEV 682

Query: 850  RLLSEDMNLLIINEETRDDTERNLLEKINALNEHQLSTHDMKSLALVIDGKSLGFALEPE 909
             +L    NL    +E  D      +  + A     L+  ++  L ++             
Sbjct: 683  GILPH--NLYHYPKEVVD------IMVMTATQFDSLTDEELDQLPVL------------- 721

Query: 910  LEDYLLTVAKLCKAVICCRVSPLQKALVVKMVKRKXXXXXXAIASGANDVSMIQAAHVGV 969
                          ++  R +P  K  ++  + R+          G ND   ++ A+VG+
Sbjct: 722  -------------PLVIARCAPQTKVRMIDALHRREKFCAMT-GDGVNDSPSLKKANVGI 767

Query: 970  GISGMEGMQAARSA-DIALGQXXXXXXXXXV-HGSWSYQRISVAILYSFYKNTALYMTQF 1027
             + G+ G   A+ A DI L           V  G      I   +L     N A      
Sbjct: 768  AM-GINGSDVAKDASDIVLSDDNFASILNAVEEGRRMSDNIQKFVLQLLAANVA---QAI 823

Query: 1028 WYVFANAFSGQSIMESWTMSFYNLFFTV-----WPPFVIGVFDQFVSSRLLERYPQLYKL 1082
            + +    F  +  +  + +S   + + +      P   +G+  +  +  ++E+ P   K 
Sbjct: 824  YLMLGLTFLDEDKLSVFPLSPVEVLWIIVVTSCLPAMGLGL--EKAAPDIMEKPPNDSKA 881

Query: 1083 GQKGQFFSVYIFWGWIINGFFHSAIVFIGTI--LIYRYGFALNMHGELADHWSWGVTVYT 1140
            G     F+  +    I+ G    A+  +G    +IY+ G     HG L  + +     Y+
Sbjct: 882  G----IFTWEVIVDMIVYGLVM-AVCCLGCFVSIIYKDG-----HGNLGTNCN---VEYS 928

Query: 1141 TSVIIVL-GKAA-LVTNQWTKFTL-----------------IAIP----------GSLLF 1171
             S   V  G+AA   T  W    L                    P             LF
Sbjct: 929  DSCKSVFSGRAATFATMTWCALILAWEVIDMRRSFFAMKPETDTPYTQVFKDIWSNKFLF 988

Query: 1172 WLIFFPIYASIFPHANISREYYGVVKHTYGSGVFW-LTLIVLPIFALVRDFLWKYYKRMY 1230
            W + F  + S+FP   I      V  H  G G  W +      +F LV +F WK+ KR Y
Sbjct: 989  WSVIFG-FTSVFPVVYIPVINTKVFLH-IGIGYEWGIAFAFSLVFWLVAEF-WKFAKRRY 1045

>AFR354C [3546] [Homologous to ScYEL031W (SPF1) - SH]
           (1078275..1081907) [3633 bp, 1210 aa]
          Length = 1210

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 67/275 (24%), Positives = 110/275 (40%), Gaps = 44/275 (16%)

Query: 721 KGADTVILERLDDEANQYVEATMRHLEDYASEGLRTLCLAMRDISEGEYEEWNSIYNEAA 780
           KGA   I ERL      Y +      + +   G R L LA + +     ++         
Sbjct: 605 KGAPETIRERLSQVPTDYDQV----YKSFTRAGSRVLALASKKLPSMSIKQ--------- 651

Query: 781 TTLDNRAEKLDEAANLIEKNLILIGATAIEDKLQDGVPETIHTLQEAGIKIWVLTGDRQE 840
                  EKL+  A  +E +L   G       L+D   ETI  L E+  +  ++TGD   
Sbjct: 652 ------IEKLEREA--VESDLEFKGFLVFHCPLKDDAIETIKMLNESSHRCIMITGDNPL 703

Query: 841 TAINIGMSCRLLSEDMNLLIINEETRDDTE----RNLLEKI-NALNEHQLSTHDMKSLAL 895
           TA+++     ++  +   LI++E     +     RN+ E I N  N  +  T +   L  
Sbjct: 704 TAVHVAKEVAIVERET--LILDEPIDGSSHALVFRNIEETIVNPFNPEK-DTFEHSKLFA 760

Query: 896 VIDGKSLGFALEPELEDYLLTVAKLCKAV----ICCRVSPLQKALVVKMVKRKXXXXXXA 951
             D    G AL+      L   ++L + +    +  RVSP QK  ++  +K         
Sbjct: 761 KYDIAVTGHALQ-----LLSGHSQLNELIRHTWVYARVSPAQKEFIMNSLK-DMGYQTLM 814

Query: 952 IASGANDVSMIQAAHVGVGI-----SGMEGMQAAR 981
              G NDV  ++ AHVG+ +      G++ +Q  R
Sbjct: 815 CGDGTNDVGALKQAHVGIALLNGTEEGLKKLQEQR 849

>CAGL0J01870g 181666..184506 highly similar to sp|P13586
           Saccharomyces cerevisiae YGL167c PMR1, hypothetical
           start
          Length = 946

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 107/458 (23%), Positives = 174/458 (37%), Gaps = 131/458 (28%)

Query: 541 VVRTSSLVEELGQIEYIFSDKTGTLTRNIMEFKS--CSIAGHCYIDKI-PEDKTATVEDG 597
           +VR    VE LG +  I +DKTGTLT N M      C  +   Y + I PE+ +      
Sbjct: 359 IVRRLPSVETLGSVNVICTDKTGTLTTNHMTVSKLFCLDSSGTYENAISPEEDS------ 412

Query: 598 IEVGYRKFDDLKKKLNDPSDEDSPIINDFLTLLATCHTVIPEFQSDGSIKYQAASPDEGA 657
                 +FD          D D   + + LT+   C+    ++  + ++     +P + A
Sbjct: 413 ------EFD--------VHDND---VKETLTIANICNNA--KYSEEHNLYI--GNPTDVA 451

Query: 658 LVQGGADLGYKFIIRKGNSVTVLLEETGEEKEYQLLNICEFNSTRKRMSAIFRFPDGSIK 717
           L++    +  KF I          +    EK  +L     FNS RK M+       G   
Sbjct: 452 LIE----VLTKFGIPD--------QRDSHEKMEEL----SFNSKRKYMAIKSSKESGEHV 495

Query: 718 LFCKGADTVILERLDDEANQYVE--ATMRHLEDY------------ASEGLRTLCLAMRD 763
           L+ KGA     ER+ D+++ Y++    +R  +++            AS+GLRT+  A + 
Sbjct: 496 LYIKGA----FERILDKSSYYLDKAGEVREFDEHSKVMVLEAAHSCASDGLRTIACAFK- 550

Query: 764 ISEGEYEEWNSIYNEAATTLDNRAEKLDEAANLIEKNLILIGATAIEDKLQDGVPETIHT 823
                            T  DN   + D         L   G   + D  +  V  +I  
Sbjct: 551 ----------------PTDSDNVISEDDI------NGLTFTGLFGLADPPRPNVKASIEK 588

Query: 824 LQEAGIKIWVLTGDRQETAINIGMSCRLLSEDMNLLIINEETRDDTERNLLEKINALNEH 883
           L   G+ I ++TGD   TA++I       +E + L + + E+   T     +K++ L E 
Sbjct: 589 LHRGGVHIIMITGDSVNTAVSI-------AEKIGLSVQDRESSVMTG----DKVSELTED 637

Query: 884 QLSTHDMKSLALVIDGKSLGFALEPELEDYLLTVAKLCKAVICCRVSPLQKALVVKMVKR 943
           +LS         VID                       K  I  R +P  K  +VK + R
Sbjct: 638 ELSK--------VID-----------------------KVNIFARATPENKLNIVKAL-R 665

Query: 944 KXXXXXXAIASGANDVSMIQAAHVGVGISGMEGMQAAR 981
           K          G ND   ++ A +G+ + G+ G   A+
Sbjct: 666 KRGDIVAMTGDGVNDAPALKLADIGIAM-GISGTDVAK 702

>Scas_707.48*
          Length = 741

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 70/300 (23%), Positives = 110/300 (36%), Gaps = 75/300 (25%)

Query: 698 FNSTRKRMSAIFRFPDGSIKLFCKGADTVILERLDDEANQ----------YVEATMRHLE 747
           FNS RK M+      +G   L  KGA   +L +     NQ            +  +    
Sbjct: 472 FNSKRKFMAVKIVNSEGKYSLCVKGAFEKVLSQCSHYLNQKGKTEKLTQGQRDVIIETAN 531

Query: 748 DYASEGLRTLCLAMRDISEGEYEEWNSIYNEAATTLDNRAEKLDEAANLIEKNLILIGAT 807
             ASEGLR L  A                    TTL +    L E +     +LI  G  
Sbjct: 532 SLASEGLRMLAFA-------------------KTTLPDSPTLLTEES---VGDLIFTGLI 569

Query: 808 AIEDKLQDGVPETIHTLQEAGIKIWVLTGDRQETAINIGMSCRLLSEDMNLLIINEETRD 867
            + D  +  V   I  L + G+ I ++TGD + TA+NI     +   D  L +++ +   
Sbjct: 570 GMNDPPRPTVKPAIEQLLQGGVHIIMITGDSENTAVNIARQIGIPVLDPKLSVLSGD--- 626

Query: 868 DTERNLLEKINALNEHQLSTHDMKSLALVIDGKSLGFALEPELEDYLLTVAKLCKAVICC 927
                   K+N +++ QL+         VID  ++ FA                      
Sbjct: 627 --------KLNEMSDDQLAN--------VIDHVNI-FA---------------------- 647

Query: 928 RVSPLQKALVVKMVKRKXXXXXXAIASGANDVSMIQAAHVGVGISGMEGMQAARSADIAL 987
           R +P  K  +V+ + RK          G ND   ++ A +GV +  M    A  ++D+ L
Sbjct: 648 RATPEHKLNIVRAL-RKRGDVVAMTGDGVNDAPALKLADIGVSMGRMGTDVAKEASDMVL 706

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 17/30 (56%), Positives = 19/30 (63%)

Query: 541 VVRTSSLVEELGQIEYIFSDKTGTLTRNIM 570
           +VR    VE LG +  I SDKTGTLT N M
Sbjct: 352 IVRRLPSVETLGSVNVICSDKTGTLTSNHM 381

>Kwal_47.17522
          Length = 899

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 38/174 (21%), Positives = 72/174 (41%), Gaps = 41/174 (23%)

Query: 689 EYQLLNICEFNSTRKRMSAIFRFPDGSIKLFCKGADTVILERLDDE---ANQYVEATMRH 745
           +Y++L+   F+   K+++A+   P+G   +  KGA   +L+ ++++        E     
Sbjct: 423 KYKVLDFHPFDPVSKKVTAVVESPEGERIICVKGAPLFVLKTVEEDHPIPEDVHENYENK 482

Query: 746 LEDYASEGLRTLCLAMRDISEGEYEEWNSIYNEAATTLDNRAEKLDEAANLIEKNLILIG 805
           + + AS G R L +A R   EG +E                                ++G
Sbjct: 483 VAELASRGFRALGVA-RKRGEGHWE--------------------------------ILG 509

Query: 806 ATAIEDKLQDGVPETIHTLQEAGIKIWVLTGDRQETAINIGM-SCRLLSEDMNL 858
                D  +D   +T+H  +  G+++ +LTGD    A+ I   +CR L    N+
Sbjct: 510 VMPCMDPPRDDTAQTVHEARRLGLRVKMLTGD----AVGIAKETCRQLGLGTNI 559

 Score = 32.3 bits (72), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 20/28 (71%)

Query: 541 VVRTSSLVEELGQIEYIFSDKTGTLTRN 568
           +V+  S +E L  +E + SDKTGTLT+N
Sbjct: 340 IVQKLSAIESLAGVEILCSDKTGTLTKN 367

>KLLA0A09031g 787768..790467 gi|1346734|sp|P49380|PMA1_KLULA
           Kluyveromyces lactis Plasma membrane ATPase (Proton
           pump), start by similarity
          Length = 899

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 40/174 (22%), Positives = 71/174 (40%), Gaps = 41/174 (23%)

Query: 689 EYQLLNICEFNSTRKRMSAIFRFPDGSIKLFCKGADTVILERLDDE---ANQYVEATMRH 745
           +Y+LL    F+   K+++AI   P+G   +  KGA   +L+ +++E        E     
Sbjct: 423 KYKLLEFHPFDPVSKKVTAIVESPEGERIICVKGAPLFVLKTVEEEHPIPEDVRENYENK 482

Query: 746 LEDYASEGLRTLCLAMRDISEGEYEEWNSIYNEAATTLDNRAEKLDEAANLIEKNLILIG 805
           + + AS G R L +A R   EG +E                                ++G
Sbjct: 483 VAELASRGFRALGVA-RKRGEGHWE--------------------------------ILG 509

Query: 806 ATAIEDKLQDGVPETIHTLQEAGIKIWVLTGDRQETAINIGM-SCRLLSEDMNL 858
                D  +D   +T++  +  G+++ +LTGD    A+ I   +CR L    N+
Sbjct: 510 VMPCMDPPRDDTAQTVNEARHLGLRVKMLTGD----AVGIAKETCRQLGLGTNI 559

 Score = 32.3 bits (72), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 20/29 (68%)

Query: 540 TVVRTSSLVEELGQIEYIFSDKTGTLTRN 568
            +V+  S +E L  +E + SDKTGTLT+N
Sbjct: 339 AIVQKLSAIESLAGVEILCSDKTGTLTKN 367

>KLLA0A03157g complement(281313..284129) gi|3288523|emb|CAA04476.1
           Kluyveromyces lactis Ca++ ATPase, start by similarity
          Length = 938

 Score = 40.0 bits (92), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 68/307 (22%), Positives = 120/307 (39%), Gaps = 77/307 (25%)

Query: 693 LNICEFNSTRKRMSAIFRFPDGSIKLFCKGADTVILER------LDDEANQYVEATMRHL 746
           +N   FNS RK M+      +  + ++ KGA   I+E+       D + ++        +
Sbjct: 460 INEIPFNSKRKFMAVKTIDANDKVVVYVKGAFEKIVEKSINYIGRDGKVHKLKPNDKAII 519

Query: 747 ED----YASEGLRTLCLAMRDIS--EGEYEEWNSIYNEAATTLDNRAEKLDEAANLIEKN 800
            D     ASEGLRTL  A  ++S   G+ E     +NE                +++E  
Sbjct: 520 NDAAVALASEGLRTLAFAELEVSATHGDKE-----FNE----------------DMVE-G 557

Query: 801 LILIGATAIEDKLQDGVPETIHTLQEAGIKIWVLTGDRQETAINIGMSCRLLSEDMNLLI 860
           L   G  A+ D  +  V   I  L +  + + ++TGD + TA++I       +  + + +
Sbjct: 558 LTFTGLIAMNDPPRPTVRSAIEELLQGSVHVIMITGDAENTAVSI-------ARQIGIPV 610

Query: 861 INEETRDDTERNLLEKINALNEHQLSTHDMKSLALVIDGKSLGFALEPELEDYLLTVAKL 920
           IN E             + L+  +L       LA VID  ++ FA               
Sbjct: 611 INPE------------YSVLSGDKLDQMTDDQLASVIDHVNV-FA--------------- 642

Query: 921 CKAVICCRVSPLQKALVVKMVKRKXXXXXXAIASGANDVSMIQAAHVGVGISGMEGMQAA 980
                  R +P  K  +V+ ++++          G ND   ++ A +GV +  M    A 
Sbjct: 643 -------RATPEHKLNIVRALQKRGDIVAMT-GDGVNDAPALKLADIGVSMGKMGTDVAK 694

Query: 981 RSADIAL 987
            ++D+ L
Sbjct: 695 EASDMVL 701

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 17/30 (56%), Positives = 19/30 (63%)

Query: 541 VVRTSSLVEELGQIEYIFSDKTGTLTRNIM 570
           +VR    VE LG +  I SDKTGTLT N M
Sbjct: 347 IVRRLPSVETLGSVNVICSDKTGTLTANHM 376

>YPL036W (PMA2) [5403] chr16 (482839..485682) H[+]-transporting
           P-type ATPase of the plasma membrane, expression not
           detected under normal growth conditions [2844 bp, 947
           aa]
          Length = 947

 Score = 39.3 bits (90), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 39/174 (22%), Positives = 71/174 (40%), Gaps = 41/174 (23%)

Query: 689 EYQLLNICEFNSTRKRMSAIFRFPDGSIKLFCKGADTVILERLDDE---ANQYVEATMRH 745
           +Y++L    F+   K+++A+   P+G   +  KGA   +L+ ++++        E     
Sbjct: 471 KYKVLEFHPFDPVSKKVTAVVESPEGERIVCVKGAPLFVLKTVEEDHPIPEDVHENYENK 530

Query: 746 LEDYASEGLRTLCLAMRDISEGEYEEWNSIYNEAATTLDNRAEKLDEAANLIEKNLILIG 805
           + + AS G R L +A R   EG +E                                ++G
Sbjct: 531 VAELASRGFRALGVA-RKRGEGHWE--------------------------------ILG 557

Query: 806 ATAIEDKLQDGVPETIHTLQEAGIKIWVLTGDRQETAINIGM-SCRLLSEDMNL 858
                D  +D   +TI+  +  G++I +LTGD    A+ I   +CR L    N+
Sbjct: 558 VMPCMDPPRDDTAQTINEARNLGLRIKMLTGD----AVGIAKETCRQLGLGTNI 607

 Score = 32.3 bits (72), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 20/28 (71%)

Query: 541 VVRTSSLVEELGQIEYIFSDKTGTLTRN 568
           +V+  S +E L  +E + SDKTGTLT+N
Sbjct: 388 IVQKLSAIESLAGVEILCSDKTGTLTKN 415

>AGL085C [4226] [Homologous to ScYGL008C (PMA1) - SH; ScYPL036W
           (PMA2) - NSH] (546285..549014) [2730 bp, 909 aa]
          Length = 909

 Score = 38.5 bits (88), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 39/176 (22%), Positives = 72/176 (40%), Gaps = 45/176 (25%)

Query: 689 EYQLLNICEFNSTRKRMSAIFRFPDGSIKLFCKGADTVILERLDDEANQYVEATMRH--- 745
           +Y++L    F+   K+++AI   P+G   +  KGA   +L+ +  E N  +   ++    
Sbjct: 423 KYKVLEFHPFDPVSKKVTAIVESPEGERIVCVKGAPLFVLKTV--EENHLIPEDVKENYE 480

Query: 746 --LEDYASEGLRTLCLAMRDISEGEYEEWNSIYNEAATTLDNRAEKLDEAANLIEKNLIL 803
             + + AS G R L +A R   EG +E                                +
Sbjct: 481 NKVAELASRGYRALGVA-RKRGEGHWE--------------------------------I 507

Query: 804 IGATAIEDKLQDGVPETIHTLQEAGIKIWVLTGDRQETAINIGM-SCRLLSEDMNL 858
           +G     D  +D   +T++  +  G+++ +LTGD    A+ I   +CR L    N+
Sbjct: 508 LGVMPCMDPPRDDTAQTVNEARHLGLRVKMLTGD----AVGIAKETCRQLGLGTNI 559

 Score = 32.3 bits (72), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 20/29 (68%)

Query: 540 TVVRTSSLVEELGQIEYIFSDKTGTLTRN 568
            +V+  S +E L  +E + SDKTGTLT+N
Sbjct: 339 AIVQKLSAIESLAGVEILCSDKTGTLTKN 367

>CAGL0A00495g complement(55014..57722) highly similar to sp|P05030
           Saccharomyces cerevisiae YGL008c PMA1 or sp|P19657
           Saccharomyces cerevisiae YPL036w PMA2, hypothetical
           start
          Length = 902

 Score = 38.5 bits (88), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 37/174 (21%), Positives = 71/174 (40%), Gaps = 41/174 (23%)

Query: 689 EYQLLNICEFNSTRKRMSAIFRFPDGSIKLFCKGADTVILERLDDE---ANQYVEATMRH 745
           +Y+++    F+   K+++A+   P+G   +  KGA   +L+ ++++        E     
Sbjct: 426 KYKVIEFHPFDPVSKKVTAVVESPEGERIVCVKGAPLFVLKTVEEDHPIPEDVHENYENK 485

Query: 746 LEDYASEGLRTLCLAMRDISEGEYEEWNSIYNEAATTLDNRAEKLDEAANLIEKNLILIG 805
           + + AS G R L +A R   EG +E                                ++G
Sbjct: 486 VAELASRGFRALGVA-RKRGEGHWE--------------------------------ILG 512

Query: 806 ATAIEDKLQDGVPETIHTLQEAGIKIWVLTGDRQETAINIGM-SCRLLSEDMNL 858
                D  +D   ET++  +  G+++ +LTGD    A+ I   +CR L    N+
Sbjct: 513 VMPCMDPPRDDTAETVNEARRLGLRVKMLTGD----AVGIAKETCRQLGLGTNI 562

 Score = 32.3 bits (72), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 20/29 (68%)

Query: 540 TVVRTSSLVEELGQIEYIFSDKTGTLTRN 568
            +V+  S +E L  +E + SDKTGTLT+N
Sbjct: 342 AIVQKLSAIESLAGVEILCSDKTGTLTKN 370

>Scas_688.1
          Length = 913

 Score = 38.1 bits (87), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 38/174 (21%), Positives = 70/174 (40%), Gaps = 41/174 (23%)

Query: 689 EYQLLNICEFNSTRKRMSAIFRFPDGSIKLFCKGADTVILERLDDE---ANQYVEATMRH 745
           +Y++L    F+   K+++A+   P+G   +  KGA   +L+ ++++        E     
Sbjct: 437 KYKVLEFHPFDPVSKKVTAVVESPEGERIICVKGAPLFVLKTVEEDHPIPEDIHENYENK 496

Query: 746 LEDYASEGLRTLCLAMRDISEGEYEEWNSIYNEAATTLDNRAEKLDEAANLIEKNLILIG 805
           + + AS G R L +A R   EG +E                                ++G
Sbjct: 497 VAELASRGFRALGVA-RKRGEGHWE--------------------------------ILG 523

Query: 806 ATAIEDKLQDGVPETIHTLQEAGIKIWVLTGDRQETAINIGM-SCRLLSEDMNL 858
                D  +D   ET+   +  G+++ +LTGD    A+ I   +CR L    N+
Sbjct: 524 VMPCMDPPRDDTGETVAEARRLGLRVKMLTGD----AVGIAKETCRQLGLGTNV 573

 Score = 32.3 bits (72), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 20/28 (71%)

Query: 541 VVRTSSLVEELGQIEYIFSDKTGTLTRN 568
           +V+  S +E L  +E + SDKTGTLT+N
Sbjct: 354 IVQKLSAIESLAGVEILCSDKTGTLTKN 381

>YGL008C (PMA1) [1965] chr7 complement(479913..482669)
           H+-transporting P-type ATPase of the plasma membrane
           required for nutrient uptake and pH homeostasis,
           activity is rate limiting for growth at low pH [2757 bp,
           918 aa]
          Length = 918

 Score = 38.1 bits (87), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 37/174 (21%), Positives = 70/174 (40%), Gaps = 41/174 (23%)

Query: 689 EYQLLNICEFNSTRKRMSAIFRFPDGSIKLFCKGADTVILERLDDE---ANQYVEATMRH 745
           +Y++L    F+   K+++A+   P+G   +  KGA   +L+ ++++        E     
Sbjct: 442 KYKVLEFHPFDPVSKKVTAVVESPEGERIVCVKGAPLFVLKTVEEDHPIPEDVHENYENK 501

Query: 746 LEDYASEGLRTLCLAMRDISEGEYEEWNSIYNEAATTLDNRAEKLDEAANLIEKNLILIG 805
           + + AS G R L +A R   EG +E                                ++G
Sbjct: 502 VAELASRGFRALGVA-RKRGEGHWE--------------------------------ILG 528

Query: 806 ATAIEDKLQDGVPETIHTLQEAGIKIWVLTGDRQETAINIGM-SCRLLSEDMNL 858
                D  +D   +T+   +  G+++ +LTGD    A+ I   +CR L    N+
Sbjct: 529 VMPCMDPPRDDTAQTVSEARHLGLRVKMLTGD----AVGIAKETCRQLGLGTNI 578

 Score = 32.3 bits (72), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 20/28 (71%)

Query: 541 VVRTSSLVEELGQIEYIFSDKTGTLTRN 568
           +V+  S +E L  +E + SDKTGTLT+N
Sbjct: 359 IVQKLSAIESLAGVEILCSDKTGTLTKN 386

>Scas_710.41
          Length = 904

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 35/170 (20%), Positives = 69/170 (40%), Gaps = 40/170 (23%)

Query: 689 EYQLLNICEFNSTRKRMSAIFRFPDGSIKLFCKGADTVILERLDDE---ANQYVEATMRH 745
           +Y++L    F+   K+++A+ + P+G      KGA   +L+ ++++        E     
Sbjct: 429 KYKILEFHPFDPVSKKVTAVVKSPEGETITCVKGAPLFVLKTVEEDHPVPEDVHENYENK 488

Query: 746 LEDYASEGLRTLCLAMRDISEGEYEEWNSIYNEAATTLDNRAEKLDEAANLIEKNLILIG 805
           + + AS G R+L +A R   EG +E                                ++G
Sbjct: 489 VAELASRGFRSLGVA-RKRGEGYWE--------------------------------ILG 515

Query: 806 ATAIEDKLQDGVPETIHTLQEAGIKIWVLTGD----RQETAINIGMSCRL 851
                D  +D    TI   +  G+++ +LTGD     +ET+  +G+   +
Sbjct: 516 VMPCMDPPRDDTARTIAEARTLGLRVKMLTGDAVGIAKETSRQLGLGVNI 565

 Score = 32.3 bits (72), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 20/28 (71%)

Query: 541 VVRTSSLVEELGQIEYIFSDKTGTLTRN 568
           +V+  S +E L  +E + SDKTGTLT+N
Sbjct: 346 IVQKLSAIESLAGVEILCSDKTGTLTKN 373

>Scas_297.1
          Length = 800

 Score = 35.4 bits (80), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 58/107 (54%), Gaps = 18/107 (16%)

Query: 301 DIRVGDIIRVKSEEPIPADTIILSSSEPEGLCYIETANLDGETNLKIKQSRVETAKFIDV 360
           ++ VGDII +++ + IPAD +++     EG C ++ +++ GE++  IK+ +V    F  +
Sbjct: 615 NLLVGDIITLQTGDVIPADGVLV-----EGQCEVDESSITGESD-TIKKVKV----FNAL 664

Query: 361 KTLKNMNGKVVSEQPNSSLYTYEGTMTLNDRQIPLSPDQMILRGATL 407
           KT       V++E  ++      G  T N  +I   PD M++ G+ L
Sbjct: 665 KTF-----DVINEGKSNDQILDIGFKTPNGDKI---PDCMLISGSKL 703

>KLLA0F07447g 700685..703612 similar to sp|P38995 Saccharomyces
           cerevisiae YDR270w CCC2 probable copper-transporting
           ATPase, start by similarity
          Length = 975

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 17/65 (26%), Positives = 34/65 (52%)

Query: 803 LIGATAIEDKLQDGVPETIHTLQEAGIKIWVLTGDRQETAINIGMSCRLLSEDMNLLIIN 862
           L+G   I D++++     +  LQ  GIK  ++TGD  ++A+ +     + + D+   +  
Sbjct: 741 LVGKFEISDRVKEDAHFVVEYLQNLGIKCCMVTGDAHQSALKVAQQLGISANDVFSEVTP 800

Query: 863 EETRD 867
           E+ RD
Sbjct: 801 EQKRD 805

>CAGL0M08602g complement(856349..859387) similar to sp|P38995
           Saccharomyces cerevisiae YDR270w CCC2, start by
           similarity
          Length = 1012

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 38/72 (52%), Gaps = 6/72 (8%)

Query: 279 LNNSTAEIFSEAHDDFVEKRWIDI-RVGDIIRVKSEEPIPADTIILSSSEPEGLCYIETA 337
           L  S+  I  +  D   ++  I++  VGDI  VK    IP+D I+      +G+  ++ +
Sbjct: 408 LTPSSCIIVDKDDDSITQEIGIELLEVGDIAMVKPGAKIPSDGIV-----TKGISEVDES 462

Query: 338 NLDGETNLKIKQ 349
            + GETNL +K+
Sbjct: 463 LMTGETNLVVKE 474

>YJL109C (UTP10) [2806] chr10 complement(211917..217226) Component
           of U3 snoRNP (also called small subunit processome),
           which is required for 18S rRNA biogenesis [5310 bp, 1769
           aa]
          Length = 1769

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 39/93 (41%), Gaps = 5/93 (5%)

Query: 683 ETGEEKEYQLLNICEFNSTRKRMSAIFRFPDGSIKLFCKGADTV-ILERLDDE----ANQ 737
           +  E K   LL IC+   T K    + + P    KLF    DTV IL  LD E     ++
Sbjct: 287 DAKEAKHSALLTICKLFQTLKGQGNVDQLPSKIFKLFDSKFDTVSILTFLDKEDKPVCDK 346

Query: 738 YVEATMRHLEDYASEGLRTLCLAMRDISEGEYE 770
           ++ +  R +  Y    L  +   ++ I    YE
Sbjct: 347 FITSYTRSIARYDRSKLNIILSLLKKIRLERYE 379

>ABL009W [583] [Homologous to ScYLR361C - SH]
           complement(381102..382811) [1710 bp, 569 aa]
          Length = 569

 Score = 32.7 bits (73), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 35/68 (51%), Gaps = 9/68 (13%)

Query: 359 DVKTLKNMNGKVVSEQPNSSLYTYE---GTMTLNDRQIPLSPDQMILRGATLRNTAWIFG 415
           DVKT+K +N  +  E+P+ ++YT +   G +  ND + PL      L+     N  WI  
Sbjct: 278 DVKTMKFVNDVLDIERPDMAVYTGDQITGDLCDNDAETPL------LKAFAPANQRWIPF 331

Query: 416 LVIFTGHE 423
            VI+  H+
Sbjct: 332 AVIWGNHD 339

>Kwal_26.8333
          Length = 422

 Score = 32.3 bits (72), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 29/119 (24%), Positives = 46/119 (38%), Gaps = 8/119 (6%)

Query: 1022 LYMTQFWYVFANAFSGQSIMESWTMSFYNLFFTVWPPFVIGVFDQFVSSRLLERYPQLYK 1081
            +Y T   + F N  SG S+   +      +  +V+ P  +G   Q V  + +      +K
Sbjct: 169  MYTTSSAFHFGNPASGSSVSHLYANVMKQIGLSVFVPLFVGQILQNVFPKQVSWCLSTFK 228

Query: 1082 LGQKGQFFSVYIFWGWIINGFF--------HSAIVFIGTILIYRYGFALNMHGELADHW 1132
            LG+ G F  + I W      F+        H  I+F+    I  Y F   +   LA  W
Sbjct: 229  LGKVGSFCLILIMWSSFSTAFYQKAFESVSHVCIIFLVFFNIAIYLFFTGICYLLARPW 287

>Scas_630.14
          Length = 701

 Score = 32.3 bits (72), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 31/59 (52%)

Query: 511 FVTVELIKYYQAFMIGSDLDLYYEKTDTPTVVRTSSLVEELGQIEYIFSDKTGTLTRNI 569
           +V V+L+++Y   M  S+ D   E T   T+V TS ++     I YI+ DK   +  N+
Sbjct: 282 YVQVQLLRWYSLTMYPSNTDTLEEITIVNTLVSTSLMLGLHQDINYIYMDKLPNIIPNL 340

>YNL321W (YNL321W) [4293] chr14 (34695..37421) Member of the calcium
            permease family of membrane transporters [2727 bp, 908
            aa]
          Length = 908

 Score = 32.3 bits (72), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 28/52 (53%), Gaps = 5/52 (9%)

Query: 1177 PIYASI---FPHANISREYYGVVKHTYGSGVFW--LTLIVLPIFALVRDFLW 1223
            P Y SI    PHA   R Y+G  K ++G  +F+    L++ PI A++   LW
Sbjct: 372  PSYNSIRHEIPHAAAQRRYFGRGKWSWGRVLFYTIFHLVLQPILAVLSLCLW 423

>YLR417W (VPS36) [3793] chr12 (955006..956706) Component of the
            endosomal sorting complex required for transport II
            (ESCRT-II), mutant displays a prominent novel
            pre-vacuolar organelle [1701 bp, 566 aa]
          Length = 566

 Score = 32.0 bits (71), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 29/118 (24%), Positives = 47/118 (39%), Gaps = 23/118 (19%)

Query: 1232 PETYHVIQEMQKYNISDSRPHVQQFQNAIRKVRQ-----------------VQ-RMKKQR 1273
            P    V  ++ + N  DSR H++  +N++ + +                  VQ   +K  
Sbjct: 205  PNASKVRSKLNRLNFHDSRVHIELEKNSLARNKSSHSALSSSSSTGSSTEFVQLSFRKSD 264

Query: 1274 GFAFSQAEEGGQEKIVRMYDTTQKRGKYGELQDASANPFNDNNGLGSNDFESAEPFIE 1331
            G  FSQA E   E I+     T+K          S N  +   G  S+++ +  PFIE
Sbjct: 265  GVLFSQATERALENIL-----TEKNKHIFNQNVVSVNGVDMRKGASSHEYNNEVPFIE 317

>ABR035C [626] [Homologous to ScYLR336C (SGD1) - SH] (461282..464227)
            [2946 bp, 981 aa]
          Length = 981

 Score = 32.0 bits (71), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 32/64 (50%), Gaps = 3/64 (4%)

Query: 1261 RKVRQVQRMKKQRGFAFSQAEEGGQEKIVRMYDTTQKRGKYGELQDASANPFNDNNGLGS 1320
            R+ RQ+++ K+QRG   S  + G   +        QK+ K       +A PF+ ++ L S
Sbjct: 46   RERRQLKKQKRQRGDVESAPQTG---RAAAARPRQQKKEKAAPAPRQTAAPFSSDDELSS 102

Query: 1321 NDFE 1324
             DF+
Sbjct: 103  GDFD 106

>KLLA0E23056g complement(2044323..2046779) weakly similar to
           sp|P38835 Saccharomyces cerevisiae YHR131c, start by
           similarity
          Length = 818

 Score = 32.0 bits (71), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 38/84 (45%), Gaps = 9/84 (10%)

Query: 84  DQTSWNANR--FDSDAYQPQSLRAVKPPGLFARFGNGLKNAFTFKRKKGPESFEMNHYNA 141
           D+  WN  R       Y   SLR +KP G    F     N        GP+ +E N  N 
Sbjct: 710 DEMKWNPPRKEITRRRYIRDSLRCIKPLG----FDESWVNKIALAPSMGPK-YETN--NP 762

Query: 142 VTNNELDDNYLDSRNKFNIKILFN 165
             +  + ++ L S+NKF++K L+N
Sbjct: 763 PVSGFISNSDLSSKNKFSLKKLYN 786

>Scas_645.6
          Length = 830

 Score = 31.6 bits (70), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 40/185 (21%), Positives = 74/185 (40%), Gaps = 21/185 (11%)

Query: 119 LKNAFTFKRKKGPESFEMNHYNAVTNNELDDNYLDSRNKFNIKILFNRYILRKNVGDAEG 178
           L+ A     K G  S+   HY+   N +     L+SRN  ++K    R I   + GD+  
Sbjct: 20  LEAAAIATSKLGESSY--THYSNRINGKQLRTLLNSRNPRDVKDAMKRIITLMSSGDSSI 77

Query: 179 NGEPRVIHINDSLANSSFGYSDNHISTTKYNFATFLPKFLFQEFSKYANLFFLCTSAIQQ 238
           +             ++ F     +I++        +  +L +   K  NL  LC +++Q+
Sbjct: 78  D------------TSTYFADVVKNITSDDIKIKRLIGVYLLRFAEKEPNLTLLCVNSLQK 125

Query: 239 VPHVS-PTNRYTTIGTLLVVLIVSAMKECIEDIKRANSD------KELNNSTAEIFSEAH 291
             + + P  R   I  L  + I S     +  +KR  +D       E++    ++F   +
Sbjct: 126 TSYDTIPETRAFAIRALSDIKIPSLYPMVLHTLKRVVTDPSPLVRSEVSFGIMKLFRSEN 185

Query: 292 DDFVE 296
           D+F E
Sbjct: 186 DEFEE 190

>AGL041C [4270] [Homologous to ScYDR270W - NSH] (628428..632129) [3702
            bp, 1233 aa]
          Length = 1233

 Score = 31.6 bits (70), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 12/35 (34%), Positives = 20/35 (57%)

Query: 808  AIEDKLQDGVPETIHTLQEAGIKIWVLTGDRQETA 842
            A+ D+L+    E +  L E GI+ W+++GD    A
Sbjct: 1015 AVRDELRPEAKEVVQALHERGIECWMISGDNSLAA 1049

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.135    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 42,127,134
Number of extensions: 1852765
Number of successful extensions: 5967
Number of sequences better than 10.0: 101
Number of HSP's gapped: 5913
Number of HSP's successfully gapped: 181
Length of query: 1331
Length of database: 16,596,109
Length adjustment: 114
Effective length of query: 1217
Effective length of database: 12,649,657
Effective search space: 15394632569
Effective search space used: 15394632569
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)