Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YAL025C (MAK16)30630110881e-150
Scas_663.23041948881e-120
KLLA0A04037g3021948351e-112
CAGL0G06248g2971948241e-110
ADR349W3201948231e-110
Kwal_26.70822991948081e-108
CAGL0F00715g3102046621e-85
YOR260W (GCD1)57854635.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YAL025C
         (301 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YAL025C (MAK16) [43] chr1 complement(100228..101148) Nuclear pro...   423   e-150
Scas_663.2                                                            346   e-120
KLLA0A04037g complement(359981..360889) some similarities with s...   326   e-112
CAGL0G06248g 596704..597597 highly similar to sp|P10962 Saccharo...   322   e-110
ADR349W [2090] [Homologous to ScYAL025C (MAK16) - SH] complement...   321   e-110
Kwal_26.7082                                                          315   e-108
CAGL0F00715g complement(80864..81796) similar to sp|P10962 Sacch...   259   1e-85
YOR260W (GCD1) [5048] chr15 (813982..815718) Translation initiat...    29   5.7  

>YAL025C (MAK16) [43] chr1 complement(100228..101148) Nuclear
           protein with HMG-like acidic region, required for
           propagation of M1 double-stranded RNA (dsRNA) virus [921
           bp, 306 aa]
          Length = 306

 Score =  423 bits (1088), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 217/301 (72%), Positives = 217/301 (72%)

Query: 1   MSDEIVWQVINQSFCSHRIKAPNGQNFCRNEYNVTGLCTRQSCPLANSKYATVKCDNGKL 60
           MSDEIVWQVINQSFCSHRIKAPNGQNFCRNEYNVTGLCTRQSCPLANSKYATVKCDNGKL
Sbjct: 1   MSDEIVWQVINQSFCSHRIKAPNGQNFCRNEYNVTGLCTRQSCPLANSKYATVKCDNGKL 60

Query: 61  YLYMKTPERAHTPAKLWERIKLSKNYTKALQQIDEHLLHWSKFFRHKCKQRFTKLTQVMI 120
           YLYMKTPERAHTPAKLWERIKLSKNYTKALQQIDEHLLHWSKFFRHKCKQRFTKLTQVMI
Sbjct: 61  YLYMKTPERAHTPAKLWERIKLSKNYTKALQQIDEHLLHWSKFFRHKCKQRFTKLTQVMI 120

Query: 121 TXXXXXXXXXXXHYVGVAPKVKRREQNRERKALVAAKIEKAIEKELMDRLKSGAYGDKPL 180
           T           HYVGVAPKVKRREQNRERKALVAAKIEKAIEKELMDRLKSGAYGDKPL
Sbjct: 121 TERRLALREEERHYVGVAPKVKRREQNRERKALVAAKIEKAIEKELMDRLKSGAYGDKPL 180

Query: 181 NVDEKVWKKIMGQMXXXXXXXXXXXXXXXXXXXXXXXXYVAXXXXXXXXXXXXLEKWLXX 240
           NVDEKVWKKIMGQM                        YVA            LEKWL  
Sbjct: 181 NVDEKVWKKIMGQMEEENSQDEEEDWDEEEESDDGEVEYVADDGEGEYVDVDDLEKWLAD 240

Query: 241 XXXXXXXXXXXXXXXXXXXXXXXXXXNKNSAKRRKKGTSAKTKRPKVXXXXXXXXXVQNA 300
                                     NKNSAKRRKKGTSAKTKRPKV         VQNA
Sbjct: 241 SDREASSASQSESDSESESDSDSDEENKNSAKRRKKGTSAKTKRPKVEIEYEEEHEVQNA 300

Query: 301 E 301
           E
Sbjct: 301 E 301

>Scas_663.2
          Length = 304

 Score =  346 bits (888), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 160/194 (82%), Positives = 173/194 (89%)

Query: 1   MSDEIVWQVINQSFCSHRIKAPNGQNFCRNEYNVTGLCTRQSCPLANSKYATVKCDNGKL 60
           MSDEIVWQVINQSFCSHRIK+P+GQ FCR+ YNVTGLCTRQSCPLANSKYATV+ D G++
Sbjct: 1   MSDEIVWQVINQSFCSHRIKSPSGQTFCRDPYNVTGLCTRQSCPLANSKYATVRADKGRI 60

Query: 61  YLYMKTPERAHTPAKLWERIKLSKNYTKALQQIDEHLLHWSKFFRHKCKQRFTKLTQVMI 120
           YLYMKTPERAHTPAKLWERIKLSKNY+KAL+QIDEHLLHW  FF HKCKQRFTKLTQV I
Sbjct: 61  YLYMKTPERAHTPAKLWERIKLSKNYSKALKQIDEHLLHWKNFFIHKCKQRFTKLTQVAI 120

Query: 121 TXXXXXXXXXXXHYVGVAPKVKRREQNRERKALVAAKIEKAIEKELMDRLKSGAYGDKPL 180
           T           HYVGVAPKVKRREQNRERKAL AAKIEKAIEKEL+DRLKSGAYGDKPL
Sbjct: 121 TERRLAMREEERHYVGVAPKVKRREQNRERKALAAAKIEKAIEKELLDRLKSGAYGDKPL 180

Query: 181 NVDEKVWKKIMGQM 194
           NVDEK+WKK++G +
Sbjct: 181 NVDEKIWKKVLGHL 194

>KLLA0A04037g complement(359981..360889) some similarities with
           sp|P10962 Saccharomyces cerevisiae YAL025c MAK16 nuclear
           viral propagation protein singleton, hypothetical start
          Length = 302

 Score =  326 bits (835), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 150/194 (77%), Positives = 169/194 (87%)

Query: 1   MSDEIVWQVINQSFCSHRIKAPNGQNFCRNEYNVTGLCTRQSCPLANSKYATVKCDNGKL 60
           MSDEI+WQVINQ FC++++K   GQNFCRNEYNVTGLC+RQ+CPLANSKYATVK  +G L
Sbjct: 1   MSDEIIWQVINQHFCAYKVKTDKGQNFCRNEYNVTGLCSRQACPLANSKYATVKNVDGTL 60

Query: 61  YLYMKTPERAHTPAKLWERIKLSKNYTKALQQIDEHLLHWSKFFRHKCKQRFTKLTQVMI 120
           YLYMKT ERAHTPAKLWER+KLSKNYTKAL QIDEHLL+W+KF  HKCKQR TKLTQVMI
Sbjct: 61  YLYMKTAERAHTPAKLWERVKLSKNYTKALAQIDEHLLYWNKFLIHKCKQRMTKLTQVMI 120

Query: 121 TXXXXXXXXXXXHYVGVAPKVKRREQNRERKALVAAKIEKAIEKELMDRLKSGAYGDKPL 180
           T           HYVG+APKVKRRE+NRERKAL AAKIEKAIEKEL++RLKSG YGDKPL
Sbjct: 121 TERRLALREEERHYVGIAPKVKRREENRERKALSAAKIEKAIEKELLERLKSGVYGDKPL 180

Query: 181 NVDEKVWKKIMGQM 194
           NVDEK+WKK+MG++
Sbjct: 181 NVDEKIWKKVMGRV 194

>CAGL0G06248g 596704..597597 highly similar to sp|P10962
           Saccharomyces cerevisiae YAL025c MAK16, start by
           similarity
          Length = 297

 Score =  322 bits (824), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 147/194 (75%), Positives = 170/194 (87%)

Query: 1   MSDEIVWQVINQSFCSHRIKAPNGQNFCRNEYNVTGLCTRQSCPLANSKYATVKCDNGKL 60
           MSDEIVWQVINQ FC++++K   GQ FCRNEYNVTGLC+RQSCPLANSKYATVK +NG+L
Sbjct: 1   MSDEIVWQVINQQFCAYKVKTDKGQTFCRNEYNVTGLCSRQSCPLANSKYATVKSENGRL 60

Query: 61  YLYMKTPERAHTPAKLWERIKLSKNYTKALQQIDEHLLHWSKFFRHKCKQRFTKLTQVMI 120
           YLY++T ERAHTPAK WE+I+LSKNY+KAL+QID+HLL+W+KF  HKCKQRFTKLTQV I
Sbjct: 61  YLYIRTVERAHTPAKWWEKIRLSKNYSKALKQIDDHLLYWNKFSIHKCKQRFTKLTQVAI 120

Query: 121 TXXXXXXXXXXXHYVGVAPKVKRREQNRERKALVAAKIEKAIEKELMDRLKSGAYGDKPL 180
           T           HYVGVAPKVKRRE+NRERKAL AAKIEK+IEKEL+DRLKSGAYGDKP+
Sbjct: 121 TERRLAMREMERHYVGVAPKVKRREENRERKALAAAKIEKSIEKELLDRLKSGAYGDKPM 180

Query: 181 NVDEKVWKKIMGQM 194
           NVDEK+WKK+MG +
Sbjct: 181 NVDEKIWKKVMGHL 194

>ADR349W [2090] [Homologous to ScYAL025C (MAK16) - SH]
           complement(1319477..1320439) [963 bp, 320 aa]
          Length = 320

 Score =  321 bits (823), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 149/194 (76%), Positives = 166/194 (85%)

Query: 1   MSDEIVWQVINQSFCSHRIKAPNGQNFCRNEYNVTGLCTRQSCPLANSKYATVKCDNGKL 60
           MSDEI+WQVINQ FC+++IK   GQNFCRNEYNVTG C R SCPLAN+KYATVK  +GKL
Sbjct: 22  MSDEIIWQVINQHFCAYKIKTDKGQNFCRNEYNVTGFCNRSSCPLANAKYATVKQVDGKL 81

Query: 61  YLYMKTPERAHTPAKLWERIKLSKNYTKALQQIDEHLLHWSKFFRHKCKQRFTKLTQVMI 120
           YLYMKT ERAHTPAKLWERI+LSKNY+ AL+QIDEHLL W+KF  HKCKQR TKLTQVMI
Sbjct: 82  YLYMKTVERAHTPAKLWERIRLSKNYSTALKQIDEHLLFWNKFLIHKCKQRLTKLTQVMI 141

Query: 121 TXXXXXXXXXXXHYVGVAPKVKRREQNRERKALVAAKIEKAIEKELMDRLKSGAYGDKPL 180
           T           HYVGVAPKVKRR++NRERKAL AAKIEKAIEKEL+DRLKSGAYGDKPL
Sbjct: 142 TERRMALREEERHYVGVAPKVKRRDENRERKALAAAKIEKAIEKELLDRLKSGAYGDKPL 201

Query: 181 NVDEKVWKKIMGQM 194
           NVDEK+WK++MG +
Sbjct: 202 NVDEKIWKRVMGHV 215

>Kwal_26.7082
          Length = 299

 Score =  315 bits (808), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 143/194 (73%), Positives = 167/194 (86%)

Query: 1   MSDEIVWQVINQSFCSHRIKAPNGQNFCRNEYNVTGLCTRQSCPLANSKYATVKCDNGKL 60
           MSDEI+WQVINQ FC++++K   GQNFCRNEYNVTGLC RQSCPLAN+KYATVK  +G+L
Sbjct: 1   MSDEIIWQVINQQFCAYKLKTDKGQNFCRNEYNVTGLCNRQSCPLANAKYATVKNVDGRL 60

Query: 61  YLYMKTPERAHTPAKLWERIKLSKNYTKALQQIDEHLLHWSKFFRHKCKQRFTKLTQVMI 120
           YLYMKT ERAHTPAKLWERI+LSKNY KAL Q+D+HLL+W+KF  HKCKQR T+LTQ+ +
Sbjct: 61  YLYMKTAERAHTPAKLWERIRLSKNYAKALTQVDDHLLYWNKFLIHKCKQRLTRLTQIAV 120

Query: 121 TXXXXXXXXXXXHYVGVAPKVKRREQNRERKALVAAKIEKAIEKELMDRLKSGAYGDKPL 180
           T           HYVGVAPKVKRR++NRERKAL AAKIEKAIEKEL++RLKSGAYGDKPL
Sbjct: 121 TERRMELREEERHYVGVAPKVKRRDENRERKALAAAKIEKAIEKELLERLKSGAYGDKPL 180

Query: 181 NVDEKVWKKIMGQM 194
           NVDEK+WKK++G +
Sbjct: 181 NVDEKIWKKVLGHV 194

>CAGL0F00715g complement(80864..81796) similar to sp|P10962
           Saccharomyces cerevisiae YAL025c MAK16 nuclear viral
           propagation protein, hypothetical start
          Length = 310

 Score =  259 bits (662), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 123/204 (60%), Positives = 156/204 (76%), Gaps = 10/204 (4%)

Query: 1   MSDEIVWQVINQSFCSHRIKAPNGQNFCRNEYNVTGLCTRQSCPLANSKYATVK--CDNG 58
           +SD+++W +IN  FC+ +IK   GQ F R+ YNVTGL TRQSCPLANSKYATV+   D G
Sbjct: 3   VSDDLIWDIINHGFCATKIKTKVGQTFDRDPYNVTGLFTRQSCPLANSKYATVREYGDKG 62

Query: 59  KLYLYMKTPERAHTPAKLWERIKLSKNYTKALQQIDEHLLHWSKFFRHKCKQRFTKLTQV 118
           +LYL +KTPERAHTPAK+W+RI+LS NY+KAL+QIDEHL++W+KFF H+CKQR+ KL+Q+
Sbjct: 63  RLYLCIKTPERAHTPAKMWQRIRLSNNYSKALKQIDEHLMYWNKFFLHRCKQRYVKLSQI 122

Query: 119 MITXXXX---XXXXXXXHYVGVAPKVKRREQNRERKALVAAKIEKAIEKELMDRLKSGAY 175
            +                 VG+APKVKRRE NRERKALVAAKIE++I KEL++RLKSGAY
Sbjct: 123 KLVERRQLKLQMNGEQKRLVGIAPKVKRREMNRERKALVAAKIEESISKELLNRLKSGAY 182

Query: 176 GD-----KPLNVDEKVWKKIMGQM 194
            +      PLNVDE +W KIMG++
Sbjct: 183 SNADKTLTPLNVDENIWNKIMGKL 206

>YOR260W (GCD1) [5048] chr15 (813982..815718) Translation initiation
           factor eIF2B (guanine nucleotide exchange factor), 58
           kDa (gamma) subunit [1737 bp, 578 aa]
          Length = 578

 Score = 28.9 bits (63), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 14/54 (25%), Positives = 28/54 (51%), Gaps = 1/54 (1%)

Query: 4   EIVWQVINQSFCSHRIKAPNGQNFCRNEYNVTG-LCTRQSCPLANSKYATVKCD 56
           E++++ ++ S  SH ++ P   NF  ++ N TG    ++  P  N  +  + CD
Sbjct: 120 ELIYKALSNSNHSHHLQDPKKINFIPSKANSTGESLQKELLPRINGDFVILPCD 173

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.130    0.394 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 7,020,501
Number of extensions: 242588
Number of successful extensions: 681
Number of sequences better than 10.0: 10
Number of HSP's gapped: 677
Number of HSP's successfully gapped: 10
Length of query: 301
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 200
Effective length of database: 13,099,691
Effective search space: 2619938200
Effective search space used: 2619938200
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 61 (28.1 bits)