Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YAL024C (LTE1)1435140968500.0
Scas_505.31364143326790.0
CAGL0G06226g1318143521470.0
Kwal_26.70831400148619370.0
KLLA0A04059g136644811671e-136
ACR292W143945511231e-130
YLL016W (SDC25)10482921994e-15
Kwal_14.231315171481834e-13
CAGL0E03476g15642111817e-13
YLR310C (CDC25)15891801772e-12
Sklu_2189.415262081772e-12
Scas_621.1*13232191736e-12
KLLA0D09306g15371821682e-11
ADL038W15091451549e-10
Scas_604.1516762141469e-09
CAGL0D06512g13081961315e-07
KLLA0C03410g13602121298e-07
Kwal_33.1359814122211243e-06
CAGL0B01287g12472261126e-05
Scas_476.21330218990.003
Sklu_2300.3478152840.12
Scas_588.15542124830.15
AFR630C1436249810.36
Scas_707.3159891761.1
KLLA0D11374g265124695.9
YDR372C (VPS74)34592696.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YAL024C
         (1409 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YAL024C (LTE1) [44] chr1 complement(101568..105875) GDP/GTP exch...  2643   0.0  
Scas_505.3                                                           1036   0.0  
CAGL0G06226g 592179..596135 similar to sp|P07866 Saccharomyces c...   831   0.0  
Kwal_26.7083                                                          750   0.0  
KLLA0A04059g complement(361328..365428) similar to sp|P07866 Sac...   454   e-136
ACR292W [1339] [Homologous to ScYAL024C (LTE1) - SH] complement(...   437   e-130
YLL016W (SDC25) [3403] chr12 (112846..115992) Protein of unknown...    81   4e-15
Kwal_14.2313                                                           75   4e-13
CAGL0E03476g complement(318956..323650) similar to sp|P04821 Sac...    74   7e-13
YLR310C (CDC25) [3699] chr12 complement(752226..756995) Guanine-...    73   2e-12
Sklu_2189.4 YLR310C, Contig c2189 8340-12920                           73   2e-12
Scas_621.1*                                                            71   6e-12
KLLA0D09306g 783852..788465 weakly similar to sp|P04821 Saccharo...    69   2e-11
ADL038W [1703] [Homologous to ScYLR310C (CDC25 ) - SH; ScYLL016W...    64   9e-10
Scas_604.15                                                            61   9e-09
CAGL0D06512g complement(617453..621379) some similarities with s...    55   5e-07
KLLA0C03410g 303739..307821 weakly similar to ca|CA0382|IPF16030...    54   8e-07
Kwal_33.13598                                                          52   3e-06
CAGL0B01287g 114832..118575 similar to KLLA0C03410g Kluyveromyce...    48   6e-05
Scas_476.2                                                             43   0.003
Sklu_2300.3 YCR038C, Contig c2300 4973-6405 reverse complement         37   0.12 
Scas_588.15                                                            37   0.15 
AFR630C [3822] [Homologous to ScYCR038C (BUD5) - SH] (1582542..1...    36   0.36 
Scas_707.3                                                             34   1.1  
KLLA0D11374g complement(975206..976003) similar to sp|P32496 Sac...    31   5.9  
YDR372C (VPS74) [1198] chr4 complement(1221100..1222137) Protein...    31   6.7  

>YAL024C (LTE1) [44] chr1 complement(101568..105875) GDP/GTP exchange
            factor, required for termination of M phase [4308 bp,
            1435 aa]
          Length = 1435

 Score = 2643 bits (6850), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1315/1409 (93%), Positives = 1315/1409 (93%)

Query: 1    MEIFSQKDYYPTPSSNVISYESDCVSKPVNSADLPALIVHLSSPLEGVDYNASADFFLIY 60
            MEIFSQKDYYPTPSSNVISYESDCVSKPVNSADLPALIVHLSSPLEGVDYNASADFFLIY
Sbjct: 1    MEIFSQKDYYPTPSSNVISYESDCVSKPVNSADLPALIVHLSSPLEGVDYNASADFFLIY 60

Query: 61   RNFITPQDLHDLLIYRFRWCIREITTNAAKAKRRRIGEVALVRTFVLLRHSILNYFVQDF 120
            RNFITPQDLHDLLIYRFRWCIREITTNAAKAKRRRIGEVALVRTFVLLRHSILNYFVQDF
Sbjct: 61   RNFITPQDLHDLLIYRFRWCIREITTNAAKAKRRRIGEVALVRTFVLLRHSILNYFVQDF 120

Query: 121  LPNITLRLRLIEFLNDKHIEQYPKIISSCIINLKKNWVHCSKLVWENIELNEPDKLDFDA 180
            LPNITLRLRLIEFLNDKHIEQYPKIISSCIINLKKNWVHCSKLVWENIELNEPDKLDFDA
Sbjct: 121  LPNITLRLRLIEFLNDKHIEQYPKIISSCIINLKKNWVHCSKLVWENIELNEPDKLDFDA 180

Query: 181  WLHYSLKDFTQLESLHKRGSRLSIYARQSFASPDFRNQSVLSLYKTSDVFRLPEKLXXXX 240
            WLHYSLKDFTQLESLHKRGSRLSIYARQSFASPDFRNQSVLSLYKTSDVFRLPEKL    
Sbjct: 181  WLHYSLKDFTQLESLHKRGSRLSIYARQSFASPDFRNQSVLSLYKTSDVFRLPEKLQSSN 240

Query: 241  XXXXXXXXXMLLFPDNTSNVYSKHRIAKEPSVDNESEDMSDSKQKISHLSKVTLVSTLMK 300
                     MLLFPDNTSNVYSKHRIAKEPSVDNESEDMSDSKQKISHLSKVTLVSTLMK
Sbjct: 241  SSKNQRSPSMLLFPDNTSNVYSKHRIAKEPSVDNESEDMSDSKQKISHLSKVTLVSTLMK 300

Query: 301  GVDYPSSYAVDKIMPPTPAKKVEFILNSLYIPEDLNEXXXXXXXXXXXXXXXXXXXXXXX 360
            GVDYPSSYAVDKIMPPTPAKKVEFILNSLYIPEDLNE                       
Sbjct: 301  GVDYPSSYAVDKIMPPTPAKKVEFILNSLYIPEDLNEQSGTLQGTSTTSSLDNNSNSNSR 360

Query: 361  XXXXXXXVLHRSAIGLLAKWMKNHNRHDSSNDKKFMSAIKPANQKPEMDAFVKYVVSISS 420
                   VLHRSAIGLLAKWMKNHNRHDSSNDKKFMSAIKPANQKPEMDAFVKYVVSISS
Sbjct: 361  SNTSSMSVLHRSAIGLLAKWMKNHNRHDSSNDKKFMSAIKPANQKPEMDAFVKYVVSISS 420

Query: 421  LNRKSSKEEEEEFLNSDSSKFDILSARTIDEVESLLHLQNQLIEKVQTHSNNNRGPTVNV 480
            LNRKSSKEEEEEFLNSDSSKFDILSARTIDEVESLLHLQNQLIEKVQTHSNNNRGPTVNV
Sbjct: 421  LNRKSSKEEEEEFLNSDSSKFDILSARTIDEVESLLHLQNQLIEKVQTHSNNNRGPTVNV 480

Query: 481  DCERREHIHDIKILQQNSFKPSNDNFSAMDNLDLYQTVSSIAQSVISXXXXXXXXXXXXE 540
            DCERREHIHDIKILQQNSFKPSNDNFSAMDNLDLYQTVSSIAQSVIS            E
Sbjct: 481  DCERREHIHDIKILQQNSFKPSNDNFSAMDNLDLYQTVSSIAQSVISLTNTLNKQLQNNE 540

Query: 541  SNMQPSPSYDALQRRKVKSLTTAYYNKMHGSYSAESMRLFDKDNSSSRTDENGPQRLLFH 600
            SNMQPSPSYDALQRRKVKSLTTAYYNKMHGSYSAESMRLFDKDNSSSRTDENGPQRLLFH
Sbjct: 541  SNMQPSPSYDALQRRKVKSLTTAYYNKMHGSYSAESMRLFDKDNSSSRTDENGPQRLLFH 600

Query: 601  ETDKTNSEAITNMTPRRKNHSQSQKSMTSSPLKNVLPDLKESSPLNDSREDTEXXXXXXX 660
            ETDKTNSEAITNMTPRRKNHSQSQKSMTSSPLKNVLPDLKESSPLNDSREDTE       
Sbjct: 601  ETDKTNSEAITNMTPRRKNHSQSQKSMTSSPLKNVLPDLKESSPLNDSREDTESITYSYD 660

Query: 661  XXXXXXXPPRDTVTKKSRKVRNIVNNTDSPTLKTKTGFLNLREFTFEDTKSLDEKKSTID 720
                   PPRDTVTKKSRKVRNIVNNTDSPTLKTKTGFLNLREFTFEDTKSLDEKKSTID
Sbjct: 661  SELSSSSPPRDTVTKKSRKVRNIVNNTDSPTLKTKTGFLNLREFTFEDTKSLDEKKSTID 720

Query: 721  GLEKNYDNKENQESEYESTKKLDNSLDASSEANNYDITTRKKHSSCNHKIKQAVVRPASG 780
            GLEKNYDNKENQESEYESTKKLDNSLDASSEANNYDITTRKKHSSCNHKIKQAVVRPASG
Sbjct: 721  GLEKNYDNKENQESEYESTKKLDNSLDASSEANNYDITTRKKHSSCNHKIKQAVVRPASG 780

Query: 781  RISISRVQSIAITPTKELSIVDPEQNKXXXXXXXXXXXXPLNLEYNKKSALYXXXXXXXX 840
            RISISRVQSIAITPTKELSIVDPEQNK            PLNLEYNKKSALY        
Sbjct: 781  RISISRVQSIAITPTKELSIVDPEQNKSNSVIEEISEIEPLNLEYNKKSALYSDTSSTVI 840

Query: 841  XXXXXKLFESAQNSPLKQTQNPQREFPNGTSVSETNRIRLSIAPTIESVVSDLNSITTGS 900
                 KLFESAQNSPLKQTQNPQREFPNGTSVSETNRIRLSIAPTIESVVSDLNSITTGS
Sbjct: 841  SISTSKLFESAQNSPLKQTQNPQREFPNGTSVSETNRIRLSIAPTIESVVSDLNSITTGS 900

Query: 901  TVETFETSRDLPVPHQRIINLREEYQRGNQDIISNTSSLHELKTIDLSDSNNDLESPSTH 960
            TVETFETSRDLPVPHQRIINLREEYQRGNQDIISNTSSLHELKTIDLSDSNNDLESPSTH
Sbjct: 901  TVETFETSRDLPVPHQRIINLREEYQRGNQDIISNTSSLHELKTIDLSDSNNDLESPSTH 960

Query: 961  AKNNKYFFSPDDGSIDVASPMKNVEELKSKFLKNESETNSNISGSVLTMDDIDINDTSSA 1020
            AKNNKYFFSPDDGSIDVASPMKNVEELKSKFLKNESETNSNISGSVLTMDDIDINDTSSA
Sbjct: 961  AKNNKYFFSPDDGSIDVASPMKNVEELKSKFLKNESETNSNISGSVLTMDDIDINDTSSA 1020

Query: 1021 RNTRRANSESAFTGSLNKKNLNEIANMLDDSINDDPITVALMKLEGTYEKIPEKPENTKS 1080
            RNTRRANSESAFTGSLNKKNLNEIANMLDDSINDDPITVALMKLEGTYEKIPEKPENTKS
Sbjct: 1021 RNTRRANSESAFTGSLNKKNLNEIANMLDDSINDDPITVALMKLEGTYEKIPEKPENTKS 1080

Query: 1081 SDAIGIKTSKLADEVEMLNLNNLPSFQNSPAEKRKSLLIERRRQTIMNIPFTPDQSEKEG 1140
            SDAIGIKTSKLADEVEMLNLNNLPSFQNSPAEKRKSLLIERRRQTIMNIPFTPDQSEKEG
Sbjct: 1081 SDAIGIKTSKLADEVEMLNLNNLPSFQNSPAEKRKSLLIERRRQTIMNIPFTPDQSEKEG 1140

Query: 1141 FTSSSPEKIDVSANVDVAVQAAQIQELIGQYRIHDSRLMISNNESHVPFILMYDSLSVAQ 1200
            FTSSSPEKIDVSANVDVAVQAAQIQELIGQYRIHDSRLMISNNESHVPFILMYDSLSVAQ
Sbjct: 1141 FTSSSPEKIDVSANVDVAVQAAQIQELIGQYRIHDSRLMISNNESHVPFILMYDSLSVAQ 1200

Query: 1201 QMTLIEKEILGEIDWKDLLDLKMKHEGPQVISWLQLLVRNETLSGIDLAISRFNLTVDWI 1260
            QMTLIEKEILGEIDWKDLLDLKMKHEGPQVISWLQLLVRNETLSGIDLAISRFNLTVDWI
Sbjct: 1201 QMTLIEKEILGEIDWKDLLDLKMKHEGPQVISWLQLLVRNETLSGIDLAISRFNLTVDWI 1260

Query: 1261 ISEILLTKSSKMKRNVIQRFIHVADHCRTFQNFNTLMEIILALSSSVVQKFTDAWRLIEP 1320
            ISEILLTKSSKMKRNVIQRFIHVADHCRTFQNFNTLMEIILALSSSVVQKFTDAWRLIEP
Sbjct: 1261 ISEILLTKSSKMKRNVIQRFIHVADHCRTFQNFNTLMEIILALSSSVVQKFTDAWRLIEP 1320

Query: 1321 GDLLTWEELKKIPSLDRNYSTIRNLLNSVNPLVGCVPFIVVYLSDLSANAEKKDWILEDK 1380
            GDLLTWEELKKIPSLDRNYSTIRNLLNSVNPLVGCVPFIVVYLSDLSANAEKKDWILEDK
Sbjct: 1321 GDLLTWEELKKIPSLDRNYSTIRNLLNSVNPLVGCVPFIVVYLSDLSANAEKKDWILEDK 1380

Query: 1381 VVNYNKFDTNVQIVKNFIQRVQWSKFYTF 1409
            VVNYNKFDTNVQIVKNFIQRVQWSKFYTF
Sbjct: 1381 VVNYNKFDTNVQIVKNFIQRVQWSKFYTF 1409

>Scas_505.3
          Length = 1364

 Score = 1036 bits (2679), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 645/1433 (45%), Positives = 849/1433 (59%), Gaps = 132/1433 (9%)

Query: 1    MEIFSQKDYYPTPSSNVISY---ESDCVSKPVNSADLPALIVHLSSPLEGVDYNASADFF 57
            + IFS  DYYP PS++VI+Y    ++ + K V+ AD+ ALI +LSSP++ VDY   +DFF
Sbjct: 8    LGIFSADDYYPVPSTSVITYNESRTNKIRKTVSKADIIALITYLSSPIDPVDYTIFSDFF 67

Query: 58   LIYRNFITPQDLHDLLIYRFRWCIREITTNA-AKAKRRRIGEVALVRTFVLLRHSILNYF 116
            LIYR+F++P +LH+LLI RFRWCI EI  N     +++++GEVAL+RTFVLLRHSILNYF
Sbjct: 68   LIYRDFLSPNELHELLILRFRWCILEILENKNVDVEKQKVGEVALIRTFVLLRHSILNYF 127

Query: 117  VQDFLPNITLRLRLIEFLNDKHIEQYPKIISSCIINLKKNWVHCSKLVWENIELNEPDKL 176
            VQDFLP+  LR  L+ FLND   +  P+I+S  I+NLK+ W+H +K  WENI  NEP  +
Sbjct: 128  VQDFLPDSHLRYMLLNFLNDNVYQTSPRIVSGSIVNLKRAWIHSAKQTWENIPFNEPSSV 187

Query: 177  DFDAWLHYSLKDFTQLESLHKRGSRLSIYARQSFASPDFRNQSVLSLYKTSDVFRLPEKL 236
            DF+ WL + +KD  Q+E   KRGSRLS YA Q  +SPDFRN+SVLSLY ++D F+LPE L
Sbjct: 188  DFNEWLLFEIKDVIQMEEQLKRGSRLSEYAIQGSSSPDFRNRSVLSLYNSTDNFKLPESL 247

Query: 237  XXXXXXXXXXXXXMLLFPDNTSNVYSKHRI--AKEPSVDNESEDMSDSKQKISHLSKVTL 294
                         M+L+P++ SN+  K  I   KEP       D  +  +KISHLSK+  
Sbjct: 248  DFNSNRTKQTAS-MMLYPNDNSNI-PKIPIPKGKEPLKITLINDNKNDIRKISHLSKIAH 305

Query: 295  VSTLMKGVDYPSSYAVDKIMPPTPAKKVEFILNSLYIPEDLNEXXXXXXXXXXXXXXXXX 354
            +ST++K VDYP+S A+++I+PPTPAKKVEFILNSLYIPED +E                 
Sbjct: 306  MSTVIKDVDYPTSPAINRIIPPTPAKKVEFILNSLYIPEDNDETIEDNPRVKSTPPPIQS 365

Query: 355  XXXXXXXXXXXXXVLHRSAIGLLAKWMKNHNRHDSSND-KKFMSAIKPANQKPEMDAFVK 413
                         +L R AIGLLA+W +NH R+      K   S +     KP+MD FVK
Sbjct: 366  S------------LLQRGAIGLLARWKRNHTRNSRKEKIKTTQSGVNTPISKPDMDNFVK 413

Query: 414  YVVSISSLNRKSSKEEEEEFLNSDSSKFDILSARTIDEVESLLHLQNQLIEKVQTHSNNN 473
            YV+SI+SL    S     E  +  +SKFDILSARTIDEVE L+ L+N+L +KV+  +N N
Sbjct: 414  YVISITSLENTKS-HASGEINDMITSKFDILSARTIDEVEYLISLENELQQKVRGQANLN 472

Query: 474  RGPTVNVDCERREHIHDIKILQQNSFKPSND--NFSAMDNLDLYQTVSSIAQSVISXXXX 531
                         ++  I +     F+P  D  NFSAMDNLDLY+TVSS+AQSVIS    
Sbjct: 473  NN-----------NLKSIGLENTMPFEPPKDTANFSAMDNLDLYKTVSSLAQSVISLSNT 521

Query: 532  XXXXXXXXESNMQPSPSYDALQRRKVKSLTTAYYNKMHGSYSAESMRLFDKDNSSSRTDE 591
                      N   SPS  AL+RR V S   A   K+  S           + +  R   
Sbjct: 522  LNKSTKLKIVN---SPSLSALERRMVMSSFPALNGKVSSSSKIGIEDELVINITPPRAKN 578

Query: 592  NGPQRLLFHETDKTNSEAITNMTPRRKNHSQSQKSMTSSPLKNVLPDLKESSPLNDSRED 651
            +GPQRL+FH+   T S      TP + N   + +   SSPLKNVLP+L E    +    D
Sbjct: 579  DGPQRLVFHDDGSTLSLP---QTPTKSNRKSNIRH--SSPLKNVLPNLNEVDLSDSVCSD 633

Query: 652  TEXXXXXXXXXXXXXXPPRDTVTKKSRKV--RNIVNNTDSPTLKTKTGFLNLREFTFEDT 709
             E                    + +   +  R +    +  TLK KT   NLREFTFE +
Sbjct: 634  DESFVSTISYDSLLSSKSFKHKSSRRSNLYSRPLTFKNEEQTLKKKTASKNLREFTFETS 693

Query: 710  KSLDEKKSTIDGLEKNYDNKENQESEYESTKKLDNSLDASSEANNYDITTRKKHSSCNHK 769
            K      +   G  K    +  Q+        L  +     EA ++        S  N  
Sbjct: 694  KLSLPSPTKSQGSPKATHIR--QQHHLTPPVSLSPTDPLKMEAEDH-------LSPLNKL 744

Query: 770  IKQAVVRPASGRISISRVQSIAIT---------PTKELSIVDPE-QNKXXXXXXXXXXXX 819
              Q  +RPASGRISI R +S++IT         P K   + DP+   K            
Sbjct: 745  TPQTAIRPASGRISILR-KSLSITQARRNTYAGPPKADLLRDPDFIKKERSLIESEHQLQ 803

Query: 820  PLNLEYNKKSALYXXXXXXXXXXXXXKLFESAQNSPLKQTQNPQREFPNGTSVSETNRIR 879
             L  +  ++++L               LF S +NSP K              V+  N++R
Sbjct: 804  ELQDDLLERTSL-------QSSVATDNLFNSRKNSPKK--------------VTAENKVR 842

Query: 880  LSIAPTIESVVSDLNSITTGSTVETFETSRDLPVPHQRIINLREEYQRGN-QDIISNTSS 938
            LS  P+I S++ D +  ++G+T         +   + + I+LRE +  G+ Q++ISN  S
Sbjct: 843  LSTTPSIYSILDDSSL-SSGNTSYNDPARDSMQFTNDKRIDLREVFHNGSVQNVISNDLS 901

Query: 939  LHELKTIDLSDSNNDLESPSTHAKNNKYFFSPDDGSIDVASPMKNVEELKSKFLKNES-- 996
               +  +      ++L+    +  +NKY FSP++ + D+ SP K+VE LK+KFLKNE+  
Sbjct: 902  SDAISGL------SELKDNGINGVSNKYLFSPEEDNTDLISPGKDVEVLKNKFLKNETFE 955

Query: 997  -ETNSNISGSVLTMDDIDINDTSSARNTRRANSESAFTG-SLNKKNLNEIANMLDDSIND 1054
             E+ S I G                   + A+ E A     L+K+ L +IA++ DD+ + 
Sbjct: 956  EESESIIDG------------------IQEASDEGAMPNVDLDKEKLKDIADIPDDTGSG 997

Query: 1055 DPITVALMKLEGTYEKIPEKPENTKSSDAIGIKTSKLADEVEMLNLNNLPSFQNSPAEKR 1114
            DPI++A+MKLEGTY+      +N    D+  ++   L  EVEMLNL  LP+F  SP EKR
Sbjct: 998  DPISIAMMKLEGTYKT--NDDDNKTHEDSSSVQ--DLIKEVEMLNLKKLPTFPKSPLEKR 1053

Query: 1115 KSLLIERRRQTIMNIPFTPDQSEKEGFTSSSPEKIDVSANVDVAVQAAQIQELIGQYRIH 1174
            KSL+IERRRQTIMNIPFTP  SE EG            A  D  V   Q+Q L+  Y + 
Sbjct: 1054 KSLMIERRRQTIMNIPFTPQNSE-EGL-----------AIEDKCVSPLQVQTLVMNYEVQ 1101

Query: 1175 DSRLMISNNESHVPFILMYDSLSVAQQMTLIEKEILGEIDWKDLLDLKMKHEGPQVISWL 1234
            DS L ISNNE H+PFILMYDS S+A+QMTLIEKE+L EIDWKDLL+LK++++G  V SWL
Sbjct: 1102 DSSLQISNNEHHIPFILMYDSKSIAEQMTLIEKELLSEIDWKDLLNLKIQYKGKAVTSWL 1161

Query: 1235 QLLVRNETLSGIDLAISRFNLTVDWIISEILLTKSSKMKRNVIQRFIHVADHCRTFQNFN 1294
            QLL++NETLSG+DLAI+RFNLTVDWI+SEI LT+  KM+RN IQRFIHVA +CR FQN+N
Sbjct: 1162 QLLIQNETLSGVDLAIARFNLTVDWIVSEITLTRDVKMRRNTIQRFIHVAQYCREFQNYN 1221

Query: 1295 TLMEIILALSSSVVQKFTDAWRLIEPGDLLTWEELKKIPSLDRNYSTIRNLLNSVNPLVG 1354
            TLMEIILALSS VVQKFTDAWRLIEPGD+L WEELK IPSLDRNYSTIRNLLNS++P  G
Sbjct: 1222 TLMEIILALSSIVVQKFTDAWRLIEPGDMLLWEELKHIPSLDRNYSTIRNLLNSLDPKKG 1281

Query: 1355 CVPFIVVYLSDLSANAEKKDWILEDKVVNYNKFDTNVQIVKNFIQRVQWSKFY 1407
            C+PFIVVYLSDLS N+EK++WI++ KVVNY+KF+T+VQIVKNFIQRVQW+KFY
Sbjct: 1282 CIPFIVVYLSDLSLNSEKRNWIVDRKVVNYHKFETSVQIVKNFIQRVQWAKFY 1334

>CAGL0G06226g 592179..596135 similar to sp|P07866 Saccharomyces
            cerevisiae YAL024c LTE1, start by similarity
          Length = 1318

 Score =  831 bits (2147), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 551/1435 (38%), Positives = 796/1435 (55%), Gaps = 177/1435 (12%)

Query: 1    MEIFSQKDYYPTPSSNVISYESDCVSK----PVNSADLPALIVHLSSPLEGVDYNASADF 56
            M+IFSQ+DYYP PS +VI Y+     K     V  AD+P++IVHLSSP++ VDY   +DF
Sbjct: 1    MDIFSQRDYYPIPSDDVIKYKHMVHKKWNKNEVIQADIPSIIVHLSSPVDSVDYKGFSDF 60

Query: 57   FLIYRNFITPQDLHDLLIYRFRWCIREITT---NAAKAKRRRIGEVALVRTFVLLRHSIL 113
            FL YRNF+TP +L+D LI RF+WC+REI +     +   + RIG+VAL+RTFVLLRH IL
Sbjct: 61   FLFYRNFLTPAELYDYLILRFKWCMREIESYQHQRSGDNQLRIGKVALIRTFVLLRHGIL 120

Query: 114  NYFVQDFLPNITLRLRLIEFLNDKHIEQYPKIISSCIINLKKNWVHCSKLVWENIELNEP 173
            N+F  DFL N  LRLRLI F N+  I+   K+I SC+I+LKK W+H  KL W+N+  NEP
Sbjct: 121  NHFADDFLLNENLRLRLISFFNED-IKSDMKVIVSCLISLKKAWLHAMKLNWDNVLFNEP 179

Query: 174  DKLDFDAWLHYSLKDFTQLESLHKRGSRLSIYARQSFASPDFRNQSVLSLYKTSDVFRLP 233
                +  W+ Y +KD +QL+   KR SR S +  QS ++PD RN+S+LS+YK+ +   + 
Sbjct: 180  AFSAYTDWIDYKIKDVSQLDMAQKRNSRFSYHGIQSISNPDMRNRSILSIYKSDNFDHMV 239

Query: 234  EKLXXXXXXXXXXXXXMLLFPDNTSN-----VYSKHRIAKEPSVDNESEDMSDSKQKISH 288
            +                LLF  ++SN     VYS  + A++ ++   +   S+  +K   
Sbjct: 240  Q--SNSNKISRNRTPSTLLFQKDSSNSEMATVYSNRKGAQKKTIALPNILTSELDRK-DV 296

Query: 289  LSKVTLVSTLMKGVDYPSSYAVDKIMPPTPAKKVEFILNSLYIPEDLNEXXXXXXXXXXX 348
            +S VT +S +++      S  V+KI+P TPAKKVE ILN++Y P+ L             
Sbjct: 297  MSNVTRMSHIIQDAKTLRSSDVNKIIPSTPAKKVELILNTIYSPDCLESENIQESLNQDT 356

Query: 349  XXXXXXXXXXXXXXXXXXXVLHRSAIGLLAKWMKNHNRHDSSNDKKFMSAIKPANQK-PE 407
                                  +  + LLA+W KNH   D     K    +   N++  E
Sbjct: 357  SSTQKS--------------FPKGIMSLLARWKKNHKIADP----KIRKPVGFTNKREAE 398

Query: 408  MDAFVKYVVSISSLNRKSSKEEEEEFLNSD-SSKFDILSARTIDEVESLLHLQNQLIEKV 466
            +D FVKYV+SISSL   ++KEE+ + LN +  SKFDILSARTIDEVE L  L+++L+ ++
Sbjct: 399  LDNFVKYVISISSL---TNKEEDLKRLNENLDSKFDILSARTIDEVEYLFRLESKLLAQL 455

Query: 467  QTHSNNNRGPTVNVDCERREHIHDIKILQQNSFKPSN---DNFSAMDNLDLYQTVSSIAQ 523
             T     R  +        +  +D+ +       P+N      SAMDNLDL++TV+ +A+
Sbjct: 456  STMQKTTRTLS-------NDEFNDVNV-------PNNIDSKQISAMDNLDLFRTVNGVAR 501

Query: 524  SVISXXXXXXXXXXXXESNMQPSPSYDALQRRKVKSLTTAYYNK---MHGSYSAESMRLF 580
            SVIS            +        +  L RR+VKS    +YN+   + G  +   ++ +
Sbjct: 502  SVISLTNSVNKLNNLSD--------HSVLDRRRVKSSMPNFYNRERSLSGLSNYAGLQFY 553

Query: 581  DKDNSSSRTDENGPQRLLFHETDKTNSEAITNMTPRRKNHSQSQKSMTSSPLKNVLPDLK 640
            D  +  S  D+  PQ+L+FH+        +T    +  + S S      SPLK VLP+L 
Sbjct: 554  DASSEMSAEDDK-PQKLVFHDGVDELKNHLTQTFTKPGSISNS------SPLKKVLPNLF 606

Query: 641  ESSPLNDSREDTEXXXXXXXXXXXXXXPPRDTVTKKSRKVRNIVNNTDSPTLKTKTGFLN 700
            E  P  DS    +                  TV K  +   +  +N + P LK K  + N
Sbjct: 607  EH-PSVDSLASGDACSYVTYDSQLSQM---GTVKKSMKDETSRYSNYEGPVLKKKVAYDN 662

Query: 701  LREFTFEDTKSL--DEKKSTIDGLEKNYDNKENQESEYESTKKLDNSLDASSEANNYDIT 758
            LREFTFED+K +  ++  S ID L               S    D S+   +      + 
Sbjct: 663  LREFTFEDSKEIIKNDTSSLIDILN--------------SPVTPDLSILPQTPTGKGSVQ 708

Query: 759  TRKKHSSCNHKIKQAVVRPASGRISISRVQSIAITPTKELSIVDPEQNKXXXXXXXXXXX 818
             +KK  S      ++++ PASGRISI++   ++++P       D E  K           
Sbjct: 709  HKKKEKS------ESIISPASGRISIAKSHHMSLSPNLTKLKEDDEYVKGDNSLGQAEDE 762

Query: 819  XPLNLEYNKKSALYXXXXXXXXXXXXXKLFESAQNSPLKQTQNPQREFPNGTSVSETNRI 878
              + LE N + +                   S  ++PL  +     E P+          
Sbjct: 763  L-IRLEKNLRDSKLENYNTVVAGNLGAG---SGSSTPLGDSPTNVFELPS---------- 808

Query: 879  RLSIAPTIESVVSDLNSITTGSTVETFETSRDLPVPHQRIINLREEYQR--GNQDIISNT 936
                  +I  V SD+++       E+FE+S +   P     NLRE+Y +  G+ +  S  
Sbjct: 809  ------SINMVESDMDT-------ESFESSFEQRQP----TNLREQYFKSIGSPETASP- 850

Query: 937  SSLHELKTIDLSDSNNDLESPSTHAKNNKYFFSPDDGSIDVASPMKNVEELKSKFLK--N 994
                  + ++ +++ + + S  + +  NKY FSPD+ S+D+ASP+KNVE+LKS+FLK  N
Sbjct: 851  ------RKVNSNNAYSQVSSQMSPSLANKYLFSPDNESLDIASPVKNVEDLKSRFLKGNN 904

Query: 995  ESETNSNISGSVLTMDDIDINDTSSARNTRRANSESAFTGSLNKKNLNEIANMLDDSIND 1054
            +S ++S I  S      I+ + T++ +N         F    +K  L  I    ++ ++ 
Sbjct: 905  QSASSSQIGAS------INTSVTATPKNN------DMFGSDFDKNGLKNIMTASEEKLSK 952

Query: 1055 DPITVALMKLEGTYEKIPEKPENTKSSDAIGIKTSKLADEVEMLNLNNLPSFQNSPAEKR 1114
            DP+ +A+MKLEGT++K        KS +  G  +S L  EV++LN+ NLP    +P++KR
Sbjct: 953  DPVELAMMKLEGTFKK-------NKSGNNTGY-SSDLEKEVDILNIANLPEMNANPSDKR 1004

Query: 1115 KSLLIERRRQTIMNIP--FTPDQSEKEGFTSSSPEKIDVSANVDVAVQAAQIQELIGQYR 1172
            KSL+++RRRQT+ NI     P  +  EG+   S             +   +I  LI QY 
Sbjct: 1005 KSLMLDRRRQTMFNIGPSIYPSNTNDEGYDEES-------------ITDDKIWSLIAQYH 1051

Query: 1173 IHDSRLMISNNESHVPFILMYDSLSVAQQMTLIEKEILGEIDWKDLLDLKMKHEGPQVIS 1232
            I D  L+  N+ +HVPFILMY+S  VAQQ TLIE+EIL EIDWKDLLD+K+ ++GP + S
Sbjct: 1052 IDDENLLAKNHANHVPFILMYESKDVAQQFTLIEREILSEIDWKDLLDIKLLYKGPNLTS 1111

Query: 1233 WLQLLVRNETLSGIDLAISRFNLTVDWIISEILLTKSSKMKRNVIQRFIHVADHCRTFQN 1292
            WLQLL++N+  +GIDLA++RFNLTVDW ISEI+LT   KM+RN I+RFIHVA+HCR  QN
Sbjct: 1112 WLQLLIQNQEFTGIDLAVARFNLTVDWAISEIVLTTDLKMRRNTIERFIHVAEHCRKLQN 1171

Query: 1293 FNTLMEIILALSSSVVQKFTDAWRLIEPGDLLTWEELKKIPSLDRNYSTIRNLLNSVNPL 1352
            FNT+M+IILAL+S VVQKFT+AWRLIEPGD+L WE+L+KIP+LD NY  +R ++ +V+PL
Sbjct: 1172 FNTMMQIILALNSVVVQKFTEAWRLIEPGDMLLWEDLRKIPALDWNYHALRTMMKTVDPL 1231

Query: 1353 VGCVPFIVVYLSDLSANAEKKDWILEDKVVNYNKFDTNVQIVKNFIQRVQWSKFY 1407
             GC+PFIVVYLSDL+ N+EK  WI+E +VVNY+KF T VQIVKNFIQ+VQWS FY
Sbjct: 1232 KGCIPFIVVYLSDLTINSEKNTWIVEKRVVNYSKFSTCVQIVKNFIQKVQWSSFY 1286

>Kwal_26.7083
          Length = 1400

 Score =  750 bits (1937), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 567/1486 (38%), Positives = 780/1486 (52%), Gaps = 211/1486 (14%)

Query: 3    IFSQKDYYPTPSSNVISYESDCVSKPVNSADLPALIVHLSSPLEGVDYNASADFFLIYRN 62
            +FS+++YYPTPS+  +SY     +  +   DL ALI+ L+SPL+ +DY   ADFFL YR 
Sbjct: 16   VFSEREYYPTPSAEKMSYLKRGANTLIIKTDLHALIIKLTSPLDPIDYPFLADFFLSYRK 75

Query: 63   FITPQDLHDLLIYRFRWCIREITTNAAKAKRRRIGEVALVRTFVLLRHSILNYFVQDFLP 122
            F+ P +L  LL  R +W   E  +  A  +R++IG+V  VRTFV++RH ILNYF QDFL 
Sbjct: 76   FLAPNELLRLLESRLQWAFNE--SLQADKERQKIGQVTSVRTFVVIRHWILNYFAQDFLA 133

Query: 123  NITLRLRLIEFLND---KHIEQYPKIISSCIINLKKNWVHCSKLVWENIEL-NEPDKLDF 178
            +  LR + ++ +N       E  PK I   ++++KK+WV C KL+WE++   N P  +D 
Sbjct: 134  DQELRRQFVDSINSLSWGATEMAPKSIRGIVVSIKKSWVLCLKLMWEDVTFENSPSNVD- 192

Query: 179  DAWLHYSLKDFTQLESLHKRGSRLSIYARQSFASPDFRNQSVLSLYKTSDVFRLPEKLXX 238
              WL + ++D     S  + G RLS YA QS  +PDFRN+SVLSLY   + F+LPE    
Sbjct: 193  -EWLDFKIQDIDTQSSTKEGGRRLSFYALQSRQNPDFRNRSVLSLYVGIENFQLPENSAQ 251

Query: 239  ----XXXXXXXXXXXMLLFP-DNTSNVYSKHRIAKEPSVDNESEDMSDSKQKISHLSKVT 293
                           M LFP DN  +   K          +ES + ++S    S  SK  
Sbjct: 252  INRRLGAKIKQRTASMFLFPQDNLPSARLK--------ASSESSEPANSHS--SGHSKSE 301

Query: 294  LVSTLMKGVDYPSSYAVDKIMPPTPAKKVEFILNSLYIPEDLNEXXXXXXXXXXXXXXXX 353
                +MK + YP+S +VDK++PPTPAKKVEFIL S Y+P D                   
Sbjct: 302  SGPDVMKDLQYPTSPSVDKVIPPTPAKKVEFILRSSYLPSD-----------SPTEEADP 350

Query: 354  XXXXXXXXXXXXXXVLHRSAIGLLAKWMKNHNRHDSSNDKKFMSAIKPANQKPEMDAFVK 413
                            ++  +GLL+KW KNHN   S N K    +  P NQ  E++  +K
Sbjct: 351  ANAKTDKVKKHNNHSYNKGMVGLLSKWKKNHNLR-SENHKAHSES--PKNQ--EIENLIK 405

Query: 414  YVVSISSLNRKSSKEEEEEFLNSDSSKFDILSARTIDEVESLLHLQNQLIEKVQTHSNNN 473
             V SI+SL  K  +++ E+  N+ SSKFDILSARTIDEVE  L ++N L+ K++     N
Sbjct: 406  LVFSITSLEHK--QDQSEDAANALSSKFDILSARTIDEVEYFLAIENDLLSKIR-----N 458

Query: 474  RGPTVNVDCERREHIHDIKILQQNSFKPSNDNFSAMDNLDLYQTVSSIAQSVISXXXXXX 533
            RG   N      E IH      +N    S +  SAMDNL+LY+TVSSIA SVIS      
Sbjct: 459  RGGLFNF-----ERIH-----HENPQTQSPEAVSAMDNLNLYKTVSSIASSVISLSKTL- 507

Query: 534  XXXXXXESNMQPSPSYDALQRRKVKSLTTAYYNKMHGSYSAESMRLFDKDNSSSRTDENG 593
                  + +   SPS  A +RR+VKS    + N    +++     L  +D  +  T  +G
Sbjct: 508  ------QYHHAVSPSAAAQERRRVKSAEVFFRNNSVLNFTDA---LLTRDIKTPATGNDG 558

Query: 594  PQRLLFHETDKTNSEAITNMTPRRKNHSQSQKS-MTSSPLKNVLPDL--KESSPLNDSRE 650
            P++L+FH       E I     R  ++    K+ +TS    +V+  +  KE +  + SR 
Sbjct: 559  PRKLVFH--GPMGMERIRKEEFRFHHYKTPTKTGLTSHSTPSVMQSVNTKEVNTEDRSRY 616

Query: 651  DTEXXXXXXXXXXXXXXPPRDTVTK------KSRKVRNIVNNTDSPTLKTKTGFLNLREF 704
                                DT +K       ++ V ++  +T+ P LK K G  NLREF
Sbjct: 617  SPTKGIRISSVITEVD----DTFSKHENSMNSAQSVNSVSLDTELP-LKRKEGLKNLREF 671

Query: 705  TFE---DTKSLDEKKSTIDGLEKNYDNKENQESEYESTKKLDNSLDASSEANNY-----D 756
             FE   D   + +++   D  E      E +  E  S+  L N  DA  +  ++     D
Sbjct: 672  NFEEVADHPEVTDQQEVTDQQELG----EGENGERLSSADLQN--DAEDDNASFFTTFDD 725

Query: 757  ITTR---KKHSSCNHKIKQAVVRPASGRISI--SRVQSIAITPTKELS--IVDPEQNKXX 809
            ++ R   K+ +  +   +++V   +SGRISI  SR QS++   T  L   IV        
Sbjct: 726  VSVRESIKRFTPASSVAQKSVT--SSGRISIRKSRGQSVSQPRTSVLGGLIVQEGAFSRL 783

Query: 810  XXXXXXXXXXPLNLEYNKKSALYXXX---------------------XXXXXXXXXXKLF 848
                        NLE  + SAL                                    LF
Sbjct: 784  DEELLNNEEEMKNLE-ERTSALVLSAKEDEKEKERSDCEEEDAADDRASNATSVSTQLLF 842

Query: 849  ESAQNSP----LKQTQNPQREFPNGTSVSETNRIRLSIAPTIESVVSDLNSITTGSTVET 904
             S  NSP    LK+  +  R FP G  +     IRLS  P++ S+VS       G +  +
Sbjct: 843  TSQNNSPNKMDLKELLDNDR-FPPGNKL-----IRLSSIPSMHSIVS-------GDSFSS 889

Query: 905  FETSRDLPVPHQRIINLREEYQRGNQDIISNTSSLHELKTIDLSDSNNDLESPSTHAKN- 963
            F+T+    + H          + G + ++  T S+      + S   + L  P    +  
Sbjct: 890  FQTTNTFGL-HS------TNSKTGARAVV--TPSMD----AEFSGPKDSLLGPEGDDREA 936

Query: 964  NKYFFSPDDGSIDVASPMKNVEELKSKFLK---------NESETNSNISGSVLTMDDIDI 1014
            NKY FSPD  S+D ASP KN+E+LK+KF+          NE +T+           + + 
Sbjct: 937  NKYLFSPDSDSLDFASPEKNMEDLKNKFISPIVSEAPSLNEEQTSREFDDD----QEGEP 992

Query: 1015 NDTSSARNT----------RRANSESAFTGSLNKKNLNEIANMLDDSINDDPITVALMKL 1064
            ND+  +  T          RR+ +        N   LN+ A + D+S++ DP+ VALMKL
Sbjct: 993  NDSQLSSTTQPERLPHEHHRRSITPIVSPYKANDSRLNKFAKLTDESLHGDPVNVALMKL 1052

Query: 1065 EGTYEKI-PEKPENTKSSDAIGIKTSKLADEVEMLNLNNLPSFQNSPAEKRKSLLIERRR 1123
            EGT+ K   EK EN    DA          ++E L    L       + +R+S LIE+RR
Sbjct: 1053 EGTFSKENKEKGEN----DA----------DIEKLKERRLTGLG---SRERRSFLIEKRR 1095

Query: 1124 QTIMNIPFTPDQSEKEGFTSSSPEKIDVSANVDVAVQAAQIQELIGQYRIHDSRLMISNN 1183
            Q    IP TP   EK            V    +V     +I EL+  Y+I D RL +SN 
Sbjct: 1096 QIKSEIPLTPRSKEK------------VKQEEEVRATDLEITELLENYKIQDKRLNVSNA 1143

Query: 1184 ESHVPFILMYDSLSVAQQMTLIEKEILGEIDWKDLLDLKMKHEGPQVISWLQLLVRNETL 1243
            + HVPFILMYDS S+A+Q+TL+E+EIL EIDWKDLLDLK+K E P V SWLQLL++NE L
Sbjct: 1144 QQHVPFILMYDSRSIAEQLTLVEREILNEIDWKDLLDLKLKREVPSVTSWLQLLLQNERL 1203

Query: 1244 SGIDLAISRFNLTVDWIISEILLTKSSKMKRNVIQRFIHVADHCRTFQNFNTLMEIILAL 1303
            SGIDLAI+RFNLTVDWIISEI++T  +K++RN IQR IHVA+HC+TFQN+NTLM+IILAL
Sbjct: 1204 SGIDLAIARFNLTVDWIISEIVMTCDNKLRRNTIQRLIHVAEHCKTFQNYNTLMQIILAL 1263

Query: 1304 SSSVVQKFTDAWRLIEPGDLLTWEELKKIPSLDRNYSTIRNLLNSVNPLVGCVPFIVVYL 1363
            SS VVQ + DAWRLIEPGDLLTWE LK +PSL++NY  IR LLN +NP+ GC+PFIVVYL
Sbjct: 1264 SSLVVQSYRDAWRLIEPGDLLTWESLKNVPSLEKNYYNIRMLLNDINPIKGCIPFIVVYL 1323

Query: 1364 SDLSANAEKKDWILEDKVVNYNKFDTNVQIVKNFIQRVQWSKFYTF 1409
            SDL+ NAEK +WI+ ++V+NY+KF TNVQIVKNFIQR QWSKFY F
Sbjct: 1324 SDLTLNAEKSNWIVPNQVLNYSKFQTNVQIVKNFIQRAQWSKFYQF 1369

>KLLA0A04059g complement(361328..365428) similar to sp|P07866
            Saccharomyces cerevisiae YAL024c LTE1 GDP/GTP exchange
            factor, start by similarity
          Length = 1366

 Score =  454 bits (1167), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 239/448 (53%), Positives = 310/448 (69%), Gaps = 37/448 (8%)

Query: 962  KNNKYFFSPDDGSIDVASPMKNVEELKSKFLKNESETNSNISGSVLTMDDIDINDTSSAR 1021
            +NNKY FSPD  SID ASP KN+++LK +F+   ++  +++    +   D +  D     
Sbjct: 922  ENNKYLFSPDTDSIDFASPEKNLDDLKQQFIDQSTDEQTSLDEEEIATQDNENKD----- 976

Query: 1022 NTRRANSESAFTGSLNKKNLNEIANMLDDSIND--DPITVALMKLEGTYEKIPEKPENTK 1079
                          ++KK L +I N +DD+ +   DP+ +ALMKLEGTY+K  EK  + K
Sbjct: 977  ------------HGIDKKKLEDIMNGIDDTADTSMDPVNLALMKLEGTYDK-GEKEIDDK 1023

Query: 1080 SSDAIGIKTSKLADEVEMLNLNNLPSFQNSPAEKRKSLLIERRRQTIMNIPFTPDQSEKE 1139
            S        S+LA EVE   +    +   S A KR+S+ I+RRR T+++        +K+
Sbjct: 1024 SPSI----NSELAREVENFQIVQTAALPES-ARKRQSMFIQRRRNTMIDFSVRDSLIDKD 1078

Query: 1140 GFTSSSPEKIDVSANVDVAVQAAQIQELIGQYRIHDSRLMISNNESHVPFILMYDSLSVA 1199
                SS  +++   N D      QI+ L+ QY + DSRL I N E H+PFILMYDS SVA
Sbjct: 1079 ----SSCTRLE---NTD-----EQIRNLLNQYTLTDSRLKIDNLEQHIPFILMYDSKSVA 1126

Query: 1200 QQMTLIEKEILGEIDWKDLLDLKMKHEGPQVISWLQLLVRNETLSGIDLAISRFNLTVDW 1259
             Q+TLIEKEIL E+DWKDLLDL M  + PQ  SWLQLLV+NE LSGIDLAI+RFNLTVDW
Sbjct: 1127 NQLTLIEKEILSEVDWKDLLDLTMSEQLPQFTSWLQLLVQNENLSGIDLAIARFNLTVDW 1186

Query: 1260 IISEILLTKSSKMKRNVIQRFIHVADHCRTFQNFNTLMEIILALSSSVVQKFTDAWRLIE 1319
            IISEI++T+  +++RN IQRFIH+A+HC+  QN+NTLMEIILAL+S VVQKFT+ WRL+E
Sbjct: 1187 IISEIVMTQDIRLRRNTIQRFIHIAEHCKELQNYNTLMEIILALNSIVVQKFTETWRLVE 1246

Query: 1320 PGDLLTWEELKKIPSLDRNYSTIRNLLNSVNPLVGCVPFIVVYLSDLSANAEKKDWILED 1379
            PGDLLTWE LK IPSL++NYS IR L++ V PL GC+PFIVVYLSDLS N EK+ WI+ D
Sbjct: 1247 PGDLLTWETLKAIPSLEKNYSNIRQLIDEVEPLSGCIPFIVVYLSDLSLNIEKRTWIVHD 1306

Query: 1380 KVVNYNKFDTNVQIVKNFIQRVQWSKFY 1407
            +V+NYNKF TNVQIVKNF+Q++QWSKFY
Sbjct: 1307 EVLNYNKFQTNVQIVKNFVQKMQWSKFY 1334

 Score =  308 bits (788), Expect = 9e-86,   Method: Compositional matrix adjust.
 Identities = 248/820 (30%), Positives = 401/820 (48%), Gaps = 118/820 (14%)

Query: 3   IFSQKDYYPTPSSNVISYESDCVSKPVNSADLPALIVHLSSPLEGVDYNASADFFLIYRN 62
           +FS+ + YP PS +V++ +    +  +    LPAL+V LSSPL+ VDY+   DFFL+YRN
Sbjct: 15  LFSRPELYPVPSESVLTVDLRDGTVRILKCTLPALLVQLSSPLDKVDYSMLTDFFLVYRN 74

Query: 63  FITPQDLHDLLIYRFRWCIREITTNAAKAKRRRIGEVALVRTFVLLRHSILNYFVQDFLP 122
           F++ Q L DL+  RF+W I ++  +   ++ +   EV LVR FVL+RH + NYF QDF+ 
Sbjct: 75  FMSSQKLLDLIQERFQWAI-DLRQSDPSSQEKITSEVILVRMFVLVRHWLSNYFAQDFVV 133

Query: 123 NITLRLRLIEFLNDKHIEQYPKIISSCIINLKKNWVHCSKLVWENIE--LNEPDKLDFDA 180
           + +LR + ++F+N        + + + II+LKK WV   +++WE++E  + E + +  D 
Sbjct: 134 DTSLRRQFLQFIN--GYSPVDRFLDNIIISLKKLWVQNVQIMWEDLENLIVENNVVSRDD 191

Query: 181 WLHYSLKDF-----TQLESLHKRGSRLSIYARQSFASPDFRNQSVLSLYKTSDVFRLPEK 235
           WL + ++D      ++      +G RLS  A Q+  +P  RN+S+LSL  T +   LP++
Sbjct: 192 WLKWEIEDVPSGSSSETGEGSTKGKRLSFIALQNINNPVLRNESLLSLLHTREKIPLPQQ 251

Query: 236 LXXXXXXXXX----XXXXMLLFPDNTSNVYSKHR------IAKEPSVDNESE-----DMS 280
                             MLLFP+N SN  S +       ++ E +   E E     +  
Sbjct: 252 SEDESKKQSTRIKQRTGSMLLFPENASNGLSINEKLTASGVSPEATPKQEREITDPKNSK 311

Query: 281 DSKQKISHLSKVTLVSTLMKGVDYPSSYAVDKIMPPTPAKKVEFILNSLYIPEDLNEXXX 340
           D+K  +  LS+VT VS +MK ++YPS+ +VD  +PPTPAK +EFIL + Y+  DL E   
Sbjct: 312 DNKHILPQLSRVTNVSYMMKDLEYPSTPSVDIFVPPTPAKNIEFILQTSYMETDLPEQSN 371

Query: 341 XXXXXXXXXXXXXXXXXXXXXXXXXXXVLHRSAIGLLAKWMKNHNRHDSSNDKKFMSAIK 400
                                        H+  +GLL+KW  NH R  + N         
Sbjct: 372 GSDSTNTVNGNNTN---------------HKGILGLLSKWKLNHQRKPTVN--------- 407

Query: 401 PANQKPEMDAFVKYVVSISSLNRKSSKEEEEEFLNSDSSKFDILSARTIDEVESLLHLQN 460
           P    P ++  +KYV SISSL+  ++        +S SS FDILSARTIDEVE L+ +++
Sbjct: 408 PVQNPPRVENLIKYVFSISSLDNHANP-----LPDSLSSMFDILSARTIDEVEYLVSVES 462

Query: 461 QLIEKVQTHSNNNRGPTVNVDCERREHIHDIKILQQNSFKPSNDNFSAMDNLDLYQTVSS 520
            L+ K+                E ++   +I  L+ N  +  + ++S +DNL+LY+TVSS
Sbjct: 463 DLLAKL----------------EAKKLTTEISKLETN--EDESQDYSVIDNLNLYKTVSS 504

Query: 521 IAQSVISXXXXXXXXXXXXESNMQPSPSYDALQRRKVKSLTTAYYNKMHGSYSAESMRLF 580
           IA SVIS             +++  SPS  AL+R+ +++     Y+  +  YS  +  L 
Sbjct: 505 IANSVISLSKTLNVRTNKSTTHLL-SPSTSALERKNIRNSAPMLYSYNNSRYSITNA-LM 562

Query: 581 DKDNSSSRTDENGPQRLLFHETDKTNSEAITNMTPRRKNHSQSQKSMTSSPLKNVLPDLK 640
              N++   D + P+RL+FH+             P R  +S ++K++ ++ L N+     
Sbjct: 563 GLPNTN---DNSSPKRLVFHD-------------PTR--NSPTKKAILANNLNNI----- 599

Query: 641 ESSPLNDSREDTEXXXXXXXXXXXXXXPPRDTVTKKSRKVRNIVNNTDSPTLKTKTGFLN 700
                N  R+                      +  + +   NI   + +PTLK K    +
Sbjct: 600 --GEYNGERDSITSIVTYDSAFSDISS--SGNILSQHKGSSNIFMES-APTLKRKLNVND 654

Query: 701 LREFTFEDTKSLDEKKSTIDGLEKNYDNKENQES---------EYESTKKLDNSLDASSE 751
           LR F FE + S D++  +    E    +  + ES         EYE+  +     D +S 
Sbjct: 655 LRRFNFEKSDSTDDRSCSPQNREATETSATSMESDANDNAIQDEYENENE-----DIASL 709

Query: 752 ANNYDITTRKKHSSCNHKIKQAVVRPASGRISISRVQSIA 791
              Y+ +T +  + C +  +  + RP SGRISI+R  S+A
Sbjct: 710 ITAYEESTSEIDTQCQNNAQ--IRRPTSGRISITRNYSVA 747

>ACR292W [1339] [Homologous to ScYAL024C (LTE1) - SH]
            complement(891524..895843) [4320 bp, 1439 aa]
          Length = 1439

 Score =  437 bits (1123), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 238/455 (52%), Positives = 305/455 (67%), Gaps = 40/455 (8%)

Query: 963  NNKYFFSPDDGSIDVASPMKNVEELKSKFLKNESETNSNISGSVLTMDDIDINDTSSARN 1022
             NKY FSP + + D ASP K++E LK+KF+  + E     SG          ND   A  
Sbjct: 986  GNKYIFSPGETAED-ASPKKDMETLKTKFMTTK-EPPVCPSG----------NDADLALI 1033

Query: 1023 TRRANSESAFTGSLNKKNLNEIANMLDDSIND--------DPITVALMKLEGTYEKIPEK 1074
              +    +     +  +N N+ AN L              DP+ VALMKLEGT+ K P K
Sbjct: 1034 ISKLKETNPSAERIETENPNDDANNLTPPATSSSNNENSSDPVAVALMKLEGTFAK-PAK 1092

Query: 1075 PENTKSSDAIGIKTSKLADEVEMLNLNNLPSFQNSPAEKRKSLLIERRRQTIMNI--PFT 1132
             +NT +S     ++S LA EVE L+        +    KR+S+ IERRR T+ +I    T
Sbjct: 1093 EDNT-ASKLNSPRSSVLAKEVEKLDFQKWRFPSSKTMNKRQSMFIERRR-TMTDIFSSAT 1150

Query: 1133 PDQSEKEGFTSSSPEKIDVSANVDVAVQAAQIQELIGQYRIHDSRLMISNNESHVPFILM 1192
             D S +E     SP+  D            +I+EL+  Y++ D RL I N E HVPFILM
Sbjct: 1151 EDTSSEE----QSPKLSD-----------REIRELLETYKLQDPRLNIKNVEHHVPFILM 1195

Query: 1193 YDSLSVAQQMTLIEKEILGEIDWKDLLDLKMKHEGPQVISWLQLLVRNETLSGIDLAISR 1252
            YDS S+A+QMTLIE+E++ EIDWKDLLDL MK   P+V SWLQLL+ NE LSGIDLAI+R
Sbjct: 1196 YDSCSIAKQMTLIEREVMNEIDWKDLLDLNMKKSLPRVTSWLQLLLHNEELSGIDLAIAR 1255

Query: 1253 FNLTVDWIISEILLTKSSKMKRNVIQRFIHVADHCRTFQNFNTLMEIILALSSSVVQKFT 1312
            FNLTVDWIISE+++T   K++RN IQR IHVA+HCR +QN+NT+MEI+LAL+S VVQKFT
Sbjct: 1256 FNLTVDWIISELVMTTDIKLRRNAIQRLIHVAEHCRMYQNYNTVMEIVLALNSVVVQKFT 1315

Query: 1313 DAWRLIEPGDLLTWEELKKIPSLDRNYSTIRNLLNSVNPLVGCVPFIVVYLSDLSANAEK 1372
             +WRLIEP D+LTWE LK IPSLDRNY  +RNLLNS++P+ GC+PF+VVYLSDL+ N+EK
Sbjct: 1316 SSWRLIEPADMLTWEHLKSIPSLDRNYHNVRNLLNSIDPIKGCIPFLVVYLSDLALNSEK 1375

Query: 1373 KDWILEDKVVNYNKFDTNVQIVKNFIQRVQWSKFY 1407
            +DWI+ +++VNYNKF TNVQIVKNFIQRVQW++FY
Sbjct: 1376 RDWIVPNEIVNYNKFQTNVQIVKNFIQRVQWARFY 1410

 Score =  344 bits (882), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 257/748 (34%), Positives = 376/748 (50%), Gaps = 100/748 (13%)

Query: 3   IFSQKDYYPTPSSNVISYESDCVSKPVNSADLPALIVHLSSPLEGVDYNASADFFLIYRN 62
           +FS  DYYP PS  VI+Y +    + + +AD+ AL+  L+SP++GV+Y   ADFFL+YRN
Sbjct: 15  VFSAADYYPAPSGRVITYAAGGRGRQIMAADVTALVAALTSPVDGVEYELFADFFLVYRN 74

Query: 63  FITPQDLHDLLIYRFRWCIREITTNAAKAKRRRIGEVALVRTFVLLRHSILNYFVQDFLP 122
           F+  + L +LL  RF W + EI   A +AK R +GE+ LVRTFVLLRH ++NYF QDFLP
Sbjct: 75  FLEARRLLELLEARFDWSLGEI--GAGRAKARVVGEITLVRTFVLLRHWVINYFAQDFLP 132

Query: 123 NITLRLRLIEFLN---DKHIEQYPKIISSCIINLKKNWVHCSKLVWENIELNEPDKL-DF 178
           ++ LR R + F+N          PKI+++ +++LKK W +  +L+W++++L    +L   
Sbjct: 133 DVALRERFLAFVNGLGGAAGGTRPKIVANIVVSLKKTWAYTVRLIWDDLDLEREFELRSA 192

Query: 179 DAWLHYSLKDFTQL--ESLHKRGSRLSIYARQSFASPDFRNQSVLSLYKTSDVFRLPEKL 236
           DAWL + + D TQL  E+  +R SRLS YARQS  +P FRN+SVLSLY+  D F+LP + 
Sbjct: 193 DAWLQFQIPDVTQLKTEAGLQRDSRLSFYARQSSTNPSFRNESVLSLYRPKDNFQLPVRN 252

Query: 237 X----XXXXXXXXXXXXMLLFPDNTSNVYS---KHRIAKEPSVDNESEDMSDSKQKISHL 289
                            M L+P ++ N  S   K + + EP     S       +KISH+
Sbjct: 253 NDYNIKQGTRIKKRTASMFLYPQDSLNAPSGNQKPQCSLEPPFPAHSH-----VRKISHI 307

Query: 290 SKVTLVSTLMKGVDYPSSYAVDKIMPPTPAKKVEFILNSLYIPEDLNEXXXXXXXXXXXX 349
           SKVT VS ++K V YP+S AV+   PPTP+KK+EF +NS Y+P    E            
Sbjct: 308 SKVTNVSNVIKEVAYPTSPAVESFFPPTPSKKLEFTVNSTYVPPAAAECSREPSAQKKPR 367

Query: 350 XXXXXXXXXXXXXXXXXXVLHRSAIGLLAKWMKNH-NRHDSSNDKKFMSAIKPANQKPEM 408
                               +R+  GLL+KW  NH +RH + +     S ++PA     M
Sbjct: 368 SPNG----------------YRAVTGLLSKWRMNHLSRHKACDR---TSTVEPA-----M 403

Query: 409 DAFVKYVVSISSLNR-KSSKEEEEEFLNSDSSKFDILSARTIDEVESLLHLQNQLIEKVQ 467
           D  +KYV SISSL   K   +EE E      SKFDILSARTI+EVE L+ ++N++++KV 
Sbjct: 404 DNLIKYVFSISSLESPKGDIQEEREI---SPSKFDILSARTIEEVEHLITVENEVLQKVT 460

Query: 468 THSNNNRGPTVNVDCERREH-----IHDIKILQQNSFKPSNDNFSAMDNLDLYQTVSSIA 522
            H     G         RE      +++  +L Q     +   +S +DNL+LY+TVS+IA
Sbjct: 461 AH----EGKVPITSSSAREARFPPLLNEAPLLDQAPLG-NGQEYSVIDNLNLYRTVSTIA 515

Query: 523 QSVI-----SXXXXXXXXXXXXESNMQPSPSYDALQRRKVK-----SLTTAYYNKMHGSY 572
            SVI     +                Q   S  A +    +     SL    Y     S 
Sbjct: 516 TSVIKLTRTASQRQTKVTLPPPPPLRQRPTSLSAFRGSSSRMLLSDSLRRDGYQNSKASL 575

Query: 573 SAESMRLFDKDNSSSRTDENGPQRLLFH-------ETDKT-NSEAITNMTPRRKNHSQSQ 624
               +   D++   S    + P +++FH        TDK  +++A+ + +P+        
Sbjct: 576 HLRPLASADENAEGSSVQASNPPQVIFHTHALIKTPTDKVFDAKAVEDTSPK-------- 627

Query: 625 KSMTSSPLKNVLPDLKESSPLNDSREDTEXXXXXXXXXXXXXXPPRDTVTKKSRKVRNIV 684
            S+ S+ + +  P   ES+   DS  D +                RD  T    +  N  
Sbjct: 628 TSLVSTQVTDARPPSYESTITYDS--DLQDITM------------RDYNTSNQTENHNDG 673

Query: 685 N-NTDSPTLKTKTGFLNLREFTFEDTKS 711
             +T+ P L  KT   NLREF FE + S
Sbjct: 674 TLDTNQPILNRKTNHSNLREFLFEASTS 701

>YLL016W (SDC25) [3403] chr12 (112846..115992) Protein of unknown
            function [3147 bp, 1048 aa]
          Length = 1048

 Score = 81.3 bits (199), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 78/292 (26%), Positives = 130/292 (44%), Gaps = 39/292 (13%)

Query: 1127 MNIPFTPDQSEKEGFTSSSPEKIDVSANVDVAVQAAQIQELIGQYRI--------HDSRL 1178
            +N+ +    + KE  T S    +++   V+   +   IQE     +         H S  
Sbjct: 681  LNLDYFAQVAIKENITGS----VELLKEVNQKFKHGNIQEATAPMKTLDQQICQDHYSGT 736

Query: 1179 MISNNESHVPFILMYDSLSVAQQMTLIEKEILGEIDWKDLLDLKMKHEGPQVISWLQLLV 1238
            + S  ES    IL  D +  A Q+T++E EI  EI   D L         Q I W     
Sbjct: 737  LYSTTES----ILAVDPVLFATQLTILEHEIYCEITIFDCL---------QKI-WKNKYT 782

Query: 1239 RNETLS-GIDLAISRFNLTVDWIISEILLTKSSKMKRNVIQRFIHVADHCRTFQNFNTLM 1297
            ++   S G++  IS  N   ++I   ++       +  ++  FI +A++CR F NF+++ 
Sbjct: 783  KSYGASPGLNEFISFANKLTNFISYSVVKEADKSKRAKLLSHFIFIAEYCRKFNNFSSMT 842

Query: 1298 EIILALSSSVVQKFTDAWRLIEPGDLLTWEELKKIPSLDRNYSTIRNLLNSVNPLVGCVP 1357
             II AL SS + +    W+ + P      + L K+    +N+   RN L S++    CVP
Sbjct: 843  AIISALYSSPIYRLEKTWQAVIPQTRDLLQSLNKLMDPKKNFINYRNELKSLHS-APCVP 901

Query: 1358 FIVVYLSDLS-ANAEKKDWIL----------EDKVVNYNKFDTNVQIVKNFI 1398
            F  VYLSDL+  ++   D+++          E K +N+NK    V I++  I
Sbjct: 902  FFGVYLSDLTFTDSGNPDYLVLEHGLKGVHDEKKYINFNKRSRLVDILQEII 953

>Kwal_14.2313
          Length = 1517

 Score = 75.1 bits (183), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 47/148 (31%), Positives = 77/148 (52%), Gaps = 3/148 (2%)

Query: 1250 ISRFNLTVDWIISEILLTKSSKMKRNVIQRFIHVADHCRTFQNFNTLMEIILALSSSVVQ 1309
            IS  N   +++   I+   ++K +  V Q FI VA+HC    NF+++  I+ AL SS + 
Sbjct: 1284 ISSANSLTNYVSFAIVKQTNTKKRARVTQHFISVAEHCYELNNFSSMTAIVSALYSSPIF 1343

Query: 1310 KFTDAWRLIEPGDLLTWEELKKIPSLDRNYSTIRNLLNSVNPLVGCVPFIVVYLSDLSAN 1369
            +   +W L+        E L  +    +N++T RN L ++     CVPF  VYLSDL+  
Sbjct: 1344 RLKKSWALVPEESQKVLENLNTLMDPAKNFATYRNWLKTIQD-TACVPFFGVYLSDLTFI 1402

Query: 1370 AEKKDWILE--DKVVNYNKFDTNVQIVK 1395
            AE     L    +++N++K    V+I+K
Sbjct: 1403 AEGNPNYLHRSSEIINFSKRVRIVEILK 1430

>CAGL0E03476g complement(318956..323650) similar to sp|P04821
            Saccharomyces cerevisiae YLR310c CDC25 GDP/GTP exchange
            factor for RAS1P and RAS2P, start by similarity
          Length = 1564

 Score = 74.3 bits (181), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 57/211 (27%), Positives = 90/211 (42%), Gaps = 13/211 (6%)

Query: 1190 ILMYDSLSVAQQMTLIEKEILGEIDWKDLLDLKMKHEGPQVISWLQLLVRNETLSGIDLA 1249
            +L  D    A Q+TLIE ++   I   + LD           +W            I   
Sbjct: 1275 LLDIDPYLYAAQLTLIEHDLYLRITMFECLDR----------AWGNKYCDMGGSPNITRF 1324

Query: 1250 ISRFNLTVDWIISEILLTKSSKMKRNVIQRFIHVADHCRTFQNFNTLMEIILALSSSVVQ 1309
            I+  N   +++   I+     + +  +IQ FI VA HC+   NF+++  I+ AL SS + 
Sbjct: 1325 IANANSLTNYVSFTIVKHADVQKRAKLIQYFITVAQHCKELNNFSSMTAIVSALYSSPIY 1384

Query: 1310 KFTDAWRLIEPGDLLTWEELKKIPSLDRNYSTIRNLLNSVNPLVGCVPFIVVYLSDLSAN 1369
            +    W L+        + L  +    RN+   R LL SV   V CVPF  VYLSDL+  
Sbjct: 1385 RLKQTWNLVPTETKEVLDNLNSLMDSKRNFIKYRELLRSVKD-VACVPFFGVYLSDLTFT 1443

Query: 1370 AEKKDWILEDK--VVNYNKFDTNVQIVKNFI 1398
                   L+ K  ++N+ K      I++  +
Sbjct: 1444 FAGNSDYLDGKTDIINFGKRSKIANIIEGIL 1474

>YLR310C (CDC25) [3699] chr12 complement(752226..756995)
            Guanine-nucleotide exchange protein for Ras1p and Ras2p,
            has an SH3 domain [4770 bp, 1589 aa]
          Length = 1589

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 53/180 (29%), Positives = 82/180 (45%), Gaps = 15/180 (8%)

Query: 1190 ILMYDSLSVAQQMTLIEKEILGEIDWKDLLDLKMKHEGPQVISWLQLLVRNETLSGIDLA 1249
            +L  D  + A Q+T++E ++   I   + LD           +W            I   
Sbjct: 1301 LLDIDPYTYATQLTVLEHDLYLRITMFECLDR----------AWGTKYCNMGGSPNITKF 1350

Query: 1250 ISRFNLTVDWIISEILLTKSSKMKRNVIQRFIHVADHCRTFQNFNTLMEIILALSSSVVQ 1309
            I+  N   +++   I+     K +  + Q F+ VA HC+   NF+++  I+ AL SS + 
Sbjct: 1351 IANANTLTNFVSHTIVKQADVKTRSKLTQYFVTVAQHCKELNNFSSMTAIVSALYSSPIY 1410

Query: 1310 KFTDAWRLI--EPGDLLTWEELKKIPSLDRNYSTIRNLLNSVNPLVGCVPFIVVYLSDLS 1367
            +    W L+  E  DLL  + L  +    RN+   R LL SV   V CVPF  VYLSDL+
Sbjct: 1411 RLKKTWDLVSTESKDLL--KNLNNLMDSKRNFVKYRELLRSVTD-VACVPFFGVYLSDLT 1467

>Sklu_2189.4 YLR310C, Contig c2189 8340-12920
          Length = 1526

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 62/208 (29%), Positives = 94/208 (45%), Gaps = 13/208 (6%)

Query: 1190 ILMYDSLSVAQQMTLIEKEILGEIDWKDLLDLKMKHEGPQVISWLQLLVRNETLSGIDLA 1249
            +L  DSL  A+Q+T+ E  +  +I   + LD           +W            I   
Sbjct: 1239 LLDIDSLDYAKQLTIKEHSLFYKISPFECLDR----------TWGNKYCNMGGSKNITEF 1288

Query: 1250 ISRFNLTVDWIISEILLTKSSKMKRNVIQRFIHVADHCRTFQNFNTLMEIILALSSSVVQ 1309
            IS  N   +++   I+     K +  +IQ FI+VA HC    NF++L  II AL SS + 
Sbjct: 1289 ISNSNHLTNYVSFMIVKQTDIKKRIQLIQFFINVAAHCHELNNFSSLTAIISALYSSPIY 1348

Query: 1310 KFTDAWRLIEPGDLLTWEELKKIPSLDRNYSTIRNLLNSVNPLVGCVPFIVVYLSDLSAN 1369
            +    W  +        EEL  +    +N+   R LL S+     CVPF  VYLSDL+  
Sbjct: 1349 RLKRTWAAVPEEYKKLLEELNTLMDSAKNFIRYRQLLKSIGDF-PCVPFFGVYLSDLTFT 1407

Query: 1370 AEKK-DWILEDKV-VNYNKFDTNVQIVK 1395
            A    D++  + V VN+ K    ++I+K
Sbjct: 1408 ANGNPDFLHRNTVLVNFGKRVRILEILK 1435

>Scas_621.1*
          Length = 1323

 Score = 71.2 bits (173), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 60/219 (27%), Positives = 106/219 (48%), Gaps = 25/219 (11%)

Query: 1197 SVAQQMTLIEKEILGEIDWKDLLD--LKMKHEGPQVISWLQLLVRNETLSG---IDLAIS 1251
            ++AQQ++L+E E+  +I   + L+     K+ G                 G   I + I+
Sbjct: 1086 TMAQQLSLLEHELYCQITIFECLERVWGKKYGG---------------FGGSPNITIFIN 1130

Query: 1252 RFNLTVDWIISEILLTKSSKMKRNVIQRFIHVADHCRTFQNFNTLMEIILALSSSVVQKF 1311
              N   +++   I+   +   +  +I  FI VA +CR   NF+++  II AL SS V + 
Sbjct: 1131 GANNLTNFVSYTIVSNANISRRIQIITYFIAVAQYCRDINNFSSMTAIISALYSSPVYRL 1190

Query: 1312 TDAWRLIEPGDLLTWEELKKIPSLDRNYSTIRNLLNSVNPLVGCVPFIVVYLSDLS-ANA 1370
               W L+         EL  +    +N+   R LL SV  +V CVPF  VYLSDL+ A+ 
Sbjct: 1191 KKTWHLVPESSKALLRELNTLMDSTKNFIRYRQLLKSVRQVV-CVPFFGVYLSDLTFAHT 1249

Query: 1371 EKKDWI-LEDKVVNYNKFDTNVQIVKNFI--QRVQWSKF 1406
               D++    +++N++K    V+I++  I  +++ ++ F
Sbjct: 1250 GNPDFLSGSTELINFSKRAKVVEIIEEVINFKKLHYTSF 1288

>KLLA0D09306g 783852..788465 weakly similar to sp|P04821 Saccharomyces
            cerevisiae YLR310c CDC25 GDP/GTP exchange factor for
            RAS1P and RAS2P, hypothetical start
          Length = 1537

 Score = 69.3 bits (168), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 53/182 (29%), Positives = 88/182 (48%), Gaps = 19/182 (10%)

Query: 1193 YDSLSVAQQMTLIEKEILGEIDWKDLLDLKMKHEGPQVISWLQLLVRNETLSGIDLAISR 1252
            +D ++ AQQ+TL E  +   ID  + LD   +  G +V  +           G    IS 
Sbjct: 1266 FDPITFAQQLTLEEHILYSAIDQFECLD---RIWGKKVCDF-----------GGSANISN 1311

Query: 1253 F----NLTVDWIISEILLTKSSKMKRNVIQRFIHVADHCRTFQNFNTLMEIILALSSSVV 1308
            F    N   D++   I+     K +  ++Q FI V++ C   +NF+++  I+ AL SS +
Sbjct: 1312 FITSSNHLTDFVSYTIVKETDLKKRAQILQFFIQVSEQCYNLKNFSSMTAIVSALYSSPI 1371

Query: 1309 QKFTDAWRLIEPGDLLTWEELKKIPSLDRNYSTIRNLLNSVNPLVGCVPFIVVYLSDLSA 1368
             +    +  +    L + ++L  +    RN+   R+LL +V+  V CVPF  VYLSDL+ 
Sbjct: 1372 FRLKKTFDRLPKHILNSLDKLNTLMDSTRNFFRYRDLLKTVHD-VPCVPFFGVYLSDLTF 1430

Query: 1369 NA 1370
             A
Sbjct: 1431 TA 1432

>ADL038W [1703] [Homologous to ScYLR310C (CDC25 ) - SH; ScYLL016W -
            SH] complement(623312..627841) [4530 bp, 1509 aa]
          Length = 1509

 Score = 63.9 bits (154), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 42/145 (28%), Positives = 71/145 (48%), Gaps = 7/145 (4%)

Query: 1265 LLTKSSKMKRNV--IQRFIHVADHCRTFQNFNTLMEIILALSSSVVQKFTDAWRLIEPGD 1322
            ++ K + +KR V  +Q FI VA+ CR   NF+++  I  A+ SS + +    W ++    
Sbjct: 1291 MIVKQTDLKRRVQIVQYFIDVAETCRALNNFSSMTAITSAMLSSSIYRLKRTWAMVHDNY 1350

Query: 1323 LLTWEELKKIPSLDRNYSTIRNLLNSVNPLVGCVPFIVVYLSDLSANAEKKDWILED--K 1380
              + + +  +    +N+   R LL S+     CVPF  VYLSDL+  A      L+    
Sbjct: 1351 KESLDRMNALMDSAKNFRKYRELLESLGD-CPCVPFFGVYLSDLTFTAGGNPDYLKGTTG 1409

Query: 1381 VVNYNKFDTNVQIVKNF--IQRVQW 1403
            V+N+ K    V ++K     QR+ +
Sbjct: 1410 VINFAKRARIVNVLKEIDSYQRISY 1434

>Scas_604.15
          Length = 1676

 Score = 60.8 bits (146), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 59/214 (27%), Positives = 95/214 (44%), Gaps = 19/214 (8%)

Query: 1190 ILMYDSLSVAQQMTLIEKEILGEIDWKDLLDLKMKHEGPQVISWLQLLVRNETLSGIDLA 1249
            +L  D    AQQ+T+ E E+  EI   + LD           +W            I   
Sbjct: 1365 LLDIDPYVYAQQLTIREHELYLEITMFECLDR----------AWGSKYCNMGGSRNISKF 1414

Query: 1250 ISRFNLTVDWIISEILLTKSSKMKRNVIQRFIHVADHCRTFQNFNTLMEIILALSSSVVQ 1309
            I   N   +++   I+     K +  +IQ FI VA+HC+   NF+++  I+ AL SS + 
Sbjct: 1415 IMNANSLTNFVSYTIVRHMDVKKRSKLIQYFITVAEHCKDLNNFSSMTAIVSALYSSPIF 1474

Query: 1310 KFTDAWRLIEPGDLLTWEELKKIPSL---DRNYSTIRNLLNSVNPLVGCVPFIVVYLSDL 1366
            +    W  I P ++   + LKK+ SL    RN+   R  L  V   V  +PF  +YLSDL
Sbjct: 1475 RLKKTWSKI-PVEIK--KSLKKLNSLMDSKRNFIKYRESLKLVKD-VPRIPFFGIYLSDL 1530

Query: 1367 SANAEKKDWILEDK--VVNYNKFDTNVQIVKNFI 1398
            +         L     ++N++K    V I+++ +
Sbjct: 1531 TFTFVGNPEFLHGTTDIINFSKRSRIVDIIEDIL 1564

>CAGL0D06512g complement(617453..621379) some similarities with
            sp|P04821 Saccharomyces cerevisiae YLR310c CDC25 or
            sp|P14771 Saccharomyces cerevisiae YLL016w SDC25,
            hypothetical start
          Length = 1308

 Score = 55.1 bits (131), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 54/196 (27%), Positives = 85/196 (43%), Gaps = 19/196 (9%)

Query: 1173 IHDSRLMISNNESHVPFILMYDSLSVAQQMTLIEKEILGEIDWKDLLDLKMKHEGPQVIS 1232
            +HD++   +  ES    IL   + +VAQQ+ LIE+ +  +I   D LD            
Sbjct: 975  VHDAKFTANVYES----ILDIPAENVAQQLALIEENLYEKITIFDCLDR----------V 1020

Query: 1233 WLQLLVRNETLSGIDLAISRFNLTVDWIISEILLTKSSKMKRNVIQRFIHVADHCRTFQN 1292
            W            I   IS  N    ++  +IL   ++  +   I  FI VA       N
Sbjct: 1021 WGCKQCDFGGSKNISEFISFANSITKYVSYKILQYDTAAKRGQAIGYFIKVARISYEINN 1080

Query: 1293 FNTLMEIILALSSSVVQKFTDAWRLIEPGDLLTWEELKKIPSLDRNYSTIRNLLNSVN-- 1350
            F+++  II  + +S V +  ++W+L+      T  EL  +    +N+   R  L +V   
Sbjct: 1081 FSSMTAIISGIYASPVNRLHESWKLVSRELQNTLRELDDLMISTKNFLKYRLTLKNVGNR 1140

Query: 1351 PLVGCVPFIVVYLSDL 1366
            P   C+PF  VYLSDL
Sbjct: 1141 P---CIPFFGVYLSDL 1153

>KLLA0C03410g 303739..307821 weakly similar to ca|CA0382|IPF16030
            Candida albicans, hypothetical start
          Length = 1360

 Score = 54.3 bits (129), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 52/212 (24%), Positives = 97/212 (45%), Gaps = 30/212 (14%)

Query: 1196 LSVAQQMTLIEKEILGEIDWKDLLDLKMKHEGPQVISWLQLLVRNETLSGIDLAISRFNL 1255
            L V++Q++LIE  I  +I   +LL  K   + P        L ++  ++ I   I+  NL
Sbjct: 1074 LEVSKQISLIESTIFLKITPPELLKCKYSSKNPD-------LSKSPNVNSI---ITLTNL 1123

Query: 1256 TVDWIISEILLTKSSKMKRNV-IQRFIHVADHCRTFQNFNTLMEIILALSSSVVQKFTDA 1314
              ++++  IL+      KR + I+ ++ +A     F+NFN L  I+  L S V+ + +  
Sbjct: 1124 LSNYVLESILMPGIPLKKRALRIKSWLRIALSSLYFRNFNALASIMTTLQSYVISRLSML 1183

Query: 1315 WRLIEPGDLLTWEELKKIPSLDRNYSTIRNLLNSV-------------NPLVGCVPFIVV 1361
            W ++   D+  +E L KI   + NY   R  +  +               ++  VPF  +
Sbjct: 1184 WGMLSNEDVELFEYLSKIIHPNNNYKVYRKKIEKLVTESSSSSGLLSSKSVLPVVPFFNL 1243

Query: 1362 YLSDLS------ANAEKKDWILEDKVVNYNKF 1387
            +L DL+       N +  D    +K++N +K+
Sbjct: 1244 FLQDLTFIDEGNPNFKNPDSFRPNKLINIDKY 1275

>Kwal_33.13598
          Length = 1412

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 55/221 (24%), Positives = 100/221 (45%), Gaps = 35/221 (15%)

Query: 1196 LSVAQQMTLIEKEILGEIDWKDLLDLKMKHEGPQVISWLQLLVRNETLSG---IDLAISR 1252
            L VA+Q++LIE  +   +             GP  +     + + + LS    ++  I  
Sbjct: 1124 LEVAKQLSLIESTLYLAV-------------GPGELMNQNFIPKKKHLSASPDVERIIDF 1170

Query: 1253 FNLTVDWIISEILLTKSS-KMKRNVIQRFIHVADHCRTFQNFNTLMEIILALSSSVVQKF 1311
             NL  +++I  I+ +K + K++ + +  ++++A     F+NFNT+  I+ AL S ++ + 
Sbjct: 1171 ANLLSNYVIESIVASKLTLKVRASRLTAWLNIALSALYFRNFNTVATIMTALQSHILSRV 1230

Query: 1312 TDAWRLIEPGDLLTWEELKKIPSLDRNYSTIRNLLNSVN-----PLVG-------CVPFI 1359
               W  I    L  ++ L KI   D+NYS  R  L  +      P  G        VPF 
Sbjct: 1231 ELVWENISEKYLELYKYLSKIIHPDKNYSIYRLKLRELATGFSIPESGGNRSPIPIVPFF 1290

Query: 1360 VVYLSDLSANAEK-KDW-----ILEDKVVNYNKFDTNVQIV 1394
             ++L DL+   E   D+        +K++N +KF    +I+
Sbjct: 1291 ALFLQDLTFIHEGIHDFRDPSSFRPNKLINIDKFFRTTKII 1331

>CAGL0B01287g 114832..118575 similar to KLLA0C03410g Kluyveromyces
            lactis, hypothetical start
          Length = 1247

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 49/226 (21%), Positives = 103/226 (45%), Gaps = 37/226 (16%)

Query: 1190 ILMYDSLSVAQQMTLIEKEILGEIDWKDLLDLKMKHEGPQVISWLQLLVRNETLSGIDLA 1249
            +++ + L VA+Q+T++E  +   +   D+++ K                 N T++  ++A
Sbjct: 961  LVILNPLEVAKQLTILESLLFMRLTPFDIVNYKA----------------NSTITSSNVA 1004

Query: 1250 -ISRF-NLTVDWIISEILLTKSSKMKRN-VIQRFIHVADHCRTFQNFNTLMEIILALSSS 1306
             I+ F N    ++++ IL  + +   R  +++ ++ +A      +NFN++  I+ A+ + 
Sbjct: 1005 AITSFTNQLSQYVMNGILTPRINDATRTTILKAWLRIALSALYLRNFNSVASIMTAIQNH 1064

Query: 1307 VVQKFTDAWRLIEPGDLLTWEELKKIPSLDRNYSTIRNLL---------NSVNPL---VG 1354
             + + T  W+ +   D L +E L +I   + N+   R  L          S+ P+   V 
Sbjct: 1065 SITRLTGVWQQLSRKDTLLYEYLSRIIHPNHNFKVYRQKLKKIIDDSSQGSIIPVKSHVP 1124

Query: 1355 CVPFIVVYLSDLSANAEKK------DWILEDKVVNYNKFDTNVQIV 1394
             VPF  ++L D++   E        D    +K +N +KF    +IV
Sbjct: 1125 VVPFFNLFLQDITFIHEGNSTFRNPDSFRPNKPINVDKFYRITKIV 1170

>Scas_476.2
          Length = 1330

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 50/218 (22%), Positives = 101/218 (46%), Gaps = 31/218 (14%)

Query: 1190 ILMYDSLSVAQQMTLIEKEILGEIDWKDLLDLKMKHEGPQVISWLQLLVRNETLS-GIDL 1248
            ++ +++L  A+Q+TL+E  +  E+   +L++     +        +LL     LS  I+ 
Sbjct: 1040 LVSFNALEAAKQLTLLESTLYMEVQPFELINENFLQKK-------KLL----NLSPNINA 1088

Query: 1249 AISRFNLTVDWIISEILLTKSSKMKR-NVIQRFIHVADHCRTFQNFNTLMEIILALSSSV 1307
             ++  N   ++++  IL    S  KR + ++ ++ +A     F+N+N+L  I++AL S  
Sbjct: 1089 TLNFTNQFTNYVLESILTPNLSIPKRCSRLKGWLRIALSTLYFRNYNSLASIMIALQSHS 1148

Query: 1308 VQKFTDAWRLIEPGDLLTWEELKKIPSLDRNYSTIRNLL------NSVNPL------VGC 1355
            + +    W  +   D+  ++ L +I   + NY   R  L      N+  PL      +  
Sbjct: 1149 LSRLYFLWEDLTEKDIKLYDFLCQIIHPNNNYRVYREKLRILKSGNNQAPLSLSKSPLPI 1208

Query: 1356 VPFIVVYLSDLS------ANAEKKDWILEDKVVNYNKF 1387
            VPF  ++L DL+       +    D    +K++N +KF
Sbjct: 1209 VPFFNLFLQDLTFINEGLPDYRNPDSFRPNKIINMDKF 1246

>Sklu_2300.3 YCR038C, Contig c2300 4973-6405 reverse complement
          Length = 478

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 40/152 (26%), Positives = 70/152 (46%), Gaps = 11/152 (7%)

Query: 1196 LSVAQQMTLIEKEILGEIDWKDLLDLKMKHEGPQVISWLQLLVRNETLSGIDLAISRFNL 1255
            L V++Q++LIE ++   I   +LL     HE     +++         S +   +S  NL
Sbjct: 303  LEVSKQLSLIESKLFLSITASELL-----HE-----NFMPKKAHLHQASNVGAILSFTNL 352

Query: 1256 TVDWIISEILLTKSSKMKR-NVIQRFIHVADHCRTFQNFNTLMEIILALSSSVVQKFTDA 1314
               +++  I+       KR   ++ ++ +A     F+NFN++  I+ AL S VV + +  
Sbjct: 353  LSRYVVESIVGPGFGPKKRTGRLRSWMKIALSALYFRNFNSVAAIMTALQSHVVSRLSPL 412

Query: 1315 WRLIEPGDLLTWEELKKIPSLDRNYSTIRNLL 1346
            W  +   D   +E L KI   + NY   RN L
Sbjct: 413  WSSLSSKDTELFEYLSKIVHPNNNYKVYRNKL 444

>Scas_588.15
          Length = 542

 Score = 36.6 bits (83), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 39/124 (31%), Positives = 64/124 (51%), Gaps = 21/124 (16%)

Query: 857 KQTQNPQREFPNGTSVSETNRIR---LSIAPTIESVVSDLNS--ITTGS----TVETFET 907
           K +Q+ QR+   G S++  NR+    + +   ++  V++ N   IT  S    TVE+ ET
Sbjct: 173 KLSQSIQRDAAKGYSIANQNRLFDNIIDMRIKLQKAVTNANKLPITKESWNTYTVESKET 232

Query: 908 SRDLPVPHQ-------RIINLREEYQRG---NQDIISN-TSSLHELKTIDLSDSNNDLES 956
           ++ L    +       ++IN R+++QRG   NQDI SN  +SLH+ K     D N D ++
Sbjct: 233 TKLLNKSSELVNRVLGQLINFRKDFQRGDNINQDIDSNDETSLHDKKR-SFDDLNKDTDN 291

Query: 957 PSTH 960
              H
Sbjct: 292 LDEH 295

>AFR630C [3822] [Homologous to ScYCR038C (BUD5) - SH]
            (1582542..1586852) [4311 bp, 1436 aa]
          Length = 1436

 Score = 35.8 bits (81), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 52/249 (20%), Positives = 102/249 (40%), Gaps = 47/249 (18%)

Query: 1139 EGFTSSSPEKIDVSANVDVAVQAAQIQELIGQYRIHDSRLMISNNESHVPFILMYDSLSV 1198
            E     SP+K  ++A +      A+ + L+ +   H+ + +  N       I   + + V
Sbjct: 1105 ECLYGGSPQKSKLAAII------AKWENLVFE---HNKQSIFENFSQTTLNIAELNPIEV 1155

Query: 1199 AQQMTLIEKEIL-----GEIDWKDLLDLKMKHEGPQVISWLQLLVRNETLSGIDLAISRF 1253
            A+Q+TL+E  +       E+   DL D K   E  +  + L                  F
Sbjct: 1156 AKQLTLVESVMYLAIKPVELLTGDLCDRKRTDESSKARTILN-----------------F 1198

Query: 1254 NLTVDWIISEILLTKSSKMKRNV--IQRFIHVADHCRTFQNFNTLMEIILALSSSVVQKF 1311
               +   ++E ++    +++  V  ++ ++ +A     F+NFN++  I+ AL S  + + 
Sbjct: 1199 TNFLSQYVTESIIGPGFQLEARVDRLRGWLKIALSALYFRNFNSVASIMTALQSHAISRL 1258

Query: 1312 TDAWRLIEPGDLLTWEELKKIPSLDRNYSTIRNLLNSV-------------NPLVGCVPF 1358
            +  W  ++  D   +  L KI   + NY   R  LN +             +PL   VPF
Sbjct: 1259 SFIWESLDERDRDLFTYLSKIIHPNNNYKVYRIKLNKLAEDFVPTSLPTAKSPL-PVVPF 1317

Query: 1359 IVVYLSDLS 1367
              +++ DL+
Sbjct: 1318 FNLFIQDLT 1326

>Scas_707.3
          Length = 1598

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 22/91 (24%), Positives = 42/91 (46%), Gaps = 10/91 (10%)

Query: 101 LVRTFVLLRHSILNYFVQDFLPNITLR--LRLIEFLNDKHIEQYPKIISSCIINLKKNWV 158
           + R F   ++    + V ++LP   L   ++++ +L D+ ++QY   I   + ++ +NW+
Sbjct: 760 VARLFATFQNKENLFLVMEYLPGGDLATLIKMMGYLPDQWVKQYLTEIIVGVDDMHRNWI 819

Query: 159 HCSKLVWENIELNEPDKLDFDAWLHYSLKDF 189
               L        +PD L  D   H  L DF
Sbjct: 820 IHHDL--------KPDNLLIDNLGHVKLTDF 842

>KLLA0D11374g complement(975206..976003) similar to sp|P32496
            Saccharomyces cerevisiae YFR052w NIN1 26S proteasome
            regulatory subunit singleton, start by similarity
          Length = 265

 Score = 31.2 bits (69), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 26/124 (20%), Positives = 56/124 (45%), Gaps = 5/124 (4%)

Query: 1044 IANMLDDSINDDPITVALMKLEGTYEKIPEKPENTKSSDAIGIKTSKLADEV-EMLNLNN 1102
            + N+ + S    P+ +  + +EG+Y+K  +  +     +   + T  L + + E + LN+
Sbjct: 135  VTNLEESSYLSYPVKLERLLMEGSYQKAWDLLQTGSKVEEFNVFTKTLKEAIREEIALNS 194

Query: 1103 LPSFQNSPAEKRKSLLIERRRQTIMNIPFTPDQSEKEGFTS----SSPEKIDVSANVDVA 1158
              ++ + P    K+LL     + +       D S   G  +    S+P++I+    VD+A
Sbjct: 195  EQAYSSLPLFNAKTLLFFENEKEMEAFAKERDWSVNHGVITFGNDSTPDRIESGDTVDMA 254

Query: 1159 VQAA 1162
            +  A
Sbjct: 255  IDYA 258

>YDR372C (VPS74) [1198] chr4 complement(1221100..1222137) Protein
            involved in apical bud growth and Prc1p trafficking
            pathway, has high similarity to uncharacterized C.
            albicans Orf6.3965p [1038 bp, 345 aa]
          Length = 345

 Score = 31.2 bits (69), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 42/92 (45%), Gaps = 12/92 (13%)

Query: 1017 TSSARNTRRANSE--SAFTGSLNKKNLNEIANMLDDSINDDPITVALMKLEGTYEKIPEK 1074
            T   R   RA+S   S+   S N    ++IAN+  D  +D+          GT +KI   
Sbjct: 3    TLQRRRVNRADSGDTSSIHSSANNTKGDKIANIAVDGDDDN----------GTNKKIAYD 52

Query: 1075 PENTKSSDAIGIKTSKLADEVEMLNLNNLPSF 1106
            PE +K  D I I T  L +EV ++ L +   +
Sbjct: 53   PEESKLRDNINIPTLTLMEEVLLMGLRDREGY 84

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.313    0.129    0.359 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 45,269,836
Number of extensions: 2029520
Number of successful extensions: 8081
Number of sequences better than 10.0: 202
Number of HSP's gapped: 8404
Number of HSP's successfully gapped: 221
Length of query: 1409
Length of database: 16,596,109
Length adjustment: 114
Effective length of query: 1295
Effective length of database: 12,649,657
Effective search space: 16381305815
Effective search space used: 16381305815
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 68 (30.8 bits)