Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YAL023C (PMT2)75974639230.0
Kwal_26.710574072830020.0
Scas_505.275270729620.0
KLLA0F15829g74170329380.0
CAGL0J08734g74270629000.0
ACR290W75574427110.0
YOR321W (PMT3)75370526500.0
Scas_643.2476971726150.0
CAGL0F00759g73470221530.0
Kwal_33.1547175572018060.0
KLLA0F21978g75772217430.0
YGR199W (PMT6)75976216890.0
CAGL0K00979g73072916290.0
CAGL0L07216g8587089711e-119
Scas_408.1*3913849071e-115
YDL095W (PMT1)8176959261e-113
KLLA0E01342g8386999191e-112
Kwal_23.36238766918881e-107
ADR279C8176938741e-105
YDL093W (PMT5)7436747941e-94
KLLA0B03762g7727057612e-89
CAGL0M00220g7656527374e-86
Scas_442.13093056814e-83
ABL085W7577227155e-83
YJR143C (PMT4)7627047016e-81
Scas_710.19196627009e-80
Scas_719.807627176752e-77
Kwal_47.167347927026721e-76
CAGL0L07172g7776435383e-58
Scas_30.11281104091e-46
Sklu_2215.66536734417e-46
Scas_329.12732123763e-40
AAL050W6573643566e-35
Scas_588.77266292678e-24
Kwal_33.143576574312651e-23
YDR307W6623772105e-17
KLLA0C14828g6294951901e-14
Scas_710.0d2711481371e-08
YOR220W26572665.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YAL023C
         (746 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YAL023C (PMT2) [45] chr1 complement(106275..108554) Mannosyltran...  1515   0.0  
Kwal_26.7105                                                         1160   0.0  
Scas_505.2                                                           1145   0.0  
KLLA0F15829g complement(1464112..1466337) similar to sp|P31382 S...  1136   0.0  
CAGL0J08734g 860389..862617 highly similar to sp|P31382 Saccharo...  1121   0.0  
ACR290W [1337] [Homologous to ScYAL023C (PMT2) - SH; ScYOR321W (...  1048   0.0  
YOR321W (PMT3) [5103] chr15 (916025..918286) Mannosyltransferase...  1025   0.0  
Scas_643.24                                                          1011   0.0  
CAGL0F00759g complement(85452..87656) similar to sp|P31382 Sacch...   833   0.0  
Kwal_33.15471                                                         700   0.0  
KLLA0F21978g 2042656..2044929 similar to sp|P42934 Saccharomyces...   676   0.0  
YGR199W (PMT6) [2149] chr7 (897505..899784) Protein with similar...   655   0.0  
CAGL0K00979g complement(97306..99498) similar to sp|P42934 Sacch...   632   0.0  
CAGL0L07216g complement(799529..802105) similar to sp|P33775 Sac...   378   e-119
Scas_408.1*                                                           353   e-115
YDL095W (PMT1) [773] chr4 (287059..289512) Mannosyltransferase (...   361   e-113
KLLA0E01342g complement(134691..137207) similar to sp|P33775 Sac...   358   e-112
Kwal_23.3623                                                          346   e-107
ADR279C [2020] [Homologous to ScYDL095W (PMT1) - SH; ScYDL093W (...   341   e-105
YDL093W (PMT5) [774] chr4 (289909..292140) Member of the PMT O-m...   310   1e-94
KLLA0B03762g 339424..341742 similar to sp|P46971 Saccharomyces c...   297   2e-89
CAGL0M00220g 28137..30434 similar to sp|P46971 Saccharomyces cer...   288   4e-86
Scas_442.1                                                            266   4e-83
ABL085W [507] [Homologous to ScYJR143C (PMT4) - SH] complement(2...   280   5e-83
YJR143C (PMT4) [3035] chr10 complement(698241..700529) Mannosylt...   274   6e-81
Scas_710.1                                                            274   9e-80
Scas_719.80                                                           264   2e-77
Kwal_47.16734                                                         263   1e-76
CAGL0L07172g complement(796354..798687) similar to sp|P33775 Sac...   211   3e-58
Scas_30.1                                                             162   1e-46
Sklu_2215.6 YDR307W, Contig c2215 9395-11356 reverse complement       174   7e-46
Scas_329.1                                                            149   3e-40
AAL050W [137] [Homologous to ScYDR307W - SH] complement(256490.....   141   6e-35
Scas_588.7                                                            107   8e-24
Kwal_33.14357                                                         106   1e-23
YDR307W (YDR307W) [1135] chr4 (1075857..1077845) Protein contain...    86   5e-17
KLLA0C14828g complement(1292713..1294602) weakly similar to sp|Q...    78   1e-14
Scas_710.0d                                                            57   1e-08
YOR220W (YOR220W) [5012] chr15 (755328..756125) Protein of unkno...    30   5.6  

>YAL023C (PMT2) [45] chr1 complement(106275..108554)
           Mannosyltransferase (dolichyl
           phosphate-D-mannose:protein O-D-mannosyltransferase),
           responsible for initiation of O-glycosylation [2280 bp,
           759 aa]
          Length = 759

 Score = 1515 bits (3923), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 728/746 (97%), Positives = 728/746 (97%)

Query: 1   MXXXXXTGYSKNNAAHIKQENTLRQRXXXXXXXXXXXXXADERDAEDFSKEKPAAQSSLL 60
           M     TGYSKNNAAHIKQENTLRQR             ADERDAEDFSKEKPAAQSSLL
Sbjct: 1   MSSSSSTGYSKNNAAHIKQENTLRQRESSSISVSEELSSADERDAEDFSKEKPAAQSSLL 60

Query: 61  RLESVVMPVIFTALALFTRMYKIGINNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKML 120
           RLESVVMPVIFTALALFTRMYKIGINNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKML
Sbjct: 61  RLESVVMPVIFTALALFTRMYKIGINNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKML 120

Query: 121 VGLSGYLAGYNGSWDFPSGEIYPDYLDYVKMRLFNASFSALCVPLAYFTAKAIGFSLPTV 180
           VGLSGYLAGYNGSWDFPSGEIYPDYLDYVKMRLFNASFSALCVPLAYFTAKAIGFSLPTV
Sbjct: 121 VGLSGYLAGYNGSWDFPSGEIYPDYLDYVKMRLFNASFSALCVPLAYFTAKAIGFSLPTV 180

Query: 181 WLMTVLVLFENSYSTLGRFILLDSMLLFFTVASFFSFVMFHNQRSKPFSRKWWKWLLITG 240
           WLMTVLVLFENSYSTLGRFILLDSMLLFFTVASFFSFVMFHNQRSKPFSRKWWKWLLITG
Sbjct: 181 WLMTVLVLFENSYSTLGRFILLDSMLLFFTVASFFSFVMFHNQRSKPFSRKWWKWLLITG 240

Query: 241 ISLGCTISVKMVGLFIITMVGIYTVIDLWTFLADKSMSWKTYINHWLARIFGLIIVPFCI 300
           ISLGCTISVKMVGLFIITMVGIYTVIDLWTFLADKSMSWKTYINHWLARIFGLIIVPFCI
Sbjct: 241 ISLGCTISVKMVGLFIITMVGIYTVIDLWTFLADKSMSWKTYINHWLARIFGLIIVPFCI 300

Query: 301 FLLCFKIHFDLLSHSGTGDANMPSLFQARLVGSDVGQGPRDIALGSSVVSIKNQALGGSL 360
           FLLCFKIHFDLLSHSGTGDANMPSLFQARLVGSDVGQGPRDIALGSSVVSIKNQALGGSL
Sbjct: 301 FLLCFKIHFDLLSHSGTGDANMPSLFQARLVGSDVGQGPRDIALGSSVVSIKNQALGGSL 360

Query: 361 LHSHIQTYPDGSNQQQVTCYGYKDANNEWFFNRERGLPSWSENETDIEYLKPGTSYRLVH 420
           LHSHIQTYPDGSNQQQVTCYGYKDANNEWFFNRERGLPSWSENETDIEYLKPGTSYRLVH
Sbjct: 361 LHSHIQTYPDGSNQQQVTCYGYKDANNEWFFNRERGLPSWSENETDIEYLKPGTSYRLVH 420

Query: 421 KSTGRNLHTHPVAAPVSKTQWEVSGYGDNVVGDNKDNWVIEIMDQRGDEDPEKLHTLTTS 480
           KSTGRNLHTHPVAAPVSKTQWEVSGYGDNVVGDNKDNWVIEIMDQRGDEDPEKLHTLTTS
Sbjct: 421 KSTGRNLHTHPVAAPVSKTQWEVSGYGDNVVGDNKDNWVIEIMDQRGDEDPEKLHTLTTS 480

Query: 481 FRIKNLEMGCYLAQTGNSLPEWGFRQQEVVCMKNPFKRDKRTWWNIETHENERLPPRPED 540
           FRIKNLEMGCYLAQTGNSLPEWGFRQQEVVCMKNPFKRDKRTWWNIETHENERLPPRPED
Sbjct: 481 FRIKNLEMGCYLAQTGNSLPEWGFRQQEVVCMKNPFKRDKRTWWNIETHENERLPPRPED 540

Query: 541 FQYPKTNFLKDFIHLNLAMMATNNALVPDPDKFDYLASSAWQWPTLNVGLRLCGWGDDNP 600
           FQYPKTNFLKDFIHLNLAMMATNNALVPDPDKFDYLASSAWQWPTLNVGLRLCGWGDDNP
Sbjct: 541 FQYPKTNFLKDFIHLNLAMMATNNALVPDPDKFDYLASSAWQWPTLNVGLRLCGWGDDNP 600

Query: 601 KYFLLGTPASTWASSVAVLAFMATVVILLIRWQRQYVDLRNPSNWNVFLMGGFYPLLAWG 660
           KYFLLGTPASTWASSVAVLAFMATVVILLIRWQRQYVDLRNPSNWNVFLMGGFYPLLAWG
Sbjct: 601 KYFLLGTPASTWASSVAVLAFMATVVILLIRWQRQYVDLRNPSNWNVFLMGGFYPLLAWG 660

Query: 661 LHYMPFVIMSRVTYVHHYLPALYFALIILAYCFDAGLQKWSRSKCGRIMRFVLYAGFMAL 720
           LHYMPFVIMSRVTYVHHYLPALYFALIILAYCFDAGLQKWSRSKCGRIMRFVLYAGFMAL
Sbjct: 661 LHYMPFVIMSRVTYVHHYLPALYFALIILAYCFDAGLQKWSRSKCGRIMRFVLYAGFMAL 720

Query: 721 VIGCFWYFSPISFGMEGPSSNFRYLN 746
           VIGCFWYFSPISFGMEGPSSNFRYLN
Sbjct: 721 VIGCFWYFSPISFGMEGPSSNFRYLN 746

>Kwal_26.7105
          Length = 740

 Score = 1160 bits (3002), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 540/728 (74%), Positives = 626/728 (85%), Gaps = 6/728 (0%)

Query: 19  QENTLRQRXXXXXXXXXXXXXADERDAEDFSKEKPAAQSSLLRLESVVMPVIFTALALFT 78
            + TL+QR               + + +D  +EK    + LLRLES+ MP+IFTA+  FT
Sbjct: 11  SDGTLKQRKVTTVDEI------PDIEVDDRIEEKSVEVNPLLRLESIAMPMIFTAVGFFT 64

Query: 79  RMYKIGINNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYLAGYNGSWDFPS 138
           RMYKIG+NNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSG++AGYNGSWDFPS
Sbjct: 65  RMYKIGVNNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGWMAGYNGSWDFPS 124

Query: 139 GEIYPDYLDYVKMRLFNASFSALCVPLAYFTAKAIGFSLPTVWLMTVLVLFENSYSTLGR 198
           GE YPDYLDYVKMR+FNA+FSALC+PLAYFTAKAIGFSLPTVWL T+LV+FENSY+TLGR
Sbjct: 125 GEEYPDYLDYVKMRIFNATFSALCIPLAYFTAKAIGFSLPTVWLFTILVIFENSYATLGR 184

Query: 199 FILLDSMLLFFTVASFFSFVMFHNQRSKPFSRKWWKWLLITGISLGCTISVKMVGLFIIT 258
           FILLDSMLLFFTVAS F FV FHNQRSKPFSRKWWKWLL+TG+SLGCTISVKMVGLFIIT
Sbjct: 185 FILLDSMLLFFTVASMFCFVTFHNQRSKPFSRKWWKWLLLTGVSLGCTISVKMVGLFIIT 244

Query: 259 MVGIYTVIDLWTFLADKSMSWKTYINHWLARIFGLIIVPFCIFLLCFKIHFDLLSHSGTG 318
           +VGIYTVI+LWT L DK +S K Y  HWLARI  LIIVPF IFL CFK+HFDLLSHSGTG
Sbjct: 245 LVGIYTVIELWTLLGDKKVSKKAYAGHWLARILCLIIVPFLIFLACFKVHFDLLSHSGTG 304

Query: 319 DANMPSLFQARLVGSDVGQGPRDIALGSSVVSIKNQALGGSLLHSHIQTYPDGSNQQQVT 378
           DANMPSLFQA L GSDVG GPRDIA+GSS+VSIKNQALGGSLLHSH+Q YP+GSNQQQVT
Sbjct: 305 DANMPSLFQAGLAGSDVGDGPRDIAVGSSIVSIKNQALGGSLLHSHVQGYPEGSNQQQVT 364

Query: 379 CYGYKDANNEWFFNRERGLPSWSENETDIEYLKPGTSYRLVHKSTGRNLHTHPVAAPVSK 438
           CYG+KD+NN W F+R R L  WSE ET+IE++KPG+SYRLVH +TG+NLHTHP+AAP++K
Sbjct: 365 CYGHKDSNNNWLFDRIRPLTPWSEEETEIEFVKPGSSYRLVHPNTGKNLHTHPIAAPITK 424

Query: 439 TQWEVSGYGDNVVGDNKDNWVIEIMDQRGDEDPEKLHTLTTSFRIKNLEMGCYLAQTGNS 498
           ++WEVSGYG   VGD KD+WV+E++ Q G ED  +LH LT+SFRIKN E+GCYLAQTG  
Sbjct: 425 SEWEVSGYGTAEVGDPKDHWVVEVVAQHGSEDESRLHPLTSSFRIKNAELGCYLAQTGAH 484

Query: 499 LPEWGFRQQEVVCMKNPFKRDKRTWWNIETHENERLPPRPEDFQYPKTNFLKDFIHLNLA 558
           LPEWGFRQ EV C+KNPFKRDKRTWWN+ETH NE+LP RP DF+YPK NF+K+FIHLNLA
Sbjct: 485 LPEWGFRQSEVACLKNPFKRDKRTWWNVETHTNEKLPGRPADFKYPKINFIKNFIHLNLA 544

Query: 559 MMATNNALVPDPDKFDYLASSAWQWPTLNVGLRLCGWGDDNPKYFLLGTPASTWASSVAV 618
           MMATNNALVPDPDK D LASSAWQWPTLNVG+RLCGWGDD  KYFL+G+PASTW S++AV
Sbjct: 545 MMATNNALVPDPDKLDNLASSAWQWPTLNVGIRLCGWGDDTVKYFLMGSPASTWLSTIAV 604

Query: 619 LAFMATVVILLIRWQRQYVDLRNPSNWNVFLMGGFYPLLAWGLHYMPFVIMSRVTYVHHY 678
           + FM  VV+LL+RWQRQY DL +  ++N+F+MGGFYPLL WGLHYMPFVIMSRVTYVHHY
Sbjct: 605 VGFMGLVVLLLLRWQRQYQDLSDAHDFNLFMMGGFYPLLGWGLHYMPFVIMSRVTYVHHY 664

Query: 679 LPALYFALIILAYCFDAGLQKWSRSKCGRIMRFVLYAGFMALVIGCFWYFSPISFGMEGP 738
           LPALYFAL+IL+Y F+AGL+  +++K G++ R ++Y  + A+VI  F+YFSPISFG+ GP
Sbjct: 665 LPALYFALLILSYLFEAGLKGLNKTKGGQLARTLIYVTYGAIVIYGFYYFSPISFGLSGP 724

Query: 739 SSNFRYLN 746
           SSN+ +LN
Sbjct: 725 SSNYAHLN 732

>Scas_505.2
          Length = 752

 Score = 1145 bits (2962), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 530/707 (74%), Positives = 608/707 (85%), Gaps = 4/707 (0%)

Query: 44  DAEDFSKE----KPAAQSSLLRLESVVMPVIFTALALFTRMYKIGINNHVVWDEAHFGKF 99
           + ED  KE    +    ++LLR+ES++MP++FT LA+F RMYKIGIN+HVVWDEAHFGKF
Sbjct: 34  EKEDLKKEIVSTEKKESNTLLRVESIIMPLVFTGLAIFIRMYKIGINDHVVWDEAHFGKF 93

Query: 100 GSYYLRHEFYHDVHPPLGKMLVGLSGYLAGYNGSWDFPSGEIYPDYLDYVKMRLFNASFS 159
           GSYYLRHEFYHDVHPPLGKMLVGLSGYLAGYNGS+DF SG  YPDY+DYVKMR+FNA+FS
Sbjct: 94  GSYYLRHEFYHDVHPPLGKMLVGLSGYLAGYNGSFDFSSGAEYPDYVDYVKMRIFNAAFS 153

Query: 160 ALCVPLAYFTAKAIGFSLPTVWLMTVLVLFENSYSTLGRFILLDSMLLFFTVASFFSFVM 219
           A+CVP+AYFTAKAIGFS+PTVWL T+ VLFENSY+TLG+FILLDSMLLFFTV S+  FV+
Sbjct: 154 AMCVPVAYFTAKAIGFSIPTVWLFTITVLFENSYTTLGKFILLDSMLLFFTVLSYMCFVI 213

Query: 220 FHNQRSKPFSRKWWKWLLITGISLGCTISVKMVGLFIITMVGIYTVIDLWTFLADKSMSW 279
           FHNQRSKPFSRKWWKW+L+TG+S+GC ISVKMVGLFIIT+VGIYT+IDLW FL DK+MSW
Sbjct: 214 FHNQRSKPFSRKWWKWMLLTGLSMGCAISVKMVGLFIITVVGIYTIIDLWNFLGDKTMSW 273

Query: 280 KTYINHWLARIFGLIIVPFCIFLLCFKIHFDLLSHSGTGDANMPSLFQARLVGSDVGQGP 339
           K YI HWLARI  LIIVPF +FL CFKIHFDLL+HSGTGDANM SLFQA L+GSDVG GP
Sbjct: 274 KAYIGHWLARIICLIIVPFLVFLACFKIHFDLLTHSGTGDANMSSLFQANLIGSDVGAGP 333

Query: 340 RDIALGSSVVSIKNQALGGSLLHSHIQTYPDGSNQQQVTCYGYKDANNEWFFNRERGLPS 399
           RD+A+GSS++SIKNQALGG+LLHSH   YP+GSNQQQVT Y YKDANNEWFF+R RG P 
Sbjct: 334 RDVAVGSSIISIKNQALGGALLHSHYNAYPEGSNQQQVTAYSYKDANNEWFFDRPRGEPF 393

Query: 400 WSENETDIEYLKPGTSYRLVHKSTGRNLHTHPVAAPVSKTQWEVSGYGDNVVGDNKDNWV 459
           + ENETDIEY+   + YRLVH  TG+NLHTHPV AP+S TQWEVSGYGD   GD++DNW+
Sbjct: 394 YHENETDIEYVLGDSQYRLVHHKTGKNLHTHPVRAPISSTQWEVSGYGDAEQGDSRDNWL 453

Query: 460 IEIMDQRGDEDPEKLHTLTTSFRIKNLEMGCYLAQTGNSLPEWGFRQQEVVCMKNPFKRD 519
           IEI+DQRGDED  KLH LTTSFRI N +M CYL+QTGN LPEWGF+Q EV C++NPF+RD
Sbjct: 454 IEIVDQRGDEDKTKLHPLTTSFRIYNPDMDCYLSQTGNHLPEWGFKQFEVACVQNPFRRD 513

Query: 520 KRTWWNIETHENERLPPRPEDFQYPKTNFLKDFIHLNLAMMATNNALVPDPDKFDYLASS 579
           KRTWWNIET+EN+ LPPRP DF++PKTNF KDFI LNLAMMATNNALVPDP+KFD LASS
Sbjct: 514 KRTWWNIETNENDVLPPRPADFKFPKTNFFKDFIQLNLAMMATNNALVPDPEKFDILASS 573

Query: 580 AWQWPTLNVGLRLCGWGDDNPKYFLLGTPASTWASSVAVLAFMATVVILLIRWQRQYVDL 639
           AWQWPTL  GLR+C WG+D  KYFLLGTPASTW SS+AV+  M  +V+LLIRWQRQY DL
Sbjct: 574 AWQWPTLYWGLRICSWGEDVVKYFLLGTPASTWGSSLAVVGLMVYIVVLLIRWQRQYSDL 633

Query: 640 RNPSNWNVFLMGGFYPLLAWGLHYMPFVIMSRVTYVHHYLPALYFALIILAYCFDAGLQK 699
           ++P + N F+MG FYPLLAWGLHY PFVIMSRVTYVHHYLPALYFALIILAY FDAGL+ 
Sbjct: 634 QDPKDLNTFMMGAFYPLLAWGLHYAPFVIMSRVTYVHHYLPALYFALIILAYVFDAGLKF 693

Query: 700 WSRSKCGRIMRFVLYAGFMALVIGCFWYFSPISFGMEGPSSNFRYLN 746
            +++K  +I+R V+Y      VIGCFWYFSPISFGM GP  N+ YLN
Sbjct: 694 LTKTKSTQILRIVIYLAAYVTVIGCFWYFSPISFGMVGPMENYSYLN 740

>KLLA0F15829g complement(1464112..1466337) similar to sp|P31382
           Saccharomyces cerevisiae YAL023c PMT2
           mannosyltransferase, start by similarity
          Length = 741

 Score = 1136 bits (2938), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 522/703 (74%), Positives = 606/703 (86%)

Query: 44  DAEDFSKEKPAAQSSLLRLESVVMPVIFTALALFTRMYKIGINNHVVWDEAHFGKFGSYY 103
           +AED SK+K   +S LL+LES++MP+IFT LA F RMYKIG N+HVVWDEAHFGKFGSYY
Sbjct: 30  EAEDLSKQKHVNESPLLKLESILMPIIFTGLAFFIRMYKIGANDHVVWDEAHFGKFGSYY 89

Query: 104 LRHEFYHDVHPPLGKMLVGLSGYLAGYNGSWDFPSGEIYPDYLDYVKMRLFNASFSALCV 163
           LRHEFYHDVHPPLGKMLVG SGYLAGYNGSWDFPSGE YP+Y+D+VKMRLFNA FSALCV
Sbjct: 90  LRHEFYHDVHPPLGKMLVGFSGYLAGYNGSWDFPSGEQYPEYIDFVKMRLFNALFSALCV 149

Query: 164 PLAYFTAKAIGFSLPTVWLMTVLVLFENSYSTLGRFILLDSMLLFFTVASFFSFVMFHNQ 223
           P+AYFTAK+IGFSLPTVWL T LVLFENSY+TLGRFILLDSMLLFFTV S F FV FHN 
Sbjct: 150 PVAYFTAKSIGFSLPTVWLFTTLVLFENSYTTLGRFILLDSMLLFFTVLSMFCFVKFHNV 209

Query: 224 RSKPFSRKWWKWLLITGISLGCTISVKMVGLFIITMVGIYTVIDLWTFLADKSMSWKTYI 283
           RSKPF++KWWKWL  TG SLGCTISVKMVGL IITMVGIYTV+DLW  LAD  MS K Y 
Sbjct: 210 RSKPFTKKWWKWLFYTGFSLGCTISVKMVGLLIITMVGIYTVVDLWNMLADTKMSKKVYA 269

Query: 284 NHWLARIFGLIIVPFCIFLLCFKIHFDLLSHSGTGDANMPSLFQARLVGSDVGQGPRDIA 343
            HW +R   LI+VPF +FL CFKIHFDLLSHSGTGDANMPSLFQA L+GSDVG+GPRD+A
Sbjct: 270 AHWASRFVFLILVPFAVFLACFKIHFDLLSHSGTGDANMPSLFQANLIGSDVGEGPRDVA 329

Query: 344 LGSSVVSIKNQALGGSLLHSHIQTYPDGSNQQQVTCYGYKDANNEWFFNRERGLPSWSEN 403
           LGSS ++IKNQALGG LLHSHIQTYP+GS QQQVT YG+KD+NN W F+R+R    + +N
Sbjct: 330 LGSSEITIKNQALGGGLLHSHIQTYPEGSQQQQVTTYGHKDSNNVWTFDRQRFSAPYDKN 389

Query: 404 ETDIEYLKPGTSYRLVHKSTGRNLHTHPVAAPVSKTQWEVSGYGDNVVGDNKDNWVIEIM 463
           ET+ E++  G  YRLVH +TGRNLHTHP  APV    WEVSGYGD  VGD KD+W+IEI+
Sbjct: 390 ETETEFVTDGARYRLVHLNTGRNLHTHPHRAPVQANAWEVSGYGDAKVGDPKDDWIIEIV 449

Query: 464 DQRGDEDPEKLHTLTTSFRIKNLEMGCYLAQTGNSLPEWGFRQQEVVCMKNPFKRDKRTW 523
           DQ+G ED  KLH LT+SFR+KN EMGCYL+QTGN+LP+WGFRQ EV C+KNPFKRDKRTW
Sbjct: 450 DQKGPEDETKLHPLTSSFRLKNAEMGCYLSQTGNTLPQWGFRQNEVACVKNPFKRDKRTW 509

Query: 524 WNIETHENERLPPRPEDFQYPKTNFLKDFIHLNLAMMATNNALVPDPDKFDYLASSAWQW 583
           WNIET+ NE+LPPRPE+F+YPKT+F+KDFIHLNLAMMATNNALVP+ +K D LASSAWQW
Sbjct: 510 WNIETNVNEKLPPRPENFKYPKTSFIKDFIHLNLAMMATNNALVPNAEKLDKLASSAWQW 569

Query: 584 PTLNVGLRLCGWGDDNPKYFLLGTPASTWASSVAVLAFMATVVILLIRWQRQYVDLRNPS 643
           PTLNVG+RLCGWG+ N KYFL+G+PASTW S++AVLAFM  V + LIRWQRQY DL NP 
Sbjct: 570 PTLNVGIRLCGWGEQNIKYFLIGSPASTWPSTIAVLAFMVLVAVYLIRWQRQYSDLTNPE 629

Query: 644 NWNVFLMGGFYPLLAWGLHYMPFVIMSRVTYVHHYLPALYFALIILAYCFDAGLQKWSRS 703
           + N+FLMGG YPLLAWGLH++PF+IMSRVTYVHHYLPALYFAL++LAY F+  ++KW++S
Sbjct: 630 DINLFLMGGIYPLLAWGLHFVPFIIMSRVTYVHHYLPALYFALLVLAYLFEISMKKWNKS 689

Query: 704 KCGRIMRFVLYAGFMALVIGCFWYFSPISFGMEGPSSNFRYLN 746
           KCG++MR+ +Y  +MA+VI  F+YF+PISFGM GPS+++ YLN
Sbjct: 690 KCGKVMRYTIYGSYMAIVIYGFYYFAPISFGMSGPSTDYEYLN 732

>CAGL0J08734g 860389..862617 highly similar to sp|P31382
           Saccharomyces cerevisiae YAL023c PMT2 or sp|P47190
           Saccharomyces cerevisiae YOR321w PMT3, hypothetical
           start
          Length = 742

 Score = 1121 bits (2900), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 525/706 (74%), Positives = 607/706 (85%), Gaps = 4/706 (0%)

Query: 43  RDAEDFSKEKPA--AQSSLLRLESVVMPVIFTALALFTRMYKIGINNHVVWDEAHFGKFG 100
            + ED SK K A  +QS LL+LE+ +MP++FT LALF RMY+IGIN +VVWDEAHFGKFG
Sbjct: 30  EEKEDTSKLKDAKVSQSPLLQLEAYLMPLVFTGLALFVRMYRIGINGNVVWDEAHFGKFG 89

Query: 101 SYYLRHEFYHDVHPPLGKMLVGLSGYLAGYNGSWDFPSGEIYPDYLDYVKMRLFNASFSA 160
           SYYLRHEFYHDVHPPLGKMLVGLSGYLAGYNGS+DF SG  YP+Y+D+VKMRLFNASFSA
Sbjct: 90  SYYLRHEFYHDVHPPLGKMLVGLSGYLAGYNGSFDFESGHEYPEYVDFVKMRLFNASFSA 149

Query: 161 LCVPLAYFTAKAIGFSLPTVWLMTVLVLFENSYSTLGRFILLDSMLLFFTVASFFSFVMF 220
           +CVPLAYFTAKAIGFSLP VWL T +VLFENSYSTLGRFILLDSMLLFFTVAS FSFVMF
Sbjct: 150 MCVPLAYFTAKAIGFSLPAVWLFTCMVLFENSYSTLGRFILLDSMLLFFTVASVFSFVMF 209

Query: 221 HNQRSKPFSRKWWKWLLITGISLGCTISVKMVGLFIITMVGIYTVIDLWTFLADKSMSWK 280
           HNQRS+PFSRKWWKWLL+TGI+LGCTISVKMVGLF+IT+VGIYTVIDL   L +K MSWK
Sbjct: 210 HNQRSRPFSRKWWKWLLLTGINLGCTISVKMVGLFVITLVGIYTVIDLLQMLNEKKMSWK 269

Query: 281 TYINHWLARIFGLIIVPFCIFLLCFKIHFDLLSHSGTGDANMPSLFQARLVGSDVGQGPR 340
           +Y  HWLARI  LI VP  +F++CFK+HFDLL HSGTGDANMPSLFQA LVGSDVG GPR
Sbjct: 270 SYTGHWLARIVALICVPMAVFMICFKLHFDLLWHSGTGDANMPSLFQAGLVGSDVGGGPR 329

Query: 341 DIALGSSVVSIKNQALGGSLLHSHIQTYPDGSNQQQVTCYGYKDANNEWFFNRERGLPSW 400
           D+A+GSS VSIKNQAL G+LLHSH+QTYP+GSNQQQVT Y YKDANN W F+R R    W
Sbjct: 330 DVAIGSS-VSIKNQALSGALLHSHVQTYPEGSNQQQVTAYSYKDANNNWVFHRVREESLW 388

Query: 401 SENETDIEYLKPGTSYRLVHKSTGRNLHTHPVAAPVSKTQWEVSGYGDNVVGDNKDNWVI 460
             NETDIEY+  G  YRLVH +T +NLHTH +AAPV K  WEVSGYG++ +GD KD WV+
Sbjct: 389 DINETDIEYVVDGAVYRLVHANTQKNLHTHSIAAPVDKKNWEVSGYGNHTIGDAKDYWVL 448

Query: 461 EIMDQRGDEDPEKLHTLTTSFRIKNLEMGCYLAQTGNSLPEWGFRQQEVVCMKNPFKRDK 520
           EI+DQ+G E+  ++H LTTSFR++N E+ CYLAQTGN LPEWGFRQ E+ C+K+PF+RDK
Sbjct: 449 EIVDQKGSENTTQVHPLTTSFRLRNKELDCYLAQTGNHLPEWGFRQHEISCVKDPFRRDK 508

Query: 521 RTWWNIETHENERLPPRPEDFQYPKTNFLKDFIHLNLAMMATNNALVPDPDKFDYLASSA 580
           RTWWN+E+HENE+LP  PE+F+YP + FLKDFIHLNLAMMATNNALVP+ DKFDYLASSA
Sbjct: 509 RTWWNVESHENEKLPT-PEEFKYPGSGFLKDFIHLNLAMMATNNALVPESDKFDYLASSA 567

Query: 581 WQWPTLNVGLRLCGWGDDNPKYFLLGTPASTWASSVAVLAFMATVVILLIRWQRQYVDLR 640
           W+WPTL+VGLRLCGWGD+NPKYFLLGTP +TWASSVAV++FM   V+LL+RWQRQY D  
Sbjct: 568 WEWPTLHVGLRLCGWGDNNPKYFLLGTPVTTWASSVAVISFMILFVVLLLRWQRQYNDFS 627

Query: 641 NPSNWNVFLMGGFYPLLAWGLHYMPFVIMSRVTYVHHYLPALYFALIILAYCFDAGLQKW 700
           N  ++N+FLMGGFYP+L WGLH++PFVIMSRVTYVHHYLPALYFALIIL Y  DA  ++W
Sbjct: 628 NKDDFNLFLMGGFYPILGWGLHFVPFVIMSRVTYVHHYLPALYFALIILTYIIDATTKRW 687

Query: 701 SRSKCGRIMRFVLYAGFMALVIGCFWYFSPISFGMEGPSSNFRYLN 746
            +SKCG IMR V++A  +A V+GCFWYFSPISFGM GP+ N+ YL 
Sbjct: 688 MKSKCGSIMRLVVFAISIASVVGCFWYFSPISFGMTGPAINYHYLK 733

>ACR290W [1337] [Homologous to ScYAL023C (PMT2) - SH; ScYOR321W
           (PMT3) - SH] complement(886525..888792) [2268 bp, 755
           aa]
          Length = 755

 Score = 1048 bits (2711), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 505/744 (67%), Positives = 595/744 (79%), Gaps = 9/744 (1%)

Query: 12  NNAAHIKQE--NTLRQRXXXXXXXXXXXXXADER---DAEDFSKEKPAAQ--SSLLRLES 64
           N A H + E   T  QR             A++      ED SK +   Q  + L +LE+
Sbjct: 4   NTAMHDRDEMSTTGYQRHEAGPANKRGKASAEDGAGVQEEDVSKLREVQQERNPLYKLEA 63

Query: 65  VVMPVIFTALALFTRMYKIGINNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLS 124
            VMPV+FT LAL+TRM+KIG NN VVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLS
Sbjct: 64  FVMPVLFTLLALYTRMHKIGANNRVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLS 123

Query: 125 GYLAGYNGSWDFPSGEIYPDYLDYVKMRLFNASFSALCVPLAYFTAKAIGFSLPTVWLMT 184
           GY+AGYNGSWDFPSGE YP+Y+DYVKMR+FNA FSA+C P+AYFT KAIGFSLPTVWL +
Sbjct: 124 GYIAGYNGSWDFPSGEEYPEYIDYVKMRMFNAVFSAMCAPVAYFTGKAIGFSLPTVWLFS 183

Query: 185 VLVLFENSYSTLGRFILLDSMLLFFTVASFFSFVMFHNQRSKPFSRKWWKWLLITGISLG 244
           +LV+FENSY+TLGRFILLDSMLLFFTV SF++FV+FHN+R +PF RKWWKWL   G+SLG
Sbjct: 184 ILVVFENSYATLGRFILLDSMLLFFTVCSFYTFVLFHNERHRPFGRKWWKWLFFLGVSLG 243

Query: 245 CTISVKMVGLFIITMVGIYTVIDLWTFLADKSMSWKTYINHWLARIFGLIIVPFCIFLLC 304
           CTISVKMVGLFII++VGIYTV+DLW  L++ +MS   +  H+ AR   LI+VPF +FL C
Sbjct: 244 CTISVKMVGLFIISVVGIYTVVDLWNKLSEPNMSVSRFAGHFSARALCLIVVPFMVFLFC 303

Query: 305 FKIHFDLLSHSGTGDANMPSLFQARLVGSDVGQGPRDIALGSSVVSIKNQALGGSLLHSH 364
           FK+HF+ LS SGTGDA MPSLFQA L GS VG GPRDIA+GSS+VSIKNQALGG+LLHSH
Sbjct: 304 FKLHFEFLSVSGTGDAMMPSLFQAGLSGSSVGIGPRDIAVGSSLVSIKNQALGGTLLHSH 363

Query: 365 IQTYPDGSNQQQVTCYGYKDANNEWFFNRERGLPSWSENETDIEYLKPGTSYRLVHKSTG 424
           +QTYP GS+QQQVT YG+ D+NN W F+R RGLP+WS NET+ E+++ G  YRLVH +TG
Sbjct: 364 VQTYPSGSSQQQVTTYGHNDSNNNWVFDRIRGLPAWSINETEHEFVQDGRPYRLVHANTG 423

Query: 425 RNLHTHPVAAPVSKTQWEVSGYGDNVVGDNKDNWVIEIMDQRGDEDPEKLHTLTTSFRIK 484
           RNLHTHP+ APVSKT WEVSGYGD  VGD KDNW+IE + Q  DED   LHT++TSFRIK
Sbjct: 424 RNLHTHPIPAPVSKTHWEVSGYGDAQVGDPKDNWIIEFVSQPSDEDKSVLHTISTSFRIK 483

Query: 485 NLEMGCYLAQTGNSLPEWGFRQQEVVCMKNPFKRDKRTWWNIETHENERLPPRPEDFQYP 544
           N+EMGCYLAQTG SLPEWGFRQ EV C+ NPFKRDKRTWWNIET+ NERLPP PEDF+YP
Sbjct: 484 NVEMGCYLAQTGPSLPEWGFRQGEVACISNPFKRDKRTWWNIETNVNERLPPMPEDFKYP 543

Query: 545 KTNFLKDFIHLNLAMMATNNALVPDPDKFDYLASSAWQWPTLNVGLRLCGWGDDNPKYFL 604
           KT+F KDF+HLNLAMMATNNALVPDPDK D LASSAWQWPTLNVG+RLC W DD  KYFL
Sbjct: 544 KTSFFKDFVHLNLAMMATNNALVPDPDKLDQLASSAWQWPTLNVGIRLCSWADDVRKYFL 603

Query: 605 LGTPASTWASSVAVLAFMATVVILLIRWQRQYVDLRNPSNWNVFLMGGFYPLLAWGLHYM 664
           +G+PASTW S+ AV  F    V  L++WQRQ V  +   + N+FLMGG YPLL WGLHY+
Sbjct: 604 IGSPASTWPSTAAVGVFCLITVYYLLKWQRQLVLFQASDDANIFLMGGIYPLLGWGLHYL 663

Query: 665 PFVIMSRVTYVHHYLPALYFALIILAYCFDAGLQKWSRSKCG--RIMRFVLYAGFMALVI 722
           PF +M RVTYVHHYLPALYFAL+ILAY F+A L+   +S+    +I+ +V+YA +   +I
Sbjct: 664 PFAVMGRVTYVHHYLPALYFALLILAYVFEASLRAARQSQKSYWKILVYVVYAVYYCTII 723

Query: 723 GCFWYFSPISFGMEGPSSNFRYLN 746
             F+YF PI+ GMEGPSSN+++LN
Sbjct: 724 CGFYYFYPITVGMEGPSSNYKHLN 747

>YOR321W (PMT3) [5103] chr15 (916025..918286) Mannosyltransferase
           (dolichyl phosphate-D-mannose:protein
           O-D-mannosyltransferase), involved in initiation of
           O-glycosylation [2262 bp, 753 aa]
          Length = 753

 Score = 1025 bits (2650), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 477/705 (67%), Positives = 580/705 (82%), Gaps = 4/705 (0%)

Query: 42  ERDAEDFSKEKPAAQSSLLRLESVVMPVIFTALALFTRMYKIGINNHVVWDEAHFGKFGS 101
           + DAE + K K   +S++  L+++VMP+IFT L +FTRMYKIG NNHVVWDEAHFGKFGS
Sbjct: 37  KDDAELYDKVK--NESAVSHLDTIVMPIIFTVLGMFTRMYKIGRNNHVVWDEAHFGKFGS 94

Query: 102 YYLRHEFYHDVHPPLGKMLVGLSGYLAGYNGSWDFPSGEIYPDYLDYVKMRLFNASFSAL 161
           YYLRHEFYHDVHPPLGKMLVGLSGYLAGYNGSWDFPSGE+YPDY+DYVKMRLF A FS+L
Sbjct: 95  YYLRHEFYHDVHPPLGKMLVGLSGYLAGYNGSWDFPSGEVYPDYIDYVKMRLFQAMFSSL 154

Query: 162 CVPLAYFTAKAIGFSLPTVWLMTVLVLFENSYSTLGRFILLDSMLLFFTVASFFSFVMFH 221
           CVPLAYFT +AIGFS  +VWL T+LV+FENSY+TLG+FILLDSMLLFFTV+S+F    FH
Sbjct: 155 CVPLAYFTGRAIGFSRLSVWLFTILVIFENSYATLGKFILLDSMLLFFTVSSYFCLAKFH 214

Query: 222 NQRSKPFSRKWWKWLLITGISLGCTISVKMVGLFIITMVGIYTVIDLWTFLADKSMSWKT 281
             R  PFS +WW WL +TG++LGC ISVKMVGLFII++VGIYT+ +LW  L+D+S+SWK 
Sbjct: 215 TMRKSPFSARWWLWLCLTGLNLGCAISVKMVGLFIISVVGIYTISELWNLLSDRSVSWKV 274

Query: 282 YINHWLARIFGLIIVPFCIFLLCFKIHFDLLSHSGTGDANMPSLFQARLVGSDVGQGPRD 341
           Y+NHWLARIFGLII+P C+FLLCFKIHFDLLS+SG GD+ MPSLFQA L G+ VG+GPRD
Sbjct: 275 YVNHWLARIFGLIIIPVCVFLLCFKIHFDLLSNSGPGDSTMPSLFQASLNGTKVGKGPRD 334

Query: 342 IALGSSVVSIKNQALGGSLLHSHIQTYPDGSNQQQVTCYGYKDANNEWFFNRERGLPSWS 401
           +ALGSS++SIKNQALGG+LLHSH+Q +P+GS QQQVT YGY DANNEWFF R RG+  W+
Sbjct: 335 VALGSSIISIKNQALGGALLHSHVQPFPEGSEQQQVTVYGYSDANNEWFFQRIRGVEPWT 394

Query: 402 ENETD-IEYLKPGTSYRLVHKSTGRNLHTHPVAAPVSKTQWEVSGYGDNVVGDNKDNWVI 460
           + E   IE++K G  YRL+H+ TG+NLHTH V AP+SK+++EVS YGD  +GD KDNW+I
Sbjct: 395 DAENKTIEFVKGGEMYRLMHRLTGKNLHTHEVPAPISKSEYEVSAYGDVDLGDYKDNWII 454

Query: 461 EIMDQRGDEDPEKLHTLTTSFRIKNLEMGCYLAQTGNSLPEWGFRQQEVVCMKNPFKRDK 520
           EI++Q G+EDP  LH L+TSFRIKN  +GCYLAQ+G  LPEWGFRQ EVVC+K+  KRDK
Sbjct: 455 EIVEQVGEEDPTLLHPLSTSFRIKNSILGCYLAQSGKHLPEWGFRQGEVVCLKHASKRDK 514

Query: 521 RTWWNIETHENERLPPRPEDFQYPKTNFLKDFIHLNLAMMATNNALVPDPDKFDYLASSA 580
           RTWWNIETHENERL P+ EDF YPKT+F ++F+ LN AMMATNNALVP+P+KFD +ASSA
Sbjct: 515 RTWWNIETHENERL-PQGEDFVYPKTSFFRNFMQLNSAMMATNNALVPNPEKFDGIASSA 573

Query: 581 WQWPTLNVGLRLCGWGDDNPKYFLLGTPASTWASSVAVLAFMATVVILLIRWQRQYVDLR 640
           WQWPTLNVG+RLC W + + KYFLLG+PAS W SS+AV A +  V+ L ++WQRQ V L 
Sbjct: 574 WQWPTLNVGVRLCEWSEKSIKYFLLGSPASVWPSSIAVCALIIHVIFLTLKWQRQCVILS 633

Query: 641 NPSNWNVFLMGGFYPLLAWGLHYMPFVIMSRVTYVHHYLPALYFALIILAYCFDAGLQKW 700
           +P   +VF+M  FYPLLAW LHYMPFV+MSRV Y HHYLP LYFAL+IL+Y FD   ++W
Sbjct: 634 DPVERDVFVMAAFYPLLAWLLHYMPFVVMSRVVYAHHYLPTLYFALMILSYYFDMITKRW 693

Query: 701 SRSKCGRIMRFVLYAGFMALVIGCFWYFSPISFGMEGPSSNFRYL 745
           +    G+ +R   Y  + ++VI  F+YFSP SFGM+GP  ++ YL
Sbjct: 694 ATRNTGKFLRLGAYIVYGSIVIAGFFYFSPFSFGMDGPVDDYAYL 738

>Scas_643.24
          Length = 769

 Score = 1011 bits (2615), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 481/717 (67%), Positives = 564/717 (78%), Gaps = 12/717 (1%)

Query: 41  DERDAEDFSKEKPAAQSSLLRLESVVMPVIFTALALFTRMYKIGINNHVVWDEAHFGKFG 100
           DE+D     ++ P+ +S L ++E+ VMP++FT L+ FTRMYKIG+NNHVVWDEAHFGKFG
Sbjct: 42  DEKDENVKKQQPPSEESPLCKVEAWVMPIVFTGLSFFTRMYKIGVNNHVVWDEAHFGKFG 101

Query: 101 SYYLRHEFYHDVHPPLGKMLVGLSGYLAGYNGSWDFPSGEIYPDYLDYVKMRLFNASFSA 160
           SYYLRHEFYHDVHPPLGKMLVGLSGYLAGYNGSWDFPSGE YPDYLDYVKMRLF A+FS+
Sbjct: 102 SYYLRHEFYHDVHPPLGKMLVGLSGYLAGYNGSWDFPSGEEYPDYLDYVKMRLFQATFSS 161

Query: 161 LCVPLAYFTAKAIGFSLPTVWLMTVLVLFENSYSTLGRFILLDSMLLFFTVASFFSFVMF 220
           LCVP+AY TAKAIGFS+P VWL T LVLFENSY+TLGRFILLDSML FFTVASF  F++F
Sbjct: 162 LCVPMAYITAKAIGFSIPAVWLFTCLVLFENSYATLGRFILLDSMLQFFTVASFMFFILF 221

Query: 221 HNQRSKPFSRKWWKWLLITGISLGCTISVKMVGLFIITMVGIYTVIDLWTFL-------A 273
           H QR  PFS KWW  L + G +LGC ISVKMVGLFIIT+VGIYTV DLWT L        
Sbjct: 222 HTQRKNPFSIKWWTTLALLGFNLGCAISVKMVGLFIITLVGIYTVADLWTLLPKQATLKT 281

Query: 274 DKSMSWKTYINHWLARIFGLIIVPFCIFLLCFKIHFDLLSHSGTGDANMPSLFQARLVGS 333
            K  +WK Y  HW+ARI  LII+PF +FL CF+IHF LLSHSGTGDANMPSLFQA L GS
Sbjct: 282 KKLQAWKVYGCHWIARIVCLIIIPFLVFLTCFRIHFALLSHSGTGDANMPSLFQATLDGS 341

Query: 334 DVGQGPRDIALGSSVVSIKNQALGGSLLHSHIQTYPDGSNQQQVTCYGYKDANNEWFFNR 393
           DVG+GPRD+ALGSS VSIKNQALGG+LLHSH+QT+P GSNQQQVT Y Y D NN WFF+R
Sbjct: 342 DVGKGPRDVALGSSFVSIKNQALGGALLHSHVQTFPQGSNQQQVTGYAYNDDNNIWFFDR 401

Query: 394 ER--GLPSWS-ENETDIEYLKPGTSYRLVHKSTGRNLHTHPVAAPVSKTQWEVSGYGDNV 450
            R  G   WS E ETDIEY++ G  YRLVH+ST +NLH   + APVSK  WEV+G+G   
Sbjct: 402 IRIPGNQPWSNETETDIEYVRVGNEYRLVHRSTRKNLHADKIVAPVSKNDWEVAGFGYGF 461

Query: 451 -VGDNKDNWVIEIMDQRGDEDPEKLHTLTTSFRIKNLEMGCYLAQTGNSLPEWGFRQQEV 509
            VGD+ DNW+IE+++Q GDED   +H LTT+F IK+  +GCYL QT   LPEWGFRQ E+
Sbjct: 462 EVGDDMDNWIIEVIEQAGDEDKSMIHPLTTTFHIKHAVLGCYLTQTLKQLPEWGFRQSEM 521

Query: 510 VCMKNPFKRDKRTWWNIETHENERLPPRPEDFQYPKTNFLKDFIHLNLAMMATNNALVPD 569
            C     K DKRTWWN+E+HENE+LP     F YPKTNF KDF+ LN  MMATNNALVPD
Sbjct: 522 TCSHKISKNDKRTWWNVESHENEKLPDPDASFHYPKTNFFKDFLFLNRIMMATNNALVPD 581

Query: 570 PDKFDYLASSAWQWPTLNVGLRLCGWGDDNPKYFLLGTPASTWASSVAVLAFMATVVILL 629
            DK+D LAS+AWQWPTLNVGLRLCGW DD  KYFLLG+PASTW S+V+V+  M  +V+L 
Sbjct: 582 SDKYDSLASAAWQWPTLNVGLRLCGWNDDTVKYFLLGSPASTWPSTVSVIVLMIFIVVLA 641

Query: 630 IRWQRQYVDLRNPSNWNVFLMGGFYPLLAWGLHYMPFVIMSRVTYVHHYLPALYFALIIL 689
            RWQRQ  +  N    N F+MG FYPLLAWGLH+MPFVIM+RVTYVHHYLPALYFAL++L
Sbjct: 642 FRWQRQLTNFANDKALNTFMMGAFYPLLAWGLHFMPFVIMARVTYVHHYLPALYFALLVL 701

Query: 690 AYCFDAGLQKWSRSKCGRIMRFVLYAGFMALVIGCFWYFSPISFGMEGPSSNFRYLN 746
           AY F+A +++  +    + + ++    + A+VIG F+YFSPISFGM+GPS N+RYL+
Sbjct: 702 AYFFEAIIRR-PKGTLAKYITYITLVLYFAVVIGGFFYFSPISFGMDGPSKNYRYLD 757

>CAGL0F00759g complement(85452..87656) similar to sp|P31382
           Saccharomyces cerevisiae YAL023c PMT2 or sp|P47190
           Saccharomyces cerevisiae YOR321w PMT3, hypothetical
           start
          Length = 734

 Score =  833 bits (2153), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/702 (56%), Positives = 515/702 (73%), Gaps = 2/702 (0%)

Query: 45  AEDFSKEKPAAQSSLLRLESVVMPVIFTALALFTRMYKIGINNHVVWDEAHFGKFGSYYL 104
           A D  ++K + +   LRLE V MP++FT LAL  R+Y++ +   V WDEAHFGKFGSYYL
Sbjct: 27  ANDNKEQKASNKQFWLRLERVAMPIVFTLLALLVRLYRLDVVKKVTWDEAHFGKFGSYYL 86

Query: 105 RHEFYHDVHPPLGKMLVGLSGYLAGYNGSWDFPSGEIYPDYLDYVKMRLFNASFSALCVP 164
           RH FYHDVHPPLGKMLVG SGYLAGYNGSWDFPSG+ YPDY+ +VKMR+F  + SALCVP
Sbjct: 87  RHTFYHDVHPPLGKMLVGFSGYLAGYNGSWDFPSGQPYPDYVPFVKMRIFQGAVSALCVP 146

Query: 165 LAYFTAKAIGFSLPTVWLMTVLVLFENSYSTLGRFILLDSMLLFFTVASFFSFVMFHNQR 224
           + YF AKAIGFSLPTVWL T+LVL ENSY+TLG+ ILLDS+LLFFTVA+F  F  FH+  
Sbjct: 147 MTYFAAKAIGFSLPTVWLTTILVLCENSYTTLGKLILLDSLLLFFTVATFMCFQKFHSYH 206

Query: 225 SKPFSRKWWKWLLITGISLGCTISVKMVGLFIITMVGIYTVIDLWTFLADKSMSWKTYIN 284
            KPFS +W  WL +TG S+GC ISVKMVGLF+IT+VGI+T+++LWT L DK+++WK Y N
Sbjct: 207 RKPFSFQWCLWLFLTGASMGCAISVKMVGLFVITLVGIHTIVELWTLLGDKNITWKRYAN 266

Query: 285 HWLARIFGLIIVPFCIFLLCFKIHFDLLSHSGTGDANMPSLFQARLVGSDVGQGPRDIAL 344
           HW+ARI  LI+ PF IF LCFKIHF LL  SG GD  MP  FQA L G+++GQGPRD+++
Sbjct: 267 HWIARIICLIVTPFLIFALCFKIHFALLWGSGPGDHEMPPRFQAALNGTNIGQGPRDVSI 326

Query: 345 GSSVVSIKNQALGGSLLHSHIQTYPDGSNQQQVTCYGYKDANNEWFFNRERGLPSWSENE 404
           GS+ ++++N    G+ LHSH QTYP+GS Q+QVTCY Y D NN+W   R  G P W  N+
Sbjct: 327 GST-ITLQNMKPRGAYLHSHHQTYPEGSKQRQVTCYNYVDGNNDWIVYRPHGKPIWHVND 385

Query: 405 TDIEYLKPGTSYRLVHKSTGRNLHTHPVAAPVSKTQWEVSGYGDNVVGDNKDNWVIEIMD 464
           T+ E ++ G + RLVHK TG NLH+H V AP++K  +EVSGYG+  +GD KD+WV+EI+ 
Sbjct: 386 TEHEAIRNGDTIRLVHKGTGSNLHSHQVEAPLNKLDYEVSGYGNLTIGDLKDHWVVEIIK 445

Query: 465 QRGDEDPEKLHTLTTSFRIKNLEMGCYLAQTGNSLPEWGFRQQEVVCMKNPFKRDKRTWW 524
             G+ED   +H +TT  R ++  + CYLAQ+   LPEWGF Q EV C++ P K D +T W
Sbjct: 446 DDGNEDKNLIHPITTHVRFRHAVLNCYLAQSNEHLPEWGFSQAEVRCIREPEKNDIKTMW 505

Query: 525 NIETHENERLPPRPEDFQYPKTNFLKDFIHLNLAMMATNNALVPDPDKFDYLASSAWQWP 584
            ++TH +  L   PE+F YP+ +F  DF  LN  MMATNNAL    DK DYL S +W+WP
Sbjct: 506 IVDTHTHPNLEA-PENFIYPRRSFWSDFFELNKRMMATNNALTVSKDKHDYLRSESWEWP 564

Query: 585 TLNVGLRLCGWGDDNPKYFLLGTPASTWASSVAVLAFMATVVILLIRWQRQYVDLRNPSN 644
           TL   LR+  W +++ +Y LLG+PASTW S+VAVL  +  ++  +++W RQ    +N  +
Sbjct: 565 TLYRSLRINSWNENDTRYLLLGSPASTWPSTVAVLFLVFALLYKVLKWNRQMQIFQNEHD 624

Query: 645 WNVFLMGGFYPLLAWGLHYMPFVIMSRVTYVHHYLPALYFALIILAYCFDAGLQKWSRSK 704
             +F+ GG YPLL W LH+ PFVIM RV YVHHYLPALYFAL +LAY FDAGL+ ++++K
Sbjct: 625 EELFIYGGVYPLLGWFLHFFPFVIMGRVKYVHHYLPALYFALFVLAYIFDAGLRYYNKTK 684

Query: 705 CGRIMRFVLYAGFMALVIGCFWYFSPISFGMEGPSSNFRYLN 746
             RI++F +YAG+M++VIG F  F+P S+GM G   N+++LN
Sbjct: 685 TQRIIKFCIYAGYMSVVIGGFILFAPFSYGMTGKLENYKHLN 726

>Kwal_33.15471
          Length = 755

 Score =  700 bits (1806), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/720 (48%), Positives = 475/720 (65%), Gaps = 25/720 (3%)

Query: 40  ADERDAEDFSKEKPAAQSSLLR--LESVVMPVIFTALALFTRMYKIGINNHVVWDEAHFG 97
            DE+++++ +K    A SS+ R  L  V   ++ T L+ + R  KI  N+ VVWDEAHFG
Sbjct: 39  VDEKNSKNKTK---FASSSISRNVLLQVTGVILLTILSFYVRFNKIDANDEVVWDEAHFG 95

Query: 98  KFGSYYLRHEFYHDVHPPLGKMLVGLSGYLAGYNGSWDFPSGEIYPDYLDYVKMRLFNAS 157
           KFGSYY+++EFYHDVHPPLGKML+ LS YLAG+NG + F SG  YP  ++Y  MR FNA+
Sbjct: 96  KFGSYYIKNEFYHDVHPPLGKMLIALSQYLAGFNGDFAFDSGAPYPSGMNYKFMRQFNAT 155

Query: 158 FSALCVPLAYFTAKAIGFSLPTVWLMTVLVLFENSYSTLGRFILLDSMLLFFTVASFFSF 217
           F ALC P+   TAK +GFS    + + ++V  E S+  L +FILLDSMLLFFT  +F   
Sbjct: 156 FGALCAPIMLLTAKNLGFSNLGSYFLGMMVALELSFVALSKFILLDSMLLFFTATTFHCI 215

Query: 218 VMFHNQRSKPFSRKWWKWLLITGISLGCTISVKMVGLFIITMVGIYTVIDLWTFLADKSM 277
              H  R++PF+R+W  W+L+ G+S+GC  SVK VGLFI  + GIYTV+DL+++  DK +
Sbjct: 216 TELHKVRNRPFTRRWSLWMLLLGLSVGCVCSVKWVGLFITVIAGIYTVVDLFSYHYDKEL 275

Query: 278 SWKTYINHWLARIFGLIIVPFCIFLLCFKIHFDLLSHSGTGDANMPSLFQARLVGSDVGQ 337
           S  +Y  HWL RI  LI++PF ++L CFKIHF +L  SGTGDA   +LFQ  L G+ +  
Sbjct: 276 SRLSYYKHWLVRIIDLIVIPFLVYLFCFKIHFAILHKSGTGDAATNTLFQVNLDGNKIEI 335

Query: 338 GPRDIALGSSVVSIKNQALGGSLLHSHIQTYPDGSNQQQVTCYGYKDANNEWF--FNRER 395
           GPR++A GS  V+I++  L  +LLHSH+Q YP GS Q QVT YG+ D NN W   + RE 
Sbjct: 336 GPRNVAFGSE-VTIRSHGLSPNLLHSHVQLYPFGSGQHQVTGYGHSDDNNNWVIKYPREG 394

Query: 396 GLPSWSENETDIE--YLKPGTSYRLVHKSTGRNLHTHPVAAPVSKTQWEVSGYGDNVVGD 453
           GL +      D++   L  G+  RLVHK+TG NLH+H + A VSK  +EVSGYGD  +GD
Sbjct: 395 GLKAAENGLQDVQSDLLTEGSEIRLVHKNTGANLHSHEIPAHVSKGSFEVSGYGDEEIGD 454

Query: 454 NKDNWVIEIMDQRGD-------EDPEKLHTLTTSFRIKNLEMGCYLAQTGNSLPEWGFRQ 506
            KD+WV+EI+ Q          EDP  LH ++TSFR+++  +GCYLA TG + P WGF+Q
Sbjct: 455 IKDDWVVEIVQQLDSDNSSFPKEDPSLLHPISTSFRLRHKYLGCYLATTGLAYPAWGFKQ 514

Query: 507 QEVVCMKNPFKRDKRTWWNIETHENERLPPRPEDFQYPKTNFLKDFIHLNLAMMATNNAL 566
            E+VC     KRDK TWWNIE H N  L  + E +  PK+ F  DFI +N AM ++NNAL
Sbjct: 515 AEIVCKHTWMKRDKSTWWNIEDHWNPNL-EKSEGYVPPKSKFWPDFILINFAMASSNNAL 573

Query: 567 VPDPDKFDYLASSAWQWPTLNVGLRLCGWGDDNPKYFLLGTPASTWASSVAVLAFMATVV 626
           VPD DK+D LAS AWQWPTL+VGLR+C W +D  KYFLLG+P  TW S++++  F+  ++
Sbjct: 574 VPDEDKYDSLASEAWQWPTLHVGLRMCSWSNDTVKYFLLGSPFQTWLSTLSLFIFVLILL 633

Query: 627 ILLIRWQRQYVDLRNPSNWNVFLMGGFYPLLAWGLHYMPFVIMSRVTYVHHYLPALYFAL 686
            L  +WQRQ V+L   +  +   M G  P LAW LHY+PFV+M RVTYVHHY+PALYFA+
Sbjct: 634 RLAFKWQRQTVNLTG-NELSEISMQGVLPFLAWLLHYLPFVLMGRVTYVHHYVPALYFAI 692

Query: 687 IILAYCFDAGLQKWSRSKCGRIMRFVLYAGFMALVIGCFWYFSPISFGMEGPSSNFRYLN 746
           ++  +  +  L K         + +++Y    A  I  +  FSPI+ G++GP+ NF+YL 
Sbjct: 693 LVFGFVLETCLPK------RYFLNYIVYTALYAGCIYIYVLFSPIAQGIDGPAHNFKYLQ 746

>KLLA0F21978g 2042656..2044929 similar to sp|P42934 Saccharomyces
           cerevisiae YGR199w PMT6 putative mannosyltransferase,
           start by similarity
          Length = 757

 Score =  676 bits (1743), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/722 (47%), Positives = 463/722 (64%), Gaps = 31/722 (4%)

Query: 46  EDFSKEKPAAQSSLLR-LESVVMP-----------VIFTALALFTRMYKIGINNHVVWDE 93
           EDF ++    +  L++ L+S +             ++ T ++   R YKI  +N VVWDE
Sbjct: 31  EDFLRDNEPVEDKLVKPLKSSIFSNRNHRFHTYVCLLLTLVSFVLRFYKIDRSNIVVWDE 90

Query: 94  AHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYLAGYNGSWDFPSGEIYPDYLDYVKMRL 153
           AHFGKFGSYYL+HEFYHDVHPPLGKML+GL  YLAG++G++DF S   YPD +++  MR 
Sbjct: 91  AHFGKFGSYYLKHEFYHDVHPPLGKMLIGLGEYLAGFDGNFDFSSNSSYPDEVNFKIMRQ 150

Query: 154 FNASFSALCVPLAYFTAKAIGFSLPTVWLMTVLVLFENSYSTLGRFILLDSMLLFFTVAS 213
           FNA FS+LC PLA++ A+ + FS+PTV+L+ ++V FE+SY  LG+F+LLDSMLLFFTV +
Sbjct: 151 FNAIFSSLCTPLAFYAARNLNFSMPTVYLVALMVCFEHSYIVLGKFVLLDSMLLFFTVLT 210

Query: 214 FFSFVMFHNQRSKPFSRKWWKWLLITGISLGCTISVKMVGLFIITMVGIYTVIDLWTFLA 273
           F+     +  R    + KW  W+L TG S+GC  SVK VGL I  +VGIYTV +L+    
Sbjct: 211 FYCLSQLYRLRECQLTVKWLAWILATGFSIGCVCSVKWVGLLITALVGIYTVSELYCLHC 270

Query: 274 DKSMSWKTYINHWLARIFGLIIVPFCIFLLCFKIHFDLLSHSGTGDANMPSLFQARLVGS 333
           D+S+S   Y+ HW+ RI  LI+ P  ++++ FKIHF LL  +GTGD++  SLFQA L G+
Sbjct: 271 DRSLSKTKYLGHWIVRISALIVFPLILYMVFFKIHFTLLYKTGTGDSSTHSLFQANLEGA 330

Query: 334 DVGQGPRDIALGSSVVSIKNQALGGSLLHSHIQTYPDGSNQQQVTCYGYKDANNEWF--F 391
            +   PRDIA G S +S+++  L   LLHSH QTYPDGSNQ+QVT Y Y+D NN W   +
Sbjct: 331 QIKPSPRDIAFG-SCISLRSHGLSPGLLHSHPQTYPDGSNQRQVTGYSYRDGNNNWIVKY 389

Query: 392 NRERGLPSWSEN--ETDIEYLKPGTSYRLVHKSTGRNLHTHPVAAPVSKTQWEVSGYGDN 449
           +R  G  S  E     +I +LK G   RLVH+ T  NLHTH + + VSK  +EVSGYG++
Sbjct: 390 SRSSGKASAEERVYSDNILFLKDGDLLRLVHEKTKNNLHTHQIPSHVSKGHYEVSGYGND 449

Query: 450 VVGDNKDNWVIEIMDQ--RGD---EDPEKLHTLTTSFRIKNLEMGCYLAQTGNSLPEWGF 504
            VGD KD+W+IE+++Q   G+   E+   +H LTTSFR++N E+GCYLA TG S P WG+
Sbjct: 450 AVGDLKDDWIIEVVEQLPTGNNTMENKALIHPLTTSFRLRNKELGCYLAATGLSYPGWGY 509

Query: 505 RQQEVVCMKNPFKRDKRTWWNIETHENERLPPRPEDFQYPKTNFLKDFIHLNLAMMATNN 564
            Q E+VC     +RDK TWWN+E H N  L    + F  P T F  DF+ +N AM A+NN
Sbjct: 510 NQAEIVCKYPWNQRDKSTWWNVEDHINSNLHID-QTFTPPPTKFWTDFVVINFAMAASNN 568

Query: 565 ALVPDPDKFDYLASSAWQWPTLNVGLRLCGWGDDNPKYFLLGTPASTWASSVAVLAFMAT 624
           AL+PD DK+D +AS  W+WP L  GLR+C W D   KY+LLG+P +TW S+ A+   +  
Sbjct: 569 ALIPDLDKYDRIASEPWEWPILYKGLRMCNWNDKTVKYYLLGSPFNTWLSTAALPILLIL 628

Query: 625 VVILLIRWQRQYVDLRNPSNWNVFLMGGFYPLLAWGLHYMPFVIMSRVTYVHHYLPALYF 684
           V + L R+QRQ + L     WN+F   G    + W LHY PF IM RVTY+HHY+PAL+F
Sbjct: 629 VSMELFRYQRQSLQLNEKKAWNLFACAGL-SFIGWLLHYAPFFIMGRVTYIHHYVPALFF 687

Query: 685 ALIILAYCFDAGLQKWSRSKCGRIMRFVLYAGFMALVIGCFWYFSPISFGMEGPSSNFRY 744
           A++  AY  D  L     +   R ++ V Y+   A     +WYF+P   GM  P  N  Y
Sbjct: 688 AIMTFAYVVDFAL-----ANSNRYLKVVAYSSLYAGCTFTYWYFAPFCQGM--PEPNLTY 740

Query: 745 LN 746
           +N
Sbjct: 741 VN 742

>YGR199W (PMT6) [2149] chr7 (897505..899784) Protein with similarity
           to O-mannosyltransferases Pmt1p, Pmt2p, Pmt3p, Pmt4p and
           Pmt5p [2280 bp, 759 aa]
          Length = 759

 Score =  655 bits (1689), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/762 (44%), Positives = 479/762 (62%), Gaps = 36/762 (4%)

Query: 1   MXXXXXTGYSKNNAAHIKQENTLRQRXXXXXXXXXXXXXADERDA-----EDFSKEKPAA 55
           M     TG+S  +     ++  LR+R              ++ D      E    +K   
Sbjct: 1   MSKAKGTGFSSIDT----EDENLRERYVNQPKANASDIQDEQLDCFEQLEEKHRTKKNEE 56

Query: 56  QSSLLRLESVVMPVIFTALALFTRMYKIGINNHVVWDEAHFGKFGSYYLRHEFYHDVHPP 115
            ++L  L  V+ P++ T  + + R   I  NN+VVWDEAHFGKFGSYY++HE+YHDVHPP
Sbjct: 57  YTALKILRDVIGPLLLTITSFYLRFQHIDQNNYVVWDEAHFGKFGSYYIKHEYYHDVHPP 116

Query: 116 LGKMLVGLSGYLAGYNGSWDFPSGEIYPDYLDYVKMRLFNASFSALCVPLAYFTAKAIGF 175
           LGKML+ LS ++AG++G +DF S   YP+ +++  MR FNA+F ALC P+A+FTAK +GF
Sbjct: 117 LGKMLIALSEWMAGFDGQFDFSSNNAYPENVNFKLMRQFNATFGALCTPVAFFTAKWMGF 176

Query: 176 SLPTVWLMTVLVLFENSYSTLGRFILLDSMLLFFTVASFFSFVMFHNQRSKPFSRKWWKW 235
           +  TV+L+  +V  E+SY  L +FILLDSMLLFF++ +F   +  +  R +  ++KW  W
Sbjct: 177 NYFTVYLIATMVTLEHSYIVLSKFILLDSMLLFFSMTTFACMIKLYTLRKQQMTKKWSLW 236

Query: 236 LLITGISLGCTISVKMVGLFIITMVGIYTVIDLWTFLADKSMSWKTYINHWLARIFGLII 295
           +L+TG+S+GC  SVK VGLFI  +VG+YT I+L+    DK +    Y  HWL RI  LI+
Sbjct: 237 MLLTGLSIGCVCSVKWVGLFITVVVGLYTCIELFLLYCDKELPRIKYYKHWLIRIINLIV 296

Query: 296 VPFCIFLLCFKIHFDLLSHSGTGDANMPSLFQARLVGSDVGQGPRDIALGSSVVSIKNQA 355
           +PF I+L CFKIHF LL  SGTGD+   +LFQ  L G+ +  GPRD+A GS  ++I++  
Sbjct: 297 IPFLIYLYCFKIHFVLLYKSGTGDSTTNTLFQINLEGTQIEAGPRDVAFGSE-LTIRSHG 355

Query: 356 LGGSLLHSHIQTYPDGSNQQQVTCYGYKDANNEW--FFNRERGLPSWSENET---DIEYL 410
           L  +LLHSHIQ YP+GS Q+Q+T YG+ D+NN W   F+R  GL    +N T    I  +
Sbjct: 356 LSPNLLHSHIQVYPEGSGQRQITGYGFADSNNVWKFEFSRSSGL-ELDQNGTLNGKIIPI 414

Query: 411 KPGTSYRLVHKSTGRNLHTHPVAAPVSKTQWEVSGYGDNVVGDNKDNWVIEIMDQR---- 466
             G   RL HK+TG NLH+H V + VS+  +EVSGYG   VGD KD+W++EI+ Q     
Sbjct: 415 TDGVEVRLSHKNTGSNLHSHDVPSHVSRGNYEVSGYGSQSVGDEKDDWIVEIVKQMDSPN 474

Query: 467 ---GDEDPEKLHTLTTSFRIKNLEMGCYLAQTGNSLPEWGFRQQEVVCMKNPFKRDKRTW 523
               +E+   LH ++T FR+++  +GCYLA TG + P WGF+Q E+VC  +  +RDK TW
Sbjct: 475 PVYSNENSTILHPVSTFFRLRHKVLGCYLASTGLTYPAWGFKQAEIVCKDSWSRRDKSTW 534

Query: 524 WNIETHENERLPPRPEDFQYPKTNFLKDFIHLNLAMMATNNALVPDPDKFDYLASSAWQW 583
           WN+E H N  L    ED+  PK+NF  DFI  N AM ++NNALVPD DK+D L+S AW+W
Sbjct: 535 WNVEDHWNHNL-ETAEDYVPPKSNFWTDFILTNFAMASSNNALVPDEDKYDSLSSDAWEW 593

Query: 584 PTLNVGLRLCGWGDDNPKYFLLGTPASTWASSVAVLAFMATVVILLIRWQRQYVDLRNPS 643
           PTL+ GLR+C W     +Y+L+G+P +TW S+V+++ F   ++ +L RW+RQ + L +  
Sbjct: 594 PTLHKGLRMCSWAGYITRYYLMGSPFNTWISTVSLIIFPFIILFILYRWRRQTLYLSDDQ 653

Query: 644 NWNVFLMGGFYPLLAWGLHYMPFVIMSRVTYVHHYLPALYFALIILAYCFDAGLQKWSRS 703
            W + + G F P ++W  HY+PF +M RVTYVHHY+PALYFA+++  +  D  L      
Sbjct: 654 IWQITIQGIF-PFISWMTHYLPFAMMGRVTYVHHYVPALYFAMLVFGFVLDFTLT----- 707

Query: 704 KCGRIMRFVLYAGFMALVIGCFW---YFSPISFGMEGPSSNF 742
              R+   V Y  +++L  GC +    F+PI  GM G  + +
Sbjct: 708 ---RVHWMVKYPIYLSLFGGCIYIYNLFAPICQGMHGDKAEY 746

>CAGL0K00979g complement(97306..99498) similar to sp|P42934
           Saccharomyces cerevisiae YGR199w
           Dolichyl-phosphate-mannose--protein mannosyltransferase
           6, hypothetical start
          Length = 730

 Score =  632 bits (1629), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/729 (47%), Positives = 471/729 (64%), Gaps = 36/729 (4%)

Query: 40  ADERDAEDFSKEKPAAQSSLL-------RLESVVMPVIFTALALFTRMYKIGINNHVVWD 92
           ADE+  E  +KE    Q+ ++       +   ++  + FT L+   R   I  NN VVWD
Sbjct: 7   ADEKTTE--TKENTPDQTKVVPRACNFAKYRDLIACLGFTVLSFVLRFQGIDKNNSVVWD 64

Query: 93  EAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYLAGYNGSWDFPSGEIYPDYLDYVKMR 152
           EAHFGKFGSYY+RHEFYHDVHPPLGKML+ LS +LAG++G +DF SG  YPD +++  MR
Sbjct: 65  EAHFGKFGSYYIRHEFYHDVHPPLGKMLIALSEWLAGFDGEFDFESGHQYPDGVNFKFMR 124

Query: 153 LFNASFSALCVPLAYFTAKAIGFSLPTVWLMTVLVLFENSYSTLGRFILLDSMLLFFTVA 212
            FNA+F ALC P+ +FTAK +  S P V+L+T++V  E+S+  L +FILLDSMLLFFT  
Sbjct: 125 QFNATFGALCTPVVFFTAKTMNLSWPIVYLVTLMVTLEHSFIALSKFILLDSMLLFFTAT 184

Query: 213 SFFSFVMFHNQRSKPFSRKWWKWLLITGISLGCTISVKMVGLFIITMVGIYTVIDLWTFL 272
           +F   V     R    +R+W  WLL+TG+S+GC  SVK VGLFI  +VG++T+IDL    
Sbjct: 185 TFACMVKLIQLRGCQLTRQWLWWLLLTGLSIGCVCSVKWVGLFITLVVGLFTIIDLLEHY 244

Query: 273 ADKSMSWKTYINHWLARIFGLIIVPFCIFLLCFKIHFDLLSHSGTGDANMPSLFQARLVG 332
            +K  S K Y  HW+ RI  LII+PF ++L CFKIHF LL  SGTGDA+  SLFQ  L G
Sbjct: 245 WNKKESRKIYYKHWILRIINLIIIPFLVYLFCFKIHFLLLYKSGTGDASTNSLFQVNLEG 304

Query: 333 SDVGQGPRDIALGSSVVSIKNQALGGSLLHSHIQTYPDGSNQQQVTCYGYKDANNEWF-- 390
           + +   PR +  GS  V+I++  L  +LLHSH+Q YPDGS Q+QVT YG+ D NN W   
Sbjct: 305 TQIQNSPRTVMYGSE-VTIRSHGLSPNLLHSHVQLYPDGSRQRQVTGYGHSDGNNNWMIK 363

Query: 391 FNRERGLPSWSENET---DIEYLKPGTSYRLVHKSTGRNLHTHPVAAPVSKTQWEVSGYG 447
           F R  G     +N+    ++  ++ G + RL H   G NLH+H +++ VSK  +EVSGYG
Sbjct: 364 FGRTTGRYLDEDNKRLNGELVPVRDGDTIRLFHVRMGCNLHSHTISSHVSKGNYEVSGYG 423

Query: 448 DNVVGDNKDNWVIEIMDQR-------GDEDPEKLHTLTTSFRIKNLEMGCYLAQTGNSLP 500
              VGD KD+W+IEIM+Q        G ED E LH ++T FR+++ ++GCYLA TG S P
Sbjct: 424 SEEVGDEKDDWIIEIMEQLDSANTNFGKEDNEVLHPISTMFRLRHKDLGCYLASTGLSYP 483

Query: 501 EWGFRQQEVVCMKNPFKRDKRTWWNIETHENERLPPRPEDFQYPKTNFLKDFIHLNLAMM 560
            WGF Q E+VC  +  KRDK TWWN+E H N++L    E++  PK+ F  DFI +N AM 
Sbjct: 484 TWGFHQAEIVCKYSWGKRDKSTWWNVEDHWNDQLVV-DEEYVPPKSKFWTDFILINFAMA 542

Query: 561 ATNNALVPDPDKFDYLASSAWQWPTLNVGLRLCGWGDDNPKYFLLGTPASTWASSVAVLA 620
           ++NNALVPD DK+DYLAS AW+WP L+ GLRLCGW     +Y+LLG+P +TW SS+A+L 
Sbjct: 543 SSNNALVPDEDKYDYLASKAWEWPILHKGLRLCGWSSAGVRYYLLGSPFNTWLSSIALLV 602

Query: 621 FMATVVILLIRWQRQYVDLRNPSNWNVFLMGGFYPLLAWGLHYMPFVIMSRVTYVHHYLP 680
            +   +++ I+W+RQ + +   S W +F +   +P LAW  ++MP+V+M RVTYVHHY+P
Sbjct: 603 NILLGMVVAIKWRRQSIVINEESCWKLFTL-LLFPFLAWLANFMPYVMMGRVTYVHHYMP 661

Query: 681 ALYFALIILAYCFDAGLQKWSRSKCGRIMRFVLYAGFMALVIGC---FWYFSPISFGMEG 737
           ALYFA+I      +  L  +   K         +  F+++V GC   +WYF+PI  G+ G
Sbjct: 662 ALYFAIIAFGSITEYLLADYCTVKA--------FLAFLSMV-GCTYIYWYFAPICQGLHG 712

Query: 738 PSSNFRYLN 746
             S++ YL 
Sbjct: 713 IGSHYFYLQ 721

>CAGL0L07216g complement(799529..802105) similar to sp|P33775
           Saccharomyces cerevisiae YDL095w PMT1
           mannosyltransferase or sp|P52867 Saccharomyces
           cerevisiae YDL093w, hypothetical start
          Length = 858

 Score =  378 bits (971), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 250/708 (35%), Positives = 370/708 (52%), Gaps = 45/708 (6%)

Query: 47  DFSKEKPAAQSSLLR-LESVVMPVIFTALALFTRMYKIGINNHVVWDEAHFGKFGSYYLR 105
           DF  +   A+   ++ L+  +M  I   +  F R+YK+   + VV+DE HFG F S Y++
Sbjct: 42  DFEGDYDTAKLRTVKTLKEKLMVAILLIITAFVRLYKLSWPSSVVFDEVHFGGFASKYIK 101

Query: 106 HEFYHDVHPPLGKMLVGLSGYLAGYNGSWDF-PSGEIYPDYLDYVKMRLFNASFSALCVP 164
            +F+ DVHPPL KML    G LAGY G + F P GE YPD + +  MRLF+AS     V 
Sbjct: 102 GDFFMDVHPPLAKMLFAGVGALAGYTGDFSFKPIGEEYPDTVPFYTMRLFSASLGVFTVL 161

Query: 165 LAYFTAKAIGFSLPTVWLMTVLVLFENSYSTLGRFILLDSMLLFFTVASFFSFVMFHNQR 224
           + Y T +A G  L   +L  ++  FENS+ T+ R+ILLD+ L+ F  A+ +S+       
Sbjct: 162 MLYLTLRASGVRLGVAYLFALVFAFENSFVTISRYILLDAPLICFIAAAVYSYKKSELYP 221

Query: 225 SKPFSRKWWKWLLITGISLGCTISVKMVGLFIITMVGIYTVIDLWTFLADKSMSWKTYIN 284
           +  F  +  K LL TGI+LG   S K VGLF +  VG+  V  LW  + D + S  T + 
Sbjct: 222 TNSF--RALKSLLATGIALGLASSSKWVGLFTVAWVGLLCVWKLWFMIGDLNKSPCTIVK 279

Query: 285 HWLARIFGLIIVPFCIFLLCFKIHFDLLSHSGTGDANMPSLFQARLVGSDVGQGPRDIAL 344
             + ++  L+ VP  +++  F +HF  L H G+G +  PS F+A L G+ +   P D+  
Sbjct: 280 AAIGKLVLLLGVPILLYVAFFYVHFQALIHDGSGSSFFPSEFRATLEGNQI---PSDVVY 336

Query: 345 G---SSVVSIKNQALGGSLLHSHIQTYPDGSNQQQVTCYGYKDANNEWFFNRERGLPSWS 401
                S+V++K+ +  G  LHSH   YP GS QQQ+T Y + D NN+W   R   LP  S
Sbjct: 337 DVGVGSIVTLKHLSTEGGYLHSHSHAYPTGSEQQQITLYPFLDDNNKWVIERSH-LPGAS 395

Query: 402 ENETDIEYLKPGTSYRLVHKSTGRNLHTHPVAAPVSKT---QWEVSGYGD-NVVGDNKDN 457
               D   LK G S  L+H +TG  LH+H    PVS++   Q EVSGYG     GD  D+
Sbjct: 396 LK--DFIGLKNGESISLLHLATGVRLHSHDHKPPVSESADWQKEVSGYGYLGFTGDINDH 453

Query: 458 WVIEIMDQRGDED---PEKLHTLTTSFRIKNLEMGCYLAQTGNSLPEWGFRQQEVVCMKN 514
           W IEI DQ   +      ++  + T F++++   GCYL      LP+WGF QQEV C   
Sbjct: 454 WTIEI-DQSSSKPGIAQHEVRAIDTKFKLRH-ATGCYLFSHEVKLPKWGFDQQEVTCATQ 511

Query: 515 PFKRDKRTWWNIETHENERLPPRPEDFQYPKTNFLKDFIHLNLAMMATNNALVPDPDKFD 574
              + +   W IE  EN +LP       Y   NF++ FI  +  M   N  L        
Sbjct: 512 --GKPELLLWYIEGSENPQLPENTPRISYKPMNFIEKFIENHKKMWKINKGLTGT----H 565

Query: 575 YLASSAWQWPTLNVGLRLCGWGDDNPKYFLLGTPASTWASS------VAVLAFMATVVIL 628
           Y  S A++WP +  G+    WG+ + K +LLG   + WA S       A+LAF A   ++
Sbjct: 566 YYESLAYEWPLMRRGIGY--WGEHHRKIYLLGNAVTWWAVSAFILVYAAILAFEAGSFLV 623

Query: 629 LIRWQRQYVDLRNPSNWNVFLMGGFYPLLAWGLHYMPFVIMSRVTYVHHYLPALYFALII 688
                +  +  +N  N++V ++   + LL + +HY+PF +M R  ++HHYLPA YF ++ 
Sbjct: 624 ----GKPILQDKNVINFHVQVL---HYLLGFAIHYVPFFLMGRQLFLHHYLPAYYFGILA 676

Query: 689 LAYCFDAGLQKWSRSKCGRIMRFVLYAGFMALVIGCFWYFSPISFGME 736
           LA+ FD  +    +++  +   + L   F A  I  F   SPI++G +
Sbjct: 677 LAHAFDIIITFVCKNR--KQAAYALLILFTAASIYFFHAHSPIAYGTD 722

>Scas_408.1*
          Length = 391

 Score =  353 bits (907), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 180/384 (46%), Positives = 257/384 (66%), Gaps = 9/384 (2%)

Query: 10  SKNNAAHIK-QENTLRQRXXXXXXXXXXXXXADERDAEDFSKEK-----PAAQSSLLRLE 63
           SK++   I   +++LR+R               E D    +K +      A  SS +R  
Sbjct: 5   SKDSTVSIHPTDSSLRERKAVTQTSTELDIKQHEPDDSKQNKSRYPYVTTAKISSSMR-- 62

Query: 64  SVVMPVIFTALALFTRMYKIGINNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGL 123
           S + P++ T L+   R + IG NNHVVWDEAHFGKFGSYY+ HEFYHDVHPPLGKML+ L
Sbjct: 63  SYIGPLLLTILSFQLRFHDIGKNNHVVWDEAHFGKFGSYYITHEFYHDVHPPLGKMLIAL 122

Query: 124 SGYLAGYNGSWDFPSGEIYPDYLDYVKMRLFNASFSALCVPLAYFTAKAIGFSLPTVWLM 183
           S YLAG++G ++F S E YP+ ++Y+ MR FNA F ALCVP+  FT +++GF+  T +L+
Sbjct: 123 SEYLAGFDGHFNFDSNEAYPEEVNYIFMRQFNAMFGALCVPVTLFTTRSMGFNWLTSYLV 182

Query: 184 TVLVLFENSYSTLGRFILLDSMLLFFTVASFFSFVMFHNQRSKPFSRKWWKWLLITGISL 243
           T++V  E+SY  L +FILLDS+LLFFT+ +F   V  +  + +  +++W  W+L+TG+S+
Sbjct: 183 TLMVTLEHSYIVLSKFILLDSILLFFTLTTFACMVKLYTLKKRQLTKQWSLWMLLTGLSV 242

Query: 244 GCTISVKMVGLFIITMVGIYTVIDLWTFLADKSMSWKTYINHWLARIFGLIIVPFCIFLL 303
           GC  SVK VGLFI  +VG++T+++L+T   DK++    Y  HW+ RI  LII+PF I++ 
Sbjct: 243 GCVCSVKWVGLFITIIVGLFTIMELFTHHYDKTLPRVKYYKHWMIRIIDLIIIPFLIYMF 302

Query: 304 CFKIHFDLLSHSGTGDANMPSLFQARLVGSDVGQGPRDIALGSSVVSIKNQALGGSLLHS 363
           CFKIHF LL  SGTGD+   +LFQ  L G+ +  GPRD+  GS  V+I++  L  +LLHS
Sbjct: 303 CFKIHFTLLYKSGTGDSATNTLFQVNLEGTTIENGPRDVMYGSE-VTIRSHGLSPNLLHS 361

Query: 364 HIQTYPDGSNQQQVTCYGYKDANN 387
           H+Q YPDGS Q+Q+T YG+ D+++
Sbjct: 362 HVQLYPDGSRQRQITGYGHSDSSS 385

>YDL095W (PMT1) [773] chr4 (287059..289512) Mannosyltransferase
           (dolichyl phosphate-D-mannose:protein
           O-D-mannosyltransferase), first step in O-glycosylation
           [2454 bp, 817 aa]
          Length = 817

 Score =  361 bits (926), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 243/695 (34%), Positives = 357/695 (51%), Gaps = 31/695 (4%)

Query: 53  PAAQ-SSLLRLESVVMPVIFTALALFT---RMYKIGINNHVVWDEAHFGKFGSYYLRHEF 108
           P+A+ +SL  + ++   ++   LA+FT   R++ +   + VV+DE HFG F S Y+R  +
Sbjct: 34  PSAELASLRTMVTLKEKLLVACLAVFTAVIRLHGLAWPDSVVFDEVHFGGFASQYIRGTY 93

Query: 109 YHDVHPPLGKMLVGLSGYLAGYNGSWDFPS-GEIYPDYLDYVKMRLFNASFSALCVPLAY 167
           + DVHPPL KML      L G+ G +DF + G+ +P    YV MR F+AS  AL V L Y
Sbjct: 94  FMDVHPPLAKMLYAGVASLGGFQGDFDFENIGDSFPSTTPYVLMRFFSASLGALTVILMY 153

Query: 168 FTAKAIGFSLPTVWLMTVLVLFENSYSTLGRFILLDSMLLFFTVASFFSFVMFHNQRSKP 227
            T +  G  +    +  +    ENSY T+ R+ILLD+ L+FF  A+ +SF  +    +  
Sbjct: 154 MTLRYSGVRMWVALMSAICFAVENSYVTISRYILLDAPLMFFIAAAVYSFKKYEMYPAN- 212

Query: 228 FSRKWWKWLLITGISLGCTISVKMVGLFIITMVGIYTVIDLWTFLADKSMSWKTYINHWL 287
            S   +K LL TGI+LG   S K VGLF +T VG+  +  LW  + D + S K+      
Sbjct: 213 -SLNAYKSLLATGIALGMASSSKWVGLFTVTWVGLLCIWRLWFMIGDLTKSSKSIFKVAF 271

Query: 288 ARIFGLIIVPFCIFLLCFKIHFDLLSHSGTGDANMPSLFQARLVGSDVGQG-PRDIALGS 346
           A++  L+ VPF ++L+ F IHF  L+  G G +     F++ L  + + Q    D+ +G 
Sbjct: 272 AKLAFLLGVPFALYLVFFYIHFQSLTLDGDGASFFSPEFRSTLKNNKIPQNVVADVGIG- 330

Query: 347 SVVSIKNQALGGSLLHSHIQTYPDGSNQQQVTCYGYKDANNEWFFNRERGLPSWSENETD 406
           S++S+++ +  G  LHSH   YP GS QQQ T Y + DANN+W            E+ T 
Sbjct: 331 SIISLRHLSTMGGYLHSHSHNYPAGSEQQQSTLYPHMDANNDWLLELYNAP---GESLTT 387

Query: 407 IEYLKPGTSYRLVHKSTGRNLHTHPVAAPVSKT---QWEVSGYG-DNVVGDNKDNWVIEI 462
            + L  GT  RL H  T   LH+H    PVS++   Q EVS YG     GD  D+WV+EI
Sbjct: 388 FQNLTDGTKVRLFHTVTRCRLHSHDHKPPVSESSDWQKEVSCYGYSGFDGDANDDWVVEI 447

Query: 463 MDQRGDE---DPEKLHTLTTSFRIKNLEMGCYLAQTGNSLPEWGFRQQEVVCMKNPFKRD 519
            D++        E++  L T FR+++   GCYL      LP WGF QQEV C  +   R 
Sbjct: 448 -DKKNSAPGVAQERVIALDTKFRLRHAMTGCYLFSHEVKLPAWGFEQQEVTCASS--GRH 504

Query: 520 KRTWWNIETHENERLPPRPEDFQYPKTNFLKDFIHLNLAMMATNNALVPDPDKFDYLASS 579
             T W +E + N  LP   +   Y   +F+  FI  +  M   N  LV +P  ++   S 
Sbjct: 505 DLTLWYVENNSNPLLPEDTKRISYKPASFISKFIESHKKMWHINKNLV-EPHVYE---SQ 560

Query: 580 AWQWPTLNVGLRLCGWGDDNPKYFLLGTPASTWASSVAVLAFMATVVILLIRWQRQYVDL 639
              WP L  G+    WG++N   +LLG     WA +  +  F   V+  L  WQ     L
Sbjct: 561 PTSWPFLLRGISY--WGENNRNVYLLGNAIVWWAVTAFIGIFGLIVITELFSWQLGKPIL 618

Query: 640 RNPSNWNVFLMGGFYPLLAWGLHYMPFVIMSRVTYVHHYLPALYFALIILAYCFDAGLQK 699
           ++    N F +   + LL + +HY P  +M R  ++HHYLPA YF ++ L +  D  +  
Sbjct: 619 KDSKVVN-FHVQVIHYLLGFAVHYAPSFLMQRQMFLHHYLPAYYFGILALGHALDIIVSY 677

Query: 700 WSRSKCGRIMRFVLYAGFMALVIGCFWYFSPISFG 734
             RSK  R M + +   F+A  +  F  FSPI +G
Sbjct: 678 VFRSK--RQMGYAVVITFLAASVYFFKSFSPIIYG 710

>KLLA0E01342g complement(134691..137207) similar to sp|P33775
           Saccharomyces cerevisiae YDL095w PMT1
           mannosyltransferase, start by similarity
          Length = 838

 Score =  358 bits (919), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 239/699 (34%), Positives = 357/699 (51%), Gaps = 34/699 (4%)

Query: 51  EKPAAQSSLLRLESVVMPVIFTALALFT---RMYKIGINNHVVWDEAHFGKFGSYYLRHE 107
           E P    S+  + S    ++  ALA+     R++ +   N VV+DE HFGKF + Y++  
Sbjct: 37  EPPKNLKSIRTMTSSKERLVVIALAVIASVVRLWNLSDPNSVVFDEVHFGKFAAKYIKGI 96

Query: 108 FYHDVHPPLGKMLVGLSGYLAGYNGSWDFPS-GEIYPDYLDYVKMRLFNASFSALCVPLA 166
           F+ DVHPPL KML    G LAG+ G ++F   G  +P    Y  MR F+A      V L 
Sbjct: 97  FFTDVHPPLAKMLFAGIGSLAGFTGDFEFKDIGLAFPASTPYFAMRFFSAFLGLATVLLM 156

Query: 167 YFTAKAIGFSLPTVWLMTVLVLFENSYSTLGRFILLDSMLLFFTVASFFSFVMFHNQRSK 226
           YFT +A G  +   ++ +++   ENS+ T+ R+ILLD+ L+FF  A+ +S+  +    S+
Sbjct: 157 YFTLRASGIRIWIAFVASLMFALENSFVTISRYILLDAPLIFFIAAAAYSYKKYEIHPSE 216

Query: 227 PFSRKWWKWLLITGISLGCTISVKMVGLFIITMVGIYTVIDLWTFLADKSMSWKTYINHW 286
            F+   +K LL TG+SLG  +S K VGLF I  VG  ++  LW  + D     ++ + H 
Sbjct: 217 SFNS--YKALLATGLSLGLAVSSKWVGLFTIAWVGALSLFKLWFDIGDLKKPVQSTLRHT 274

Query: 287 LARIFGLIIVPFCIFLLCFKIHFDLLSHSGTGDANMPSLFQARLVGSDVGQG-PRDIALG 345
           + +   L+  P  ++L  F IHF  L ++  G     S F++ L+G+++    P D+ +G
Sbjct: 275 VVKATLLLAAPAALYLFFFYIHFQTLIYNSDGAGFFSSAFRSTLIGNNIPSNIPYDVGVG 334

Query: 346 SSVVSIKNQALGGSLLHSHIQTYPDGSNQQQVTCYGYKDANNEW---FFNRERGLPSWSE 402
           SS VSI++    G  LHSH   Y  GS QQQVT Y + DANN+W    +++   +P    
Sbjct: 335 SS-VSIRHTGTMGGYLHSHKHIYETGSKQQQVTLYSHLDANNDWVIELYDQPEVIP---- 389

Query: 403 NETDIEYLKPGTSYRLVHKSTGRNLHTHPVAAPVSKT---QWEVSGYG-DNVVGDNKDNW 458
            ET  E LK GT  RL H+ T R LH+H    PVS++   Q EVS YG DN  GD  D+W
Sbjct: 390 -ET-FEGLKDGTKIRLRHRLTDRRLHSHDHKPPVSESSDWQKEVSAYGADNFTGDANDDW 447

Query: 459 VIEIMDQRG--DEDPEKLHTLTTSFRIKNLEMGCYLAQTGNSLPEWGFRQQEVVCMKNPF 516
           VIEI  +     E  E +  L T FR+++   GC L      LP+WGF QQEV C  +  
Sbjct: 448 VIEIDHEASAPGEAQEYVKALDTKFRLRHAMTGCRLFSHEVKLPKWGFEQQEVTCASSGV 507

Query: 517 KRDKRTWWNIETHENERLPPRPEDFQYPKTNFLKDFIHLNLAMMATNNALVPDPDKFDYL 576
                T W +E + N  LP       Y    FL+ FI  +  M   N  L     +    
Sbjct: 508 P--SLTLWYVEHNSNPLLPEDAAKISYQTPTFLEKFIESHQRMWHINKNL----KEHHVY 561

Query: 577 ASSAWQWPTLNVGLRLCGWGDDNPKYFLLGTPASTWASSVAVLAFMATVVILLIRWQRQY 636
            S    WP L  G+    W  D+ + +LLG     W+ +  +  F+  +V  L+ WQ   
Sbjct: 562 QSDPATWPLLLRGISY--WSQDHKQIYLLGNAVVWWSVTAFIGVFVLVIVAELLAWQLGK 619

Query: 637 VDLRNPSNWNVFLMGGFYPLLAWGLHYMPFVIMSRVTYVHHYLPALYFALIILAYCFDAG 696
             L++    N F +  F  LL WGLHY P  +M R  ++HHYLPA YF ++  A+  +  
Sbjct: 620 SILQDKHVLN-FHIQTFQYLLGWGLHYAPSFLMGRQLFLHHYLPAYYFGILAFAHALEII 678

Query: 697 LQKWSRSKCGRIMRFVLYAGFMALVIGCFWYFSPISFGM 735
           +    ++K  + + + +   F+A     F+ + P+ +G+
Sbjct: 679 VSYVFKNK--KTVGYGVVITFLAAATAFFYVYKPLIYGL 715

>Kwal_23.3623
          Length = 876

 Score =  346 bits (888), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 239/691 (34%), Positives = 354/691 (51%), Gaps = 46/691 (6%)

Query: 64  SVVMPVIFTALALFT---RMYKIGINNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKML 120
           SV   V   ALA+ T   R+Y +   N VV+DE HFG F + Y++  F+ DVHPPL KML
Sbjct: 91  SVKEKVTIAALAVITGVIRLYGLSNPNSVVFDEVHFGGFAAKYIKGIFFMDVHPPLAKML 150

Query: 121 VGLSGYLAGYNGSWDFPS-GEIYPDYLDYVKMRLFNASFSALCVPLAYFTAKAIGFSLPT 179
               G +AG+ G +DF   G+ +P+   Y  MRLF A    L V L Y T +  G  +P 
Sbjct: 151 FAAIGSIAGFTGDFDFEKIGQHFPESTPYYFMRLFPALLGTLTVLLMYLTLRCSGVRIPI 210

Query: 180 VWLMTVLVLFENSYSTLGRFILLDSMLLFFTVASFFSFVMFHNQRSKPFSRKWW---KWL 236
            ++ ++    ENS+ T+ R+ILLD+ LLFF  ++ +SF     ++ + + +  W   K L
Sbjct: 211 AFIASLCFAIENSFVTISRYILLDAPLLFFIASAVYSF-----KKYEIYPQGSWGSLKAL 265

Query: 237 LITGISLGCTISVKMVGLFIITMVGIYTVIDLWTFLADKSMSWKTYINHWLARIFGLIIV 296
           L  G++LG  +S K VGLF I  VG+  +  LW  + D S    + +     ++   + +
Sbjct: 266 LSGGLALGMALSSKWVGLFTIAWVGVLCIWRLWFMVGDLSKPLSSTLKEASRKLMFFLAL 325

Query: 297 PFCIFLLCFKIHFDLLSHSGTGDANMPSLFQARLVGSDVGQGPRDI----ALGSSVVSIK 352
           P  ++ + F +HF+ L+ +  G     S F+  L G+ +   P+DI     +GS+ +S++
Sbjct: 326 PLALYAVFFYVHFETLTINSDGAGFFSSAFRTTLHGNTI---PKDILADVGIGST-ISMR 381

Query: 353 NQALGGSLLHSHIQTYPDGSNQQQVTCYGYKDANNEWFFNRERGLPSWSENE-TDIEYLK 411
           + A  G  LHSH   Y  GS QQQVT Y + D NN+W       LP       T  E LK
Sbjct: 382 HVATMGGYLHSHNHMYEKGSQQQQVTLYPHLDGNNDWVIE----LPDQPNKAVTSFEGLK 437

Query: 412 PGTSYRLVHKSTGRNLHTHPVAAPVSKT---QWEVSGYG-DNVVGDNKDNWVIEIMDQRG 467
            GT  RL H  T R LH+H   APVS++   Q EVS YG ++  GD  D+W IEI DQ  
Sbjct: 438 DGTVIRLKHAITQRRLHSHDHKAPVSESADWQKEVSCYGFEDFEGDGNDDWTIEI-DQDA 496

Query: 468 DEDPE---KLHTLTTSFRIKNLEMGCYLAQTGNSLPEWGFRQQEVVCMKNPFKRDKRTWW 524
            E  E   ++  L T FR+K+  M C+L      LP+WGF QQEV C      +   T W
Sbjct: 497 SEPGEAQKRVKALDTKFRLKHNIMNCHLFSHEVKLPKWGFEQQEVTCASQ--GKPYLTLW 554

Query: 525 NIETHENERLPPRPEDFQYPKTNFLKDFIHLNLAMMATNNALVPDPDKFDYLASSAWQWP 584
            IE + +  L    E   Y K NF +  I  +  M   N  LV +P  ++   S    WP
Sbjct: 555 YIEGNSHPLLTGDQERVSYKKPNFFEKLIESHQRMWHINKNLV-EPHIYE---SKPHSWP 610

Query: 585 TLNVGLRLCGWGDDNPKYFLLGTPASTWASSVAVLAFMATVVIL-LIRWQRQYVDLRNPS 643
            L  G+    WG+++ + +LLG  A  W S  A +A  AT+V+  L  WQ     L++  
Sbjct: 611 FLLRGINY--WGENHKQVYLLGN-AIVWWSVTAFIALFATIVVFELFAWQLGKPILQDSK 667

Query: 644 NWNVFLMGGFYPLLAWGLHYMPFVIMSRVTYVHHYLPALYFALIILAYCFDAGLQKWSRS 703
             N F +   + LL +GLHY+P  +M R  ++HHYLPA YF ++  A+  D  +    R 
Sbjct: 668 VVN-FHVQVIHYLLGYGLHYIPSFLMGRQLFLHHYLPAYYFGILAFAHALDITVTYVFRK 726

Query: 704 KCGRIMRFVLYAGFMALVIGCFWYFSPISFG 734
           +   ++ + +   F + V+  F  +  + +G
Sbjct: 727 R--EVIGYAVIGVFFSAVVYFFVSYRALIYG 755

>ADR279C [2020] [Homologous to ScYDL095W (PMT1) - SH; ScYDL093W
           (PMT5) - SH] (1177907..1180360) [2454 bp, 817 aa]
          Length = 817

 Score =  341 bits (874), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 234/693 (33%), Positives = 348/693 (50%), Gaps = 38/693 (5%)

Query: 57  SSLLRLESVVMPVIFTALALFTRMYKIGINNHVVWDEAHFGKFGSYYLRHEFYHDVHPPL 116
           SS    +SVV  ++  A A+  R+Y +   + VV+DE HFG + S Y++  F+ DVHPPL
Sbjct: 43  SSTWSEKSVVGALMGVAAAV--RLYNLAYPDSVVFDEVHFGGYASKYIQGAFFLDVHPPL 100

Query: 117 GKMLVGLSGYLAGYNGSWDFPS-GEIYPDYLDYVKMRLFNASFSALCVPLAYFTAKAIGF 175
            KML+  +G LAGY G + F   G  YP  + Y  MR   A+   L V L + T +A G 
Sbjct: 101 AKMLLAGAGKLAGYGGEFGFEDIGIDYPATVPYQVMRFLPAALGVLTVLLMFLTLRASGV 160

Query: 176 SLPTVWLMTVLVLFENSYSTLGRFILLDSMLLFFTVASFFSFVMFHNQRSKPFSRKWWKW 235
                + ++++   ENS+ T+ R+ILLDS LLFF  A+ +SF      ++   S +++K 
Sbjct: 161 RKWVAFAVSLVFTVENSFVTISRYILLDSPLLFFIAAAVYSFKRLELHQTG--SLQYYKC 218

Query: 236 LLITGISLGCTISVKMVGLFIITMVGIYTVIDLWTFLADKSMSWKTYINHWLARIFGLII 295
           L  TG++LG  +S K VG F    VG+ +V+ LW  + D +    + +     +   L +
Sbjct: 219 LAATGMALGLAMSSKWVGFFTFAWVGVVSVMQLWFQVGDLNKPVPSILKQSAIKASILCV 278

Query: 296 VPFCIFLLCFKIHFDLLSHSGTGDANMPSLFQARLVGSDVGQGPRDIALG---SSVVSIK 352
           +P C+++L F+IHF  L +      N  S F+  L G  +   P +I  G    S V+I+
Sbjct: 279 LPMCLYVLFFRIHFQSLPNVTDAAGNFSSAFRTTLHGHTI---PANIYAGVGIGSTVTIR 335

Query: 353 NQALGGSLLHSHIQTYPDGSNQQQVTCYGYKDANNEWF---FNRERGLPSWSENETDIEY 409
           +    G  LHSH   Y  GS QQQVT Y + D NN W+   +N    +P      T  E 
Sbjct: 336 HIGTMGGYLHSHNHMYQGGSEQQQVTLYPHLDQNNHWYIEHYNASNTVP------TTFEG 389

Query: 410 LKPGTSYRLVHKSTGRNLHTHPVAAPVSKT---QWEVSGYG-DNVVGDNKDNWVIEIMDQ 465
           L+ GT  RL H  TG  LH+H    PVS +   Q EVSGYG     GD  D+W++EI  +
Sbjct: 390 LEHGTKIRLKHVLTGHRLHSHDHKPPVSVSSDWQKEVSGYGFPEFEGDANDDWIVEIDQE 449

Query: 466 RGD--EDPEKLHTLTTSFRIKNLEMGCYLAQTGNSLPEWGFRQQEVVCMKNPFKRDKRTW 523
           +    E  E++  + T FR+++   GC L      LP+WGF QQEV C      R   T 
Sbjct: 450 KSTPGEARERVRAIETKFRLRHAMTGCMLFSHQVKLPKWGFEQQEVTCATQ--GRPDLTL 507

Query: 524 WNIETHENERLPPRPEDFQYPKTNFLKDFIHLNLAMMATNNALVPDPDKFDYLASSAWQW 583
           W IE + N  L    E   Y   NF +  + ++  M   N +L    D   Y  S   QW
Sbjct: 508 WYIEENTNPLLSEDSEKISYKTPNFWEKLVEIHRKMWHINKSLT---DAHMY-QSDPIQW 563

Query: 584 PTLNVGLRLCGWGDDNPKYFLLGTPASTWASSVAVLAFMATVVILLIRWQRQYVDLRNPS 643
           P L  G+    W  D+ + +LLG     ++ ++ V+ F    V  L  WQ     L +  
Sbjct: 564 PFLLRGISY--WSKDSRQVYLLGNAVVWYSVTLFVVIFGLICVGELFVWQLGKPILSDTK 621

Query: 644 NWNVFLMGGFYPLLAWGLHYMPFVIMSRVTYVHHYLPALYFALIILAYCFDAGLQKWSRS 703
             N F +   + LL + +HY+P  +M R  ++HHYLPA YF ++ LA+  D  +   +R 
Sbjct: 622 ILN-FHIQTIHYLLGYFIHYLPSFLMGRQMFLHHYLPAYYFGILALAHGLDGLVTFLNRK 680

Query: 704 KCGRIMRFVLYAGFMALVIGCFWYFSPISFGME 736
              R + + L A F+   I  F  +SP+ +G++
Sbjct: 681 ---RPIAYGLVAMFVLGSIAFFVTYSPLVYGLQ 710

>YDL093W (PMT5) [774] chr4 (289909..292140) Member of the PMT
           O-mannosyltransferases family [2232 bp, 743 aa]
          Length = 743

 Score =  310 bits (794), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 216/674 (32%), Positives = 330/674 (48%), Gaps = 41/674 (6%)

Query: 69  VIFTALALFTRMYKIGINNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYLA 128
           +IFTA+    R++ I + N VV+ E   G F S Y+ + F+ DVHPPL  ML      + 
Sbjct: 53  LIFTAI---VRLHNISLPNSVVFGENEVGTFVSQYVNNIFFTDVHPPLVAMLYATVSSVF 109

Query: 129 GYNGSWDFPS-GEIYPDYLDYVKMRLFNASFSALCVPLAYFTAKAIGFSLPTVWLMTVLV 187
           GY G +++ + G  Y   + YV MR F+A+   + V + Y T +  G  +    +  V  
Sbjct: 110 GYKGLFNYGNIGTEYTANVPYVAMRFFSATLGIVSVLVLYLTLRVSGVKIAVAAICAVCF 169

Query: 188 LFENSYSTLGRFILLDSMLLFFTVASFFSFVMFHNQRSK---PFSRKWWKWLLITGISLG 244
             ENS+ TL RF L++   +FF   + + F     +RS+   P S K  K LL   I+LG
Sbjct: 170 AIENSFVTLSRFTLIEGPFVFFMACAVYFF-----RRSELYLPNSCKANKSLLAASIALG 224

Query: 245 CTISVKMVGLFIITMVGIYTVIDLWTFLADKSMSWKTYINHWLARIFGLIIVPFCIFLLC 304
             +S K  GLF I   GI  +  +W  + D S    + I +   +   L+ +P  I+ L 
Sbjct: 225 FAVSSKWAGLFTIAWAGIIVLWRVWFMIGDLSRPIGSSIKYMAFQFTCLLAIPAFIYFLI 284

Query: 305 FKIHFDLLSHSGTGDANMPSLFQARLVGSDV-GQGPRDIALGSSVVSIKNQALGGSLLHS 363
           F +H   L+ +G   +  P+ F+  L  ++V  +   ++A+GS+ VS+ +    G  LHS
Sbjct: 285 FSVHIKTLNVNGISSSFFPAEFRKTLKYNNVIKETVAEVAVGSA-VSLNHVGTAGGYLHS 343

Query: 364 HIQTYPDGSNQQQVTCYGYKDANNEWFFNRERGLPSWSENETDIEYLKPGTSYRLVHKST 423
           H+  YP GS QQQVT Y + D NN+W           +EN T  + L  GT  +L     
Sbjct: 344 HLHNYPAGSMQQQVTLYPHIDQNNKWIIELAEHP---NENVTSFQNLTDGTIIKLRQLKN 400

Query: 424 GRNLHTHPVAAPVSKT---QWEVSGYG-DNVVGDNKDNWVIEIMDQRGDEDP--EKLHTL 477
           G  LH+H    PVS+    Q EVS YG +   GD  D+W+IEI  +R +  P  E +  +
Sbjct: 401 GCRLHSHDHKPPVSQNADWQKEVSCYGYEGFEGDINDDWIIEIDKKRSEPGPAQEHIRAI 460

Query: 478 TTSFRIKNLEMGCYLAQTGNSLPEWGFRQQEVVCMKNPFKRDKRTWWNIETHENERLPPR 537
            T FR+K+   GCYL      LPEWGF QQEV C    F R+  T W IE +ENE   P 
Sbjct: 461 ETKFRLKHYLTGCYLFSHPEKLPEWGFGQQEVTCAY--FAREDLTSWYIEENENEISLPN 518

Query: 538 PEDFQYPKTNFLKDFIHLNLAMMATNNALVPDPDKFDYLASSAWQWPTLNVGLRLCGWGD 597
           PE   Y K +F + F+ ++  M   NN +    D     +S    WP +  G+    W +
Sbjct: 519 PEKVSYKKMSFWQKFVAIHKFMFYLNNYM----DTSHAYSSEPKTWPLMLRGIDF--WNE 572

Query: 598 DNPKYFLLGTPASTWASSVAVLAFMATVVILLIRWQRQYVDLRNPSNWNVFLMGGFYPLL 657
           +  + + LG     W+ +  +  F+  V + L+ W+     LR+    N F    F  LL
Sbjct: 573 NGREVYFLGNAVLWWSVTAFICTFIIGVAVELLAWKLGVNILRDKHIIN-FHYQVFQYLL 631

Query: 658 AWGLHYMPFVIMSRVTYVHHYLPALYFALIILAYCFD--AGLQKWSRSKCGRIMRFVLYA 715
            +  HY P+  + +  +++ YLPA YF ++   +  D  +      R+  G    +++ A
Sbjct: 632 GFAAHYFPYFFVGQKLFLYDYLPAYYFGILAFGHALDLISTYISNKRNNTG----YIVVA 687

Query: 716 GFMALVIGCFWYFS 729
            FM +   CF++FS
Sbjct: 688 IFMVV---CFYFFS 698

>KLLA0B03762g 339424..341742 similar to sp|P46971 Saccharomyces
           cerevisiae YJR143c PMT4
           dolichyl-phosphate-mannose--protein O-mannosyl
           transferase, start by similarity
          Length = 772

 Score =  297 bits (761), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 227/705 (32%), Positives = 335/705 (47%), Gaps = 51/705 (7%)

Query: 66  VMPVIFTALALFTRMYKIGINNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSG 125
           VM  + T LAL  R+++I     VV+DE HFGKF SYYL   ++ DVHPP+ KML+   G
Sbjct: 63  VMNYLVTGLALVLRLWRISEPREVVFDEVHFGKFASYYLERTYFFDVHPPMAKMLIAAIG 122

Query: 126 YLAGYNGSWDFPS-GEIYPDYLD-YVKMRLFNASFSALCVPLAYFTAKAIGFSLPTVWLM 183
           +L GYNGS+ F   G  Y  Y   +V  R  +A    L V + + T K + F   T ++ 
Sbjct: 123 WLTGYNGSFKFDDIGYSYDTYYAPFVAYRSLSAVLGVLTVSVVFQTMKELNFKAVTCFIA 182

Query: 184 TVLVLFENSYSTLGRFILLDSMLLFFTVASFFSFVMFHN-QRSKPFSRKWWKWLLITGIS 242
             L+  +N++ T  R ILLD+ML+F    S + +V F+  Q + PFS +W+ WL +TG S
Sbjct: 183 AFLIAVDNAHVTDTRLILLDAMLIFSIALSIYCYVRFYKLQLTSPFSSEWYLWLYLTGFS 242

Query: 243 LGCTISVKMVGLFIITMVGIYTVIDLWTFLADKS-MSWKTYINHWLARIFGLIIVPFCIF 301
           L   +S K VGL     +G+  V++LW  L  +S +S +  + H L RI GLII PF ++
Sbjct: 243 LSMVMSTKYVGLLTYCTIGLAVVVNLWQLLDIRSGLSMRKVVKHTLVRINGLIIFPFVVY 302

Query: 302 LLCFKIHFDLLSHSGTGDANMPSLFQARLVGSDVGQGPRDIALGSSVVSIKNQALGGSLL 361
           L  F  HF +L+ SG GDA M S FQ  L+ +      + I     +++IK++A   + L
Sbjct: 303 LFWFWCHFAILNQSGPGDAFMSSDFQDTLLDAPGAVEIKSINY-HDIITIKHKA-TDAFL 360

Query: 362 HSHIQTYP----DG---SNQQQVTCYGYKDANNEWFFNRERGLPSWSENETDIEYLKPGT 414
           HSH+  YP    DG   SN QQVTCY ++D NN+W    E   PS S+ +     +K   
Sbjct: 361 HSHLAKYPVRYEDGRISSNGQQVTCYSHEDINNQW----EILPPSGSKFKKGAP-VKLDA 415

Query: 415 SYRLVHKSTGRNLHTHPVAAPVSKTQWEVSGYGDNVV-GDNKDNWVIEIMDQRGDEDPEK 473
             RL H  T   L  H VA+P   T  EV+   +    G++ D  +              
Sbjct: 416 DIRLRHVGTNTYLLAHDVASPYYPTNEEVTTVSEEEANGESYDFTLFRFQPILPKNSGRV 475

Query: 474 LHTLTTSFRIKNLEMGCYL-AQTGNSLPEWGFRQQEVVCMKNPFKRDKRTWWNIETHENE 532
             T  ++FRI +++    L       LPEWGF QQEV   K    +D    W +++  N 
Sbjct: 476 AKTKNSAFRIFHVQTAVALWTHNDKLLPEWGFSQQEVNGNKK--VQDPENNWFVDSIVN- 532

Query: 533 RLPPRPEDFQY-PKT----NFLKDFIHLNLAMMATNNALVPDPDKFDYLASSAWQWPTLN 587
            +P       Y PK      F + +  L   M   NN L  +       AS+   WP   
Sbjct: 533 -MPENDSRRIYTPKVPTSMPFFQKWYELQFLMFEHNNKLSSEHP----FASNPQSWPLSL 587

Query: 588 VGLRLCGWGDDNPKYFLLGTPASTWASSVAVLAFMATVVILLIRWQRQYVDLRNPSNWNV 647
            G+      +   + F  G     W   V+V  ++  VV  LI  QR    L   +   +
Sbjct: 588 SGVSFWTKEEGRKQIFFTGNIVGWWFEIVSVALYLGLVVADLITRQRAVYALNKMARQKL 647

Query: 648 FLMGGFYPLLAWGLHYMPFVIMSRVTYVHHYLPA-LYFALIILA-------------YCF 693
           +    F  +  W +HY PF +M+R  ++HHYLPA L  A+   A             +  
Sbjct: 648 YGPMAFL-IFGWCIHYFPFFLMARQKFLHHYLPAHLILAMFSAALWEIVFTDNQSLDFDL 706

Query: 694 DAGLQKWSRSKCGRIMRFVLYAGFMALVI---GCFWYFSPISFGM 735
           D    K       ++     Y   +++++   GCF YF+P+ +G+
Sbjct: 707 DEEDSKNPHDAEPKVYTIAYYLFCLSVIVNVGGCFIYFAPLVYGL 751

>CAGL0M00220g 28137..30434 similar to sp|P46971 Saccharomyces
           cerevisiae YJR143c PMT4
           dolichyl-phosphate-mannose--protein O-mannosyl
           transferase, hypothetical start
          Length = 765

 Score =  288 bits (737), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 205/652 (31%), Positives = 318/652 (48%), Gaps = 39/652 (5%)

Query: 70  IFTALALFTRMYKIGINNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYLAG 129
           + TA+A   R YKI     VV+DE HFGKF SYYL   F+ DVHPPL KM++   G+L  
Sbjct: 64  LVTAIAFAVRFYKIYYPREVVFDEVHFGKFASYYLERTFFFDVHPPLAKMMIAFIGWLCN 123

Query: 130 YNGSWDFPS-GEIYPDY-LDYVKMRLFNASFSALCVPLAYFTAKAIGFSLPTVWLMTVLV 187
           Y+GS+ F   G  Y  +   ++  R FNA    L V + + + K + F   T +L ++LV
Sbjct: 124 YDGSFKFEEIGLSYDKHPAPFLAYRSFNALLGTLTVSIMFESMKELNFKAITCFLASMLV 183

Query: 188 LFENSYSTLGRFILLDSMLLFFTVASFFSFVMFHN-QRSKPFSRKWWKWLLITGISLGCT 246
             +N++ T  R ILLD++LL    A+ +S++ F+  Q  +PFS  W+ WL +TG SL C 
Sbjct: 184 AIDNAHVTETRLILLDAILLISVAATVYSYIRFYKLQLKEPFSWNWYIWLYLTGFSLSCV 243

Query: 247 ISVKMVGLFIITMVGIYTVIDLWTFL-ADKSMSWKTYINHWLARIFGLIIVPFCIFLLCF 305
           IS K +G+     +GI  V++LW  L  +  +S +  I H   R+ GLI++PF I+L  F
Sbjct: 244 ISTKYIGVMTYAAIGIPVVVNLWQLLDINAKLSIRMLIKHIGRRLNGLILIPFIIYLFWF 303

Query: 306 KIHFDLLSHSGTGDANMPSLFQARLVGSDVGQGPRDIALGSSVVSIKNQALGGSLLHSHI 365
            +HF +L+ SG GD  M S FQ  L  S+  +  +++     +V+ +NQ   G+ LHSH+
Sbjct: 304 YVHFAILNVSGPGDVFMSSEFQDTLHDSEATKLSKEVQF-FDIVTFENQD-TGAFLHSHL 361

Query: 366 QTYP-------DGSNQQQVTCYGYKDANNEWFFNRERGLPSWSENETDIEYLKPGTSYRL 418
             YP         S  QQVTCY ++D NN+W       LP   + + D   ++ G  +RL
Sbjct: 362 ARYPLRYEDDRVSSQGQQVTCYTHEDVNNQW-----EILPVADKAKGD--NIRFGDEFRL 414

Query: 419 VHKSTGRNLHTHPVAAPVSKTQWEVSG-YGDNVVGDNKDNWVIEIMDQRGDEDPEKLHTL 477
            H  T   L  H VA+P+  T  E++  + D+ +G   ++ +         ++   + + 
Sbjct: 415 RHVGTDSYLLAHDVASPLYPTNEEITTVHKDDALGARANSTIFRFQPINKKDEGHIIKSK 474

Query: 478 TTSFRIKNLEMGCYL-AQTGNSLPEWGFRQQEVVCMKNPFKRDKRTWWNIETHEN---ER 533
               RI + E    L +     LP+WGF QQEV   K     D    W I++  N   +R
Sbjct: 475 NAVLRIIHKETVVALWSHNDELLPDWGFGQQEVNGNKK--MTDSGNAWTIDSIMNLDEKR 532

Query: 534 LPPRPEDFQYPKTNFLKDFIHLNLAMMATNNALVPDPDKFDYLASSAWQWPTLNVGLRLC 593
               P++ +     F   ++ L   M   NN L  +       AS    WP    G+   
Sbjct: 533 SAYAPKEIK--SMPFFNKWLELQKLMFEQNNKLTSEHP----FASQPESWPGSMSGVSFW 586

Query: 594 GWGDDNPKYFLLGTPASTWASSVAVLAFMATVVILLIRWQRQYVDLRNPSNWNVFLMGGF 653
              ++  + + +G     W   ++   ++  ++   I  QR Y  L   +   ++     
Sbjct: 587 TKNEERRQIYFIGNIIGFWFQVISFAVYVGIIIADQITRQRGYFALNKVTREKLYGPLA- 645

Query: 654 YPLLAWGLHYMPFVIMSRVTYVHHYLPALYFALIILAYCFDAGLQKWSRSKC 705
           Y    W  HY PF +M R  ++HHYLPA      ++A  F AGL +   S+C
Sbjct: 646 YLFCGWACHYFPFFLMGRQKFLHHYLPAH-----LIAALFAAGLWETVFSRC 692

>Scas_442.1
          Length = 309

 Score =  266 bits (681), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 134/305 (43%), Positives = 193/305 (63%), Gaps = 20/305 (6%)

Query: 452 GDNKDNWVIEIMDQRGD-------EDPEKLHTLTTSFRIKNLEMGCYLAQTGNSLPEWGF 504
           GD  D+W++EI+DQ          ED   +H ++T FR+++  +GCYLA TG + P WGF
Sbjct: 6   GDVYDDWILEIVDQMDSGNPDFHKEDQNIVHPVSTFFRLRHKVLGCYLASTGLAYPSWGF 65

Query: 505 RQQEVVCMKNPFKRDKRTWWNIETHENERLPPRPEDFQYPKTNFLKDFIHLNLAMMATNN 564
           +Q E+VC K+   RDK TWWN+E H N++LP   ED+  PK+ F  DFI +N AM ++N+
Sbjct: 66  QQAEIVCKKSWSHRDKATWWNVEDHWNDQLPIE-EDYVPPKSKFWTDFILINFAMASSNS 124

Query: 565 ALVPDPDKFDYLASSAWQWPTLNVGLRLCGWGDDNPKYFLLGTPASTWASSVAVLAFMAT 624
           ALVPD DKFD LAS  W+WPTL+ GLRLC W  D  KY+LLG+P +TW S++++  F+  
Sbjct: 125 ALVPDADKFDPLASKPWEWPTLHRGLRLCSWSRDVYKYYLLGSPFNTWLSTLSLFLFVFI 184

Query: 625 VVILLIRWQRQYVDLRNPSNWNVFLMGGFYPLLAWGLHYMPFVIMSRVTYVHHYLPALYF 684
           +  +  +W+RQ+++L+    W + + G F P LAW  H+ PFV+M RVTYVHHYLPALYF
Sbjct: 185 ISKIAYQWRRQHLNLQEDQLWRLGIQGIF-PFLAWITHFFPFVMMGRVTYVHHYLPALYF 243

Query: 685 ALIILAYCFDAGLQKWSRSKCGRIMRFVLYAGFMALVIGC---FWYFSPISFGMEGPSSN 741
           A++   +  D  +        GR   F+ Y  ++AL +GC   +  F+PI  G+ G  + 
Sbjct: 244 AILTFGFVLDYSI--------GRANPFIKYPIYLALFVGCTYIYVLFAPICQGLHGDVAK 295

Query: 742 FRYLN 746
           +  L 
Sbjct: 296 YLRLE 300

>ABL085W [507] [Homologous to ScYJR143C (PMT4) - SH]
           complement(237967..240240) [2274 bp, 757 aa]
          Length = 757

 Score =  280 bits (715), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 212/722 (29%), Positives = 342/722 (47%), Gaps = 62/722 (8%)

Query: 51  EKPAAQSSLLRLESVVMPVIFTALALFTRMYKIGINNHVVWDEAHFGKFGSYYLRHEFYH 110
           ++PA  S+L   +      + TA+A   R +K+   + VV+DE HFGK  SYYL   ++ 
Sbjct: 37  QRPAPDSNL---KYKYYGYMVTAIAFAVRFHKLYHPSEVVFDEVHFGKCASYYLERTYFF 93

Query: 111 DVHPPLGKMLVGLSGYLAGYNGSWDFPS-GEIYPDY-LDYVKMRLFNASFSALCVPLAYF 168
           DVHPP  KML+   G+L GY+G++ F   G  Y  + + Y+  R  +A    L VPL + 
Sbjct: 94  DVHPPFSKMLIAFVGWLVGYDGAFKFDDIGYSYETHQVPYIAYRSLSAILGTLTVPLVFS 153

Query: 169 TAKAIGFSLPTVWLMTVLVLFENSYSTLGRFILLDSMLLFFTVASFFSFVMFHN-QRSKP 227
             + + F   T     +LV  +N++    R ILLD+ L+     S ++++ F+  Q   P
Sbjct: 154 ILRELNFKAITCAFGALLVAVDNAHVIDSRLILLDATLVISVALSIYTYIRFYKAQLRAP 213

Query: 228 FSRKWWKWLLITGISLGCTISVKMVGLFIITMVGIYTVIDLWTFLADKS-MSWKTYINHW 286
            S +W+ WL  TG+SL   IS K VG+F   M+G   +++LW  L  ++ +S + +  H+
Sbjct: 214 LSSEWYFWLYATGLSLSFVISTKYVGVFTFAMIGTAVIVNLWQLLDVRAGLSLRMFFRHF 273

Query: 287 LARIFGLIIVPFCIFLLCFKIHFDLLSHSGTGDANMPSLFQARLVGSDVGQGPRDIALGS 346
           + R  GL+  PF ++L  F +HF +L+ SG GD  M S FQ  L  S + +  +D+    
Sbjct: 274 VQRFNGLVCFPFAVYLFWFYVHFAILTKSGPGDDFMSSAFQETLADSPLAKDSKDVHY-Y 332

Query: 347 SVVSIKNQALGGSLLHSHIQTYP----DG---SNQQQVTCYGYKDANNEWFFNRERGLPS 399
            +V+ +++   G+LLHSH   YP    DG   S  QQVT Y ++D NN+W     + L S
Sbjct: 333 DIVTFQHRD-TGALLHSHNAYYPLRYEDGRVSSQGQQVTGYSHEDINNQWEILPTKELSS 391

Query: 400 WSENETDIEYLKPGTSYRLVHKSTGRNLHTHPVAAPVSKTQWEVSGYGDNVV-GDNKDNW 458
            +     ++        RL H +TG  L TH VA+P   T  EV+   + +  G+     
Sbjct: 392 RTGQPVLLD-----DVLRLRHIATGTYLLTHDVASPYYPTNEEVTTISEELANGERYKQT 446

Query: 459 VIEIMDQRGDEDPEKLHTLTTSFRIKNLEMGCYL-AQTGNSLPEWGFRQQEVVCMKNPFK 517
           + ++      +    + + T+ FR+ +++    L       LPEWGF+QQEV   K    
Sbjct: 447 LFKLQPPNKKDGGHTVKSKTSMFRMFHVDTAVALWTHNDVFLPEWGFKQQEVNGNKK--V 504

Query: 518 RDKRTWWNIETHEN---ERLPPRPEDFQYPKTNFLKDFIHLNLAMMATNNALVPDPDKFD 574
            D    W + +  N   ER    P+  +  K  F   ++ L  +M   NN L  +     
Sbjct: 505 TDPANIWTVNSILNLSEERKVYIPK--KVTKMPFFSKWLELQRSMFEHNNKLSSEHP--- 559

Query: 575 YLASSAWQWPTLNVGLRLCGWGDDNPKYFLLGTPASTWASSVAVLAFMATVVILLIRWQR 634
             AS    WP    G+       +  + +  G     W   +++  F+  ++   I  QR
Sbjct: 560 -FASQPESWPGSLSGVSFWTNDTERRQIYFTGNIIGWWIELISLALFVGILLADAITRQR 618

Query: 635 QYVDLRNPSNWNVFLMGGFYPLLAWGLHYMPFVIMSRVTYVHHYLPALYFALIILAYCFD 694
            +  L   +   ++    F   + W +HY PF +M R  ++HHYLPA      ++A  F 
Sbjct: 619 SFFVLGKLAREKIYGPLCFL-YIGWAIHYFPFFLMGRQKFLHHYLPAH-----LIAAMFT 672

Query: 695 AGLQKW----SRSKCGR---------------IMRFVLYA--GFMAL-VIGCFWYFSPIS 732
           AGL +     +R+   R               +  + L A  G +++ V+G F YFSPI 
Sbjct: 673 AGLWEVIFTDNRALTTRKDESEPAAPHNTNPIVYEYFLLAFLGLLSIAVVGFFIYFSPIV 732

Query: 733 FG 734
           +G
Sbjct: 733 YG 734

>YJR143C (PMT4) [3035] chr10 complement(698241..700529)
           Mannosyltransferase (dolichyl
           phosphate-D-mannose:protein O-D-mannosyltransferase),
           involved in initiation of O-glycosylation [2289 bp, 762
           aa]
          Length = 762

 Score =  274 bits (701), Expect = 6e-81,   Method: Compositional matrix adjust.
 Identities = 213/704 (30%), Positives = 334/704 (47%), Gaps = 61/704 (8%)

Query: 70  IFTALALFTRMYKIGINNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYLAG 129
           I T LA   R YKI     VV+DE HFGKF SYYL   ++ DVHPP  KM++   G+L G
Sbjct: 58  IVTLLAFAARFYKIWYPKEVVFDEVHFGKFASYYLERSYFFDVHPPFAKMMIAFIGWLCG 117

Query: 130 YNGSWDFP----SGEIYPDYLDYVKMRLFNASFSALCVPLAYFTAKAIGFSLPTVWLMTV 185
           Y+GS+ F     S E +P    Y+  R FNA    L VP+ + T K + F   T    ++
Sbjct: 118 YDGSFKFDEIGYSYETHP--APYIAYRSFNAILGTLTVPIMFNTLKELNFRAITCAFASL 175

Query: 186 LVLFENSYSTLGRFILLDSMLLFFTVASFFSFVMFHN-QRSKPFSRKWWKWLLITGISLG 244
           LV  + ++ T  R ILLD++L+    A+ + +V F+  Q  +PF+  W+ WL  TG+SL 
Sbjct: 176 LVAIDTAHVTETRLILLDAILIISIAATMYCYVRFYKCQLRQPFTWSWYIWLHATGLSLS 235

Query: 245 CTISVKMVGLFIITMVGIYTVIDLWTFLADKS-MSWKTYINHWLARIFGLIIVPFCIFLL 303
             IS K VG+   + +G   V++LW  L  K+ +S + ++ H+  R+ GL+++PF I+L 
Sbjct: 236 FVISTKYVGVMTYSAIGFAAVVNLWQLLDIKAGLSLRQFMRHFSKRLNGLVLIPFVIYLF 295

Query: 304 CFKIHFDLLSHSGTGDANMPSLFQARLVGSDVGQGPRDIALGSSVVSIKNQALGGSLLHS 363
            F +HF +L+ SG GDA M + FQ  L  S +    + +     +++IK+Q    + LHS
Sbjct: 296 WFWVHFTVLNTSGPGDAFMSAEFQETLKDSPLSVDSKTVNY-FDIITIKHQD-TDAFLHS 353

Query: 364 HIQTYP----DG---SNQQQVTCYGYKDANNEWFFNRERGLPSWSENETDIEYLKPGTSY 416
           H+  YP    DG   S  QQVT Y + D NN+W       LP    +    + +      
Sbjct: 354 HLARYPQRYEDGRISSAGQQVTGYTHPDFNNQW-----EVLPPHGSDVGKGQAVLLNQHI 408

Query: 417 RLVHKSTGRNLHTHPVAAPVSKTQWEVSGY----GDNVVGDNKDNWVIEIMDQRGDEDPE 472
           RL H +T   L  H VA+P   T  E++      GD   G+     +      +  ++  
Sbjct: 409 RLRHVATDTYLLAHDVASPFYPTNEEITTVTLEEGD---GELYPETLFAFQPLKKSDEGH 465

Query: 473 KLHTLTTSFRIKNLEMGCYL-AQTGNSLPEWGFRQQEVVCMKNPFKRDKRTWWNIETHEN 531
            L + T SFR+ +++    L       LP+WGF+QQE+   K     D    W ++   N
Sbjct: 466 VLKSKTVSFRLFHVDTSVALWTHNDELLPDWGFQQQEINGNKKVI--DPSNNWVVDEIVN 523

Query: 532 ERLPPRPEDFQYPKT----NFLKDFIHLNLAMMATNNALVPDPDKFDYLASSAWQWPTLN 587
                       PK      FLK +I    +M   NN L  +       AS  + WP   
Sbjct: 524 LD---EVRKVYIPKVVKPLPFLKKWIETQKSMFEHNNKLSSEHP----FASEPYSWPGSL 576

Query: 588 VGLRLCGWGDDNPKYFLLGTPASTWASSVAVLAFMATVVILLIRWQRQYVDLRNPSNWNV 647
            G+     GD+  + + +G     W   +++  F+  +V  LI   R Y  L   +   +
Sbjct: 577 SGVSFWTNGDEKKQIYFIGNIIGWWFQVISLAVFVGIIVADLITRHRGYYALNKMTREKL 636

Query: 648 FLMGGFYPLLAWGLHYMPFVIMSRVTYVHHYLPALYFAL--------IILAYCFDAGLQK 699
           +    F+  ++W  HY PF +M+R  ++HHYLPA   A         +I + C    L+K
Sbjct: 637 YGPLMFF-FVSWCCHYFPFFLMARQKFLHHYLPAHLIACLFSGALWEVIFSDCKSLDLEK 695

Query: 700 --------WSRSKCGRIMRFVLYAGFMALVIGCFW-YFSPISFG 734
                   + R+    +  + ++   ++  +  F+ YFSP+ +G
Sbjct: 696 DEDISGASYERNPKVYVKPYTVFLVCVSCAVAWFFVYFSPLVYG 739

>Scas_710.1
          Length = 919

 Score =  274 bits (700), Expect = 9e-80,   Method: Compositional matrix adjust.
 Identities = 204/662 (30%), Positives = 315/662 (47%), Gaps = 34/662 (5%)

Query: 48  FSKEKPAAQSSLLRLESVVMPVIFT----ALALFTRMYKIGINNHVVWDEAHFGKFGSYY 103
           F   +P+     LR  S    +I      A     R++ +G  N VV+DEA +G   S Y
Sbjct: 31  FIDTEPSQDLVQLRTISTTHEIILVLSLLAFTALIRLHDLGWPNGVVFDEAVYGNIVSKY 90

Query: 104 LRHEFYHDVHPPLGKMLVGLSGYLAGYNGSWDFPS-GEIYPDYLDYVKMRLFNASFSALC 162
           L++  + DVHPPL K+L     +  G+ G ++F   G  +P    Y  MRLF+A+  +L 
Sbjct: 91  LKNILFVDVHPPLIKLLYAGIAHFLGFEGQFEFNDIGVPFPTTTPYYAMRLFSATLGSLT 150

Query: 163 VPLAYFTAKAIGFSLPTVWLMTVLVLFENSYSTLGRFILLDSMLLFFTVASFFSFVMFHN 222
           V L Y T +A G  +      ++ ++ ENS+ T+ R I+L+  L+FF  A+     ++  
Sbjct: 151 VLLMYLTLRASGVRIWVALAGSICLVIENSFVTVSRHIMLEGPLMFFIAAA-----VYFT 205

Query: 223 QRSKPF---SRKWWKWLLITGISLGCTISVKMVGLFIITMVGIYTVIDLWTFLADKSMSW 279
           ++S  F   S   +  + I  ++LG  IS K VG+  +   G+  V  LW  + + SM  
Sbjct: 206 KKSDLFKADSCNSYINIGIAAVALGLAISSKWVGVATLIWAGLICVWRLWFMVGNLSMPV 265

Query: 280 KTYINHWLARIFGLIIVPFCIFLLCFKIHFDLLS-HSGTGDANMPSLFQARLVGSDVGQG 338
                  L + F LI +P  +++L F  HF     +S       P         S V   
Sbjct: 266 CGSFKVALIKAFTLIFLPIILYILTFYFHFQYTGINSDVSQLFTPEFRTTLANNSVVNNV 325

Query: 339 PRDIALGSSVVSIKNQALGGSLLHSHIQTYPDGSNQQQVTCYGYKDANNEWFFNRERGLP 398
             +IA+G S++++++    G  LHSH   Y  GSNQQQ+TCY Y D N+ W       +P
Sbjct: 326 VAEIAVG-SMITLRHPGTHGGYLHSHDAFYEKGSNQQQITCYPYVDKNDNWTVEL-YDVP 383

Query: 399 SWSENETDIEYLKPGTSYRLVHKSTGRNLHTHPVAAPVSKT---QWEVSGYG-DNVVGDN 454
              EN T  + L  GT  RL+H +TG  LH+H    PVS+    Q EVS YG     GD 
Sbjct: 384 --LENITSFQNLTDGTKIRLLH-NTGCRLHSHDHKPPVSENSDWQKEVSCYGYPGFEGDA 440

Query: 455 KDNWVIEIMDQRG--DEDPEKLHTLTTSFRIKNLEMGCYLAQTGNSLPEWGFRQQEVVCM 512
            D+W+IEI        E  E +  + T FR+K+  MGCYL      LP+ GF QQEV C 
Sbjct: 441 NDDWIIEIDKDASIPGESQEHVRAIETKFRLKHAIMGCYLFSHNTMLPKLGFEQQEVTCA 500

Query: 513 KNPFKRDKRTWWNIETHENERLPPRPEDFQYPKTNFLKDFIHLNLAMMATNNALVPDPDK 572
            +    D  T W++E +EN  +    E   Y   +F K F+  +  M+   + +    D 
Sbjct: 501 YSGI--DSLTLWSVENNENPFVSDDAERVSYEPLSFWKKFVETHKRMLEIASGM----DN 554

Query: 573 FDYLASSAWQWPTLNVGLRLCGWGDDNPKYFLLGTPASTWASSVAVLAFMATVVILLIRW 632
                S    WP +  G+    W + +   +LLG     W+ +  ++ F   VV  L+  
Sbjct: 555 THMYESKPATWPFMLRGIDF--WSEQHQDIYLLGNAVLWWSVTAFIVGFAGIVVWELVSL 612

Query: 633 QRQYVDLRNPSNWNVFLMGGFYPLLAWGLHYMPFVIMSRVTYVHHYLPALYFALIILAYC 692
           Q  Y   ++P   N  +    Y LL + L+++P +++    +++HYLPA YF ++ L + 
Sbjct: 613 QLGYEFSKDPHVINFHIQVIQY-LLGFLLNFIPSLLLENQIFLYHYLPAYYFGILALTHG 671

Query: 693 FD 694
            D
Sbjct: 672 LD 673

>Scas_719.80
          Length = 762

 Score =  264 bits (675), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 218/717 (30%), Positives = 333/717 (46%), Gaps = 65/717 (9%)

Query: 58  SLLRLESVVMPVIFTALALFTRMYKIGINNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLG 117
           S LR  +++  V  T +A   R Y I     VV+DE HFGKF SYYL   ++ DVHPP  
Sbjct: 48  SALRYNALLYTV--TLIAFVARFYMIWYPKEVVFDEVHFGKFASYYLERTYFFDVHPPFA 105

Query: 118 KMLVGLSGYLAGYNGSWDFPSGEIYPDY----LDYVKMRLFNASFSALCVPLAYFTAKAI 173
           KM +   G+L GYNGS+ F   EI   Y      Y+  R FNA    L V + + T K +
Sbjct: 106 KMAIAFIGWLVGYNGSFKF--DEIGSSYQTNPAPYIAYRSFNAMLGTLTVSIMFNTLKEL 163

Query: 174 GFSLPTVWLMTVLVLFENSYSTLGRFILLDSMLLFFTVASFFSFVMFHN-QRSKPFSRKW 232
            F   T +   +LV  +N++ T  R ILLD++LL    ASF+SFV F+  Q   PFS +W
Sbjct: 164 NFKAITCFFGALLVAVDNAHVTETRLILLDAILLISIAASFYSFVRFYKAQLRAPFSPQW 223

Query: 233 WKWLLITGISLGCTISVKMVGLFIITMVGIYTVIDLWTFLADKS-MSWKTYINHWLARIF 291
           + WL +TG+SL   IS K +G+     +G   +++LW  L  ++ ++ + +  H++ R+ 
Sbjct: 224 YIWLHLTGLSLSFVISTKYIGVMTYAAIGTGVIVNLWQLLDLRANLTLRAFFRHFVKRLN 283

Query: 292 GLIIVPFCIFLLCFKIHFDLLSHSGTGDANMPSLFQARLVGSDVGQGPRDIALGSSVVSI 351
           GL+  PFCI+L  F +HF +LS SG GDA M + FQ  L  S +    +++     ++++
Sbjct: 284 GLVFAPFCIYLFWFWVHFAILSKSGPGDAFMSAEFQETLGDSPMSILSKEVHF-YDIITL 342

Query: 352 KNQALGGSLLHSHIQTYP----DG---SNQQQVTCYGYKDANNEWFFNRERGLPSWSENE 404
           K++    + LHSH   YP    DG   S  QQVT +   D +N+W     R L   S   
Sbjct: 343 KHKD-TEAFLHSHQAFYPLRYEDGRISSEGQQVTGFTGTDISNDWEVLPTRELD--SHKG 399

Query: 405 TDIEYLKPGTSYRLVHKSTGRNLHTHPVAAPVSKTQWEVSGYGDNVV-GDNKDNWVIEIM 463
             +   +P    RL H ++   L  H VA+P   T  E++   + +  G++    V    
Sbjct: 400 VPVVLNEP---IRLRHVASNTYLLAHDVASPFYPTNEEITTVSEEIANGESYQQTVFTFQ 456

Query: 464 DQRGDEDPEKLHTLTTSFRIKNLEMGCYL-AQTGNSLPEWGFRQQEVVCMKNPFKRDKRT 522
             +  ++   + T    F+I +      L       LP+WGF QQEV   KN    D   
Sbjct: 457 PLKKGDEGHVVKTKGVQFKIYHPNTDVVLWTHNDVLLPDWGFEQQEVNGSKN--FGDPTN 514

Query: 523 WWNIETHEN---ERLPPRPEDFQYPKTNFLKDFIHLNLAMMATNNALVPDPDKFDYLASS 579
            W+++   N   +R    P+  +    +F + +  L  +M   NN L  +       AS 
Sbjct: 515 AWSVDEITNLDEDRKKFTPKVVK--PMSFFRKWSELQKSMFEQNNKLSAEHP----FASQ 568

Query: 580 AWQWPTLNVGLRLCGWGDDNPKYFLLGTPASTWASSVAVLAFMATVVILLIRWQRQYVDL 639
              WP    G+      ++  + F        W   +++  F+  ++   I  +R Y  L
Sbjct: 569 PQSWPAGLCGVSFWTKSEERKQIFFTANIIGWWFQVISMSVFIGILLADQISRKRGYFVL 628

Query: 640 RNPSNWNVFLMGGFYPLLAWGLHYMPFVIMSRVTYVHHYLPALYFALIILAYCFDAGLQK 699
              +   ++    F   ++WG HY PF +M R  ++HHYLPA    LII    F AGL +
Sbjct: 629 GKITREKLYGPLAFL-FISWGCHYAPFFLMHRQKFLHHYLPA---HLII--SLFTAGLWE 682

Query: 700 WSRSKCG-------------------RIMRFVLYAGFMALVIGCFW---YFSPISFG 734
              S C                    +I    L   F+A+ I   W   YFSP+ +G
Sbjct: 683 VVFSDCKSIDASRDEEIEGTPYKADPKINSTSLTVFFVAVSIAIVWFFIYFSPLVYG 739

>Kwal_47.16734
          Length = 792

 Score =  263 bits (672), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 204/702 (29%), Positives = 312/702 (44%), Gaps = 51/702 (7%)

Query: 72  TALALFTRMYKIGINNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYLAGYN 131
           T LA   R  K+     VV+DE HFGKF SYYL   ++ DVHPP  KML+   G+L GYN
Sbjct: 90  TLLAAVVRFRKLSYPREVVFDEVHFGKFASYYLERTYFFDVHPPFAKMLIAFVGWLVGYN 149

Query: 132 GSWDFPSGEIYPDY--LDYVKMRLFNASFSALCVPLAYFTAKAIGFSLPTVWLMTVLVLF 189
           G++ F    +  D     +V  R  +A    L VP+ + T K + F   T  L  +LV  
Sbjct: 150 GTFKFDDIGLSYDSNPAPFVAYRSLSAILGTLTVPIIFNTVKELNFRAVTCALAALLVAI 209

Query: 190 ENSYSTLGRFILLDSMLLFFTVASFFSFVMFHN-QRSKPFSRKWWKWLLITGISLGCTIS 248
           + ++    R ILLD+ LL     S + +V F+  Q   PFS  W+ WL +TG SL   +S
Sbjct: 210 DCAHVIDSRLILLDATLLIAVACSLYCYVRFYKIQLKAPFSSSWYLWLYLTGTSLSFVMS 269

Query: 249 VKMVGLFIITMVGIYTVIDLWTFLADKS-MSWKTYINHWLARIFGLIIVPFCIFLLCFKI 307
            K +G+     +G    ++LW  L  ++ ++ + ++ H L R+ GLI  PF ++L  F +
Sbjct: 270 TKYIGVMTYATIGSAVAVNLWQLLDVRAGLTIRQFVKHVLQRLNGLIFAPFVLYLFWFWV 329

Query: 308 HFDLLSHSGTGDANMPSLFQARLVGSDVGQGPRDIALGSSVVSIKNQALGGSLLHSHIQT 367
           HF +L  SG GD  M S FQ  L  S + +  R +     ++++K++ +  + LHSH++ 
Sbjct: 330 HFAILIRSGPGDDFMSSQFQETLSDSPLAREARQVNYF-DIITLKHK-VTDAYLHSHLER 387

Query: 368 YP----DG---SNQQQVTCYGYKDANNEWFFNRERGLPSWSENETDIEYLKPGTSYRLVH 420
           YP    DG   SN QQVT Y  +D NN+W     + LP+       ++ +      R  H
Sbjct: 388 YPIRYEDGRVSSNGQQVTGYTLEDVNNQWEVLPTKQLPAREGQPVHLDDV-----VRFRH 442

Query: 421 KSTGRNLHTHPVAAPVSKTQWEVSGYGDNVV-GDNKDNWVIEIMDQRGDEDPEKLHTLTT 479
             T   L  H VA+P+  T  E++   + +  G N    +  +      +  + L +  +
Sbjct: 443 VVTNTFLLAHDVASPLYPTNEEITTVEEEMANGANYPETLFRLQSVNKGDSEDVLKSKAS 502

Query: 480 SFRIKNLEMGCYL-AQTGNSLPEWGFRQQEVVCMKNPFKRDKRTWWNIETHENERLPPRP 538
            FRI +++    L       LPEWGF+QQEV   K     D    W  ET  N       
Sbjct: 503 VFRIVHIDTTVALWTHNDVLLPEWGFKQQEVNGNKKII--DPENSWFAETIVN---IDEA 557

Query: 539 EDFQYPKTN----FLKDFIHLNLAMMATNNALVPDPDKFDYLASSAWQWPTLNVGLRLCG 594
                PKT     F   ++ L   M   NN L          ASS   WP    G+    
Sbjct: 558 RSVYVPKTRKKLPFFTKWMELQRLMFEHNNKLSSSHP----FASSPESWPGSLSGVSFWT 613

Query: 595 WGDDNPKYFLLGTPASTWASSVAVLAFMATVVILLIRWQRQYVDLRNPSNWNVFLMGGFY 654
              +  + + +G     W   V++  F       L+  +R    L   +   +     F 
Sbjct: 614 KDSERIQIYFIGNIIGWWFQVVSIALFCGVTAADLLVRRRGIFPLNKMAKQKLNAPLSFL 673

Query: 655 PLLAWGLHYMPFVIMSRVTYVHHYLPALYFALIILAYCFDA--------GLQKWSRSKCG 706
             + W  H++PF +M R  ++HHYLPA   A +  A  ++          L+K       
Sbjct: 674 -FVGWLCHFVPFFLMGRQKFLHHYLPAHLIASMFSAAMWETIFTDNKSLNLEKDEEDPAN 732

Query: 707 --------RIMRFVLYAGFMA-LVIGCFWYFSPISFGMEGPS 739
                     +  +L+   M+  +I  F YFSPI +G +  S
Sbjct: 733 AHEANPHLNYIPLILFVLVMSGALIWFFVYFSPIVYGDQSLS 774

>CAGL0L07172g complement(796354..798687) similar to sp|P33775
           Saccharomyces cerevisiae YDL095w PMT1
           mannosyltransferase or sp|P52867 Saccharomyces
           cerevisiae YDL093w PMT5, start by similarity
          Length = 777

 Score =  211 bits (538), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 183/643 (28%), Positives = 285/643 (44%), Gaps = 33/643 (5%)

Query: 66  VMPVIFTALALFTRMYKIGINNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSG 125
           ++  I    A+ TR Y IG    +V+DE       S Y    F  DV PPLGKM+    G
Sbjct: 62  ILMAIVALFAIVTRFYDIGFPKAIVYDEGFVIAEVSKYFNKTFSIDVFPPLGKMIYYFVG 121

Query: 126 YLAGYNGSWDF-PSGEIYPDYLDYVKMRLFNASFSALCVPLAYFTAKAIGFSLPTVWLMT 184
              G++ S+ + P G  + +   Y+  R   A   A  V   + T +A G S P   + +
Sbjct: 122 KYTGFDTSYKYHPVGTQFENASVYLPERYLAAGLGACVVVFFFMTLRASGVSRPIAGIFS 181

Query: 185 VLVLFENSYSTLGRFILLDSMLLFFTVASFFSFVMFHNQRSKPFSRKWWKWLLITGISLG 244
           V +  ENS+ T  R++ LD+  LFF  A+ +      N R+   S ++          LG
Sbjct: 182 VALSLENSFITASRYVHLDAPFLFFVAAAIYFTKKSDNLRAG--SGRYIFTFTHAACLLG 239

Query: 245 CTISVKMVGLFIITMVGIYTVIDLWTFLADKSMSWKTYINHWLARIFGLIIVPFCIFLLC 304
             IS K  GLF++  V I T+  LW    D S+     +  ++  +  L +VP  I+   
Sbjct: 240 LAISTKWAGLFVLAWVAIVTLWRLWLLAGDLSVPICRTVKVFIFNLLVLSLVPAVIYFSI 299

Query: 305 FKIHFDLLSHSGTGDANMPSLFQARLVGSDV-GQGPRDIALGSSVVSIKNQALGGSLLHS 363
           F  H    +  G     M   F++ L  + V  +   D+ +G + V + N  + G  + +
Sbjct: 300 FSWHIGSRTVDGNDSILMKPEFRSELYNNTVIKESFADVVVGGT-VRLNNIGMDGGFVEA 358

Query: 364 HIQTYPDGSNQQQVTCYGYKDANNEW---FFNRERGLPSWSENETDIEYLKPGTSYRLVH 420
               Y  GS Q+Q+     +    +W   ++NR    P   EN      LK     RL  
Sbjct: 359 APAYYEAGSKQRQIDLRKNESVTTDWVVEYYNRSGSTPKSFEN------LKNHEKIRLYS 412

Query: 421 KSTGRNLHTHPVAAPVSKT---QWEVSGYG-DNVVGDNKDNWVIEIMDQRGD--EDPEKL 474
                 LH+H   AP+S+    Q EVS YG +  +GD  D+W++EI     +  E  E +
Sbjct: 413 PKYKCRLHSHDHKAPISQHVDWQKEVSCYGYEGFMGDPNDDWIVEIDQDLSEPGEAREFV 472

Query: 475 HTLTTSFRIKNLEMGCYLAQTGNSL--PEWGFRQQEVVCMKNPFKRDKRTWWNIETHE-N 531
             + T FR+K+   GCYL      +  PE+     E+ C  +   + + T WNIE  + +
Sbjct: 473 KAIDTKFRLKHAMSGCYLFTHDVRMRTPEF-VMDYEIACAHS--GKYELTLWNIEQDQPH 529

Query: 532 ERLPPRPEDFQYPKTNFLKDFIHLNLAMMATNNALVPDPDKFDYLASSAWQWPTLNVGLR 591
              P  P+   Y K   LKD I L+L       A V   DK   L +    WP L  G+ 
Sbjct: 530 PNSPKNPKRVSY-KPMSLKDKI-LDLHAKMIEKAKV-RTDK-SSLITFPTTWPLLEKGIP 585

Query: 592 LCGWGDDNPKYFLLGTPASTWASSVAVLAFMATVVILLIRWQRQYVDLRNPSNWNVFLMG 651
              W     + + LG PA  W+ S  ++ F+   V  LI WQ  +    NP   N  +  
Sbjct: 586 F--WNGFARQIYFLGNPAMWWSVSAFIVLFVVAFVGELIFWQMGFEISSNPQFINFHIQV 643

Query: 652 GFYPLLAWGLHYMPFVIMSRVTYVHHYLPALYFALIILAYCFD 694
             Y  + + L+Y+P+++ +   +++ YLPA YF L+ LA+ F+
Sbjct: 644 LQYG-IGFALNYVPYILTTDRHHLYQYLPAYYFGLLALAHVFE 685

>Scas_30.1
          Length = 128

 Score =  162 bits (409), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 89/110 (80%)

Query: 637 VDLRNPSNWNVFLMGGFYPLLAWGLHYMPFVIMSRVTYVHHYLPALYFALIILAYCFDAG 696
           VD  NP + N FLMG FYPLL WGLHY+PFVIMSRVTYVHHYLPALYFAL+ILAY FD  
Sbjct: 11  VDFANPEDLNTFLMGAFYPLLGWGLHYLPFVIMSRVTYVHHYLPALYFALLILAYLFDFF 70

Query: 697 LQKWSRSKCGRIMRFVLYAGFMALVIGCFWYFSPISFGMEGPSSNFRYLN 746
           ++KW++SKCG I +  +Y  + A++I  F+YFSPISFGM+GPS N+ YLN
Sbjct: 71  MKKWTKSKCGSITKLAIYFCYYAVIIYGFYYFSPISFGMDGPSQNYSYLN 120

>Sklu_2215.6 YDR307W, Contig c2215 9395-11356 reverse complement
          Length = 653

 Score =  174 bits (441), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 183/673 (27%), Positives = 296/673 (43%), Gaps = 70/673 (10%)

Query: 64  SVVMPVIFTALALFTRMYKI-GINNHVVWDEAHFGKFGS--YYLRHEFYHDVHPPLGKML 120
           S++  +I   +ALF  ++++  +N  +          GS  +YL HEFY D  PPL   L
Sbjct: 29  SIIDSLIAVLIALFFVLFQLTKVNGELGTSVQEKEILGSIDHYLSHEFYLDSRPPLSVQL 88

Query: 121 VGLSGYLAGYNGSWDFPSGEIYPDYLDYVKMRLFNASFSALCVPLAYFTAKAIGFSLPTV 180
             L            F  GE+  + L     R    S   + + L Y     +G    +V
Sbjct: 89  FSL----------LTFVYGELSVELL-----RAATTSCGGIALVLLY-----LGLRKSSV 128

Query: 181 -WLMTVLVLFENSYSTLGRFILL----DSMLLFFTVASFFSFVMFHNQRSKPFSRKWWKW 235
             +++V+ +   SY  + R   L    D   + F   S +S+  F  + +KPFS+ W K+
Sbjct: 129 NRVISVIAVVSFSYLKVFREETLRVSTDIFQVCFLAMSLYSWKSF--KAAKPFSKTWHKY 186

Query: 236 LLITGISLGCTISVKMVGLFIITMVGIYTVIDLWTFLADKSMSWKTYINHWLARIFGLII 295
           LL   ISLG +IS K VG    + +   +++ LW  +AD  ++ K    H + R   L++
Sbjct: 187 LLFLSISLGLSISNKFVGFMTWSWILSLSIVQLWNIIADVRLTGKQVFTHCVLRFMALVL 246

Query: 296 VPFCIFLLCFKIHFDLLSHSGTGDAN-MPSLFQARLVGSDVGQ--GPRDIALGSSVVSIK 352
           VP  +FLL +  H   L+   T  +  M   ++  L  + + +   P  +  GS++    
Sbjct: 247 VPAIVFLLSYYAHISTLTQDLTDFSTFMSPYYKHTLENNPLNKIVPPGRVYYGSTITIRH 306

Query: 353 NQALGGSLLHSHIQTYPDGSNQQQVTCYGYKDANNEWFFNRERGLPSWSENETDIEYLKP 412
             +LGG  LHSH   Y  GS++QQVT Y + D NNEW    ++     S     +   K 
Sbjct: 307 KDSLGG-YLHSHELNYQSGSHEQQVTLYDFPDNNNEWIVEHKKENKDVSSKAVAV---KN 362

Query: 413 GTSYRLVHKSTGRNLHTHPVAAPVSKTQW--EVSGYGD-NVVGDNKDNWVIEIMDQRGDE 469
           G + RL H+ TG+ L       PVS+  +  EVS  GD N  G + + W I    +    
Sbjct: 363 GENIRLRHRLTGKLLRASGAKPPVSEQDYDREVSCTGDANYTGQSDELWKIRFSGRL--- 419

Query: 470 DPEKLHTLTTSFRIKNLEMGCYLAQTGNSLPEWGFRQQEVVCMKNPFKRDKRTWWNIETH 529
             E L  L T+F++ N   GC L      LPEW   QQEV+C+  P K  +RT + +E+ 
Sbjct: 420 -LEGLVPLDTTFQLTNQGQGCTLLSHDLRLPEWALFQQEVLCLDPPTK--ERTLFYVESS 476

Query: 530 ENERLPPRPEDFQYPKTNFLKDFIHLNLAMMATNNALVPDPDKFDYLASSAWQWPTLNVG 589
                    ED  Y    F++D  +  +  +      +    K+DY   +      + VG
Sbjct: 477 NR-----YSEDHHYI---FVED--NSVVKFLKLLKEYLYKQFKYDYYIKNYKAEGDVGVG 526

Query: 590 LRLCGWGDDNPKYFLLGTPAST--WASSV-AVLAFMATVVILLIRWQR-QYVDLRNPSNW 645
                W      +++ G    T  W S+V ++LA++    I LI W      D+  P ++
Sbjct: 527 ----KW-----PWYISGDYLDTAIWFSAVFSILAYLLLQTIRLITWNPWNVADVELPLSY 577

Query: 646 NVFLMGGFYPLLAWGLH-YMPFVIMSRVTYVHHYLPALYFALIILAYCFDAGLQKWSRSK 704
            +++  G    + W LH Y+ F  M    ++  YLP+L   L  +A    A   + + ++
Sbjct: 578 LLYIDNGLEFSVGWFLHYYIFFSSMHNRLFLFQYLPSLLLGLCHVATSAQAAWCQNNLTR 637

Query: 705 CGRIMRFVLYAGF 717
              ++  V   GF
Sbjct: 638 YALVVSAVTIFGF 650

>Scas_329.1
          Length = 273

 Score =  149 bits (376), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 89/212 (41%), Positives = 124/212 (58%), Gaps = 6/212 (2%)

Query: 74  LALFT---RMYKIGINNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYLAGY 130
           LALFT   R+  +   + VV+DE HFGKF SYY++ EF+ DVHPPL KML      LAG+
Sbjct: 64  LALFTASIRLPNLQKPDSVVFDEVHFGKFASYYIKGEFFMDVHPPLAKMLYAGVAALAGF 123

Query: 131 NGSWDFPS-GEIYPDYLDYVKMRLFNASFSALCVPLAYFTAKAIGFSLPTVWLMTVLVLF 189
            G++ F + G+++P  + YV MR F+A   AL V L Y T ++ G      ++       
Sbjct: 124 RGNFMFENIGDVFPADVPYVLMRFFSAMLGALTVMLLYLTLRSSGVRPWVAFVSGACFAI 183

Query: 190 ENSYSTLGRFILLDSMLLFFTVASFFSFVMFHNQRSKPFSRKWWKWLLITGISLGCTISV 249
           ENSY T+ R+ILLD+ L+FF  A+ +SF  + N +S  FS    K L + G++LG   S 
Sbjct: 184 ENSYVTISRYILLDAPLIFFIAAAVYSFKKYENYKS--FSIGSIKSLFVAGVALGMAASA 241

Query: 250 KMVGLFIITMVGIYTVIDLWTFLADKSMSWKT 281
           K VGLF I  VG+  +  LW  + D S S K+
Sbjct: 242 KWVGLFTIAWVGLLCIWRLWFMIGDLSKSTKS 273

>AAL050W [137] [Homologous to ScYDR307W - SH]
           complement(256490..258463) [1974 bp, 657 aa]
          Length = 657

 Score =  141 bits (356), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 112/364 (30%), Positives = 171/364 (46%), Gaps = 32/364 (8%)

Query: 213 SFFSFVMFHNQRS----KPFSRKWWKWLLITGISLGCTISVKMVGLFIITMVGIYTVIDL 268
           + F  ++ +N +S    +PF + WW  L    +  G     K VGL     V +     +
Sbjct: 176 AMFLAIILYNWKSFKLQEPFGQAWWLRLSAVAVCSGLAAGTKFVGLGTWAWVLLLNSAHI 235

Query: 269 WTFLADKSMSWKTYINHWLARIFGLIIVPFCIFLLCFKIHFDLLSHSGTGDANMPSLFQA 328
           +  + D  +S +T   H L R+  L +VP  I LL +  H    S+S    + MP+LF+A
Sbjct: 236 FQLIGDLEVSTRTVWKHVLIRLPLLTLVPLSIILLGYHSHLQAPSYSSRDSSYMPTLFKA 295

Query: 329 RLVGSDVGQGPRDIALGSSVVSIKNQALGGSLLHSHIQTYPDGSNQQQVTCYGYKDANNE 388
           +L G  V Q P  +  GS VV   + ++GG  LHSH  TYP GS +QQ+T Y ++DANN+
Sbjct: 296 QLDGYQVLQ-PASVYYGSGVVIRHSSSIGG-YLHSHELTYPGGSEEQQITLYDFEDANNK 353

Query: 389 WFFNRERGLPSWSENETDI----EYLKPGTSYRLVHKSTGRNLHTHPVAAPVSKTQW--E 442
           W        P ++E   DI    + ++ G   +L H  TG+ L       PVS+  +  E
Sbjct: 354 WTVE-----PVYNEAMDDIINSTQPVRNGDLIKLRHVQTGKLLRASAAKPPVSQRDYDQE 408

Query: 443 VSGYGDN-VVGDNKDNWVIEIMDQRGDEDPEKLHTLTTSFRI-KNLEMGCYLAQTGNSLP 500
           VS  GD+   GD+ + W ++I D    EDP+    +  S R+ K   +   L+  G +  
Sbjct: 409 VSCTGDSGYSGDSDETWRVDIQDAEYHEDPKAWFCIHFSPRVNKGPVLPPLLSHDGQAAE 468

Query: 501 EWGFRQQEVVCMKNP------FKRDKRTWWNIETHENERLPPRPEDF------QYPKTNF 548
                +QEV+C+ +P      F  D     + ET +  RL   P  F      QY    F
Sbjct: 469 VGPCTRQEVICLASPVHKYSLFYVDSSEMMHNETMQLPRL-SFPAKFWAYIHAQYKYDYF 527

Query: 549 LKDF 552
           +K+F
Sbjct: 528 VKNF 531

>Scas_588.7
          Length = 726

 Score =  107 bits (267), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 144/629 (22%), Positives = 251/629 (39%), Gaps = 77/629 (12%)

Query: 102 YYLRHEFYHDVHPPLGKMLVGLSGYLAGYNGSWDFPSGEIYPDYLDYVKMRLFNASFSAL 161
           YY + +F  +  PPLG  L  L             P G        Y  MRL + S S+ 
Sbjct: 142 YYQKDKFILNSFPPLGIQLYSL------------LPVGS-------YSAMRLMSLSASSF 182

Query: 162 CVPLAYFTAKAIGFSLPTVWLMTVLVLFENSYSTLGRFILLDSMLLFFTVASFFSFVMFH 221
            +   Y   + +        + TV +L    +      I LD++  F+   S +S+    
Sbjct: 183 SLLFLYLAFRRVNVPYLIALVSTVCILSIPLFRKESTRISLDTLQWFWLSISIYSWASL- 241

Query: 222 NQRSKPFSRKWWKWLLITGISLGCTISVKMVGLFIITMVGIYTVIDLWTFLADKSMSWKT 281
            +    FS KW    LI  +S+GC+++ K +G        + + I  W  + D  +S   
Sbjct: 242 -KCFSHFSIKWTIHSLIFAMSIGCSMATKYIGFATWGWAILISSIYFWQMIGDVRLSTSH 300

Query: 282 YINHWLARIFGLIIVPFCIFLLCFKIHFDLLSHSGTGDAN----MPSLFQARLVGSDVGQ 337
            + H   +IF L+++P  IF     +    ++HS          M S ++  L       
Sbjct: 301 IVKHTTFQIFCLLVIPMTIFATTLYLQ---INHSRIDSPEYSQYMSSYYKIFLRSKSPIL 357

Query: 338 GPRDIALGSSVVSIKNQALGGSLLHSHIQTYPDGSNQQQVTCYGYK-DANNEWFFNRERG 396
            P +I  GS +      +LGG L     ++YP+GS +Q V+    + + +N+W       
Sbjct: 358 QPMEITNGSIITIRHLNSLGGYLTSPANESYPEGSAEQIVSLTDMESNVDNQWILEY--- 414

Query: 397 LPSWSENETDIEYLKPGTSYRLVHKSTGRNLHTHPVAAPVSKTQW--EVSGYGD-NVVGD 453
                 ++ +   L      +L H++TG+ L       PVS+ ++  EVS  GD +  GD
Sbjct: 415 -----VDDYNKGPLIDSQRIKLRHRTTGKLLRASSAKPPVSEQEYNSEVSCTGDWDYHGD 469

Query: 454 NKDNWVIEIMDQRGDEDPEKLHTLTTSFRIKNLEMGCYLAQTGNSLPEWGFRQQEVVCMK 513
           + + W I++++         L        + N+   C L      LP+WG  +QEV C++
Sbjct: 470 SDEFWKIDLVEG-------SLIPCWNIMELDNVGQMCTLISHDTRLPDWGEFEQEVFCIQ 522

Query: 514 NPFKRDKRTWWNIETHENERLPPRPEDFQYPK-TNFLKDFIHLNLAMMATNN-------- 564
           +P    +R  + IE  +N+ +         P   N+ + + ++ LA              
Sbjct: 523 SP--DPQRAKFQIEFVDNDEIKNPITLAGLPGYGNYSRCYQYIKLAAELIQREFKYDYMV 580

Query: 565 ALVPDPDKFDYLASSAWQWPTLNVGLRLCGWGDDNPKYFLLGTPASTWASSVAVLAFMAT 624
            L  D D+ D +  +  +WP           G+D      L        SS+AV+     
Sbjct: 581 KLQNDNDENDKVHINKEKWPIYIT-------GNDTTDLIWL-------TSSIAVVIVACR 626

Query: 625 VVILLIRWQRQYVDLRNPS---NWNVFLMGGFYPLLAWGLHYMPFVIMSRV-TYVHHYLP 680
             + ++ W    +D  + S   N  ++       LL W +HY  F+  S     +  YLP
Sbjct: 627 FGLQVMNWNPWKIDNGDSSSHLNMKIYHEFAIESLLGWFVHYYIFLKSSNDHLEIVLYLP 686

Query: 681 ALYFALIILAYCFDAGLQKWSRSKCGRIM 709
           +  FA ++      A + +WS+ KC  I+
Sbjct: 687 SFVFAHLLATETVTA-IGQWSQWKCAIIL 714

>Kwal_33.14357
          Length = 657

 Score =  106 bits (265), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 119/431 (27%), Positives = 189/431 (43%), Gaps = 52/431 (12%)

Query: 101 SYYLRHEFYHDVHPPLGKMLVGLSGYLAGYNGSWDFPSGEIYPDYLDYVKMRLFNASFSA 160
           S Y++ EF+    PP    ++ L   + G                L    +R  N + +A
Sbjct: 69  SEYMKKEFFLMSSPPFMVQILALVSRIMGS---------------LSIEVLRKINLTTTA 113

Query: 161 LCVPLAYFTAKAIGF----SLPTVWLMTVLVLFENSYSTLGRFILLDSMLLFFTVA--SF 214
             V   Y      G     S  T   ++ L LF  +   L    L++  +LF +    S+
Sbjct: 114 FVVSSFYLALSRSGVVFVVSAVTAGSLSYLSLFAENSQHLS---LINFQVLFLSCCLLSW 170

Query: 215 FSFVMFHNQRSKPFSRKWWKWLLITGISLGCTISVKMVGLFIITMVGIYTVIDLWTFLAD 274
            SF     + S  F+R+W+  L    + L  ++S   +G    +   I  +  +W+ + D
Sbjct: 171 NSF-----KHSTSFTRRWYVALTSLSLFLSLSLSTTFLGAITWSWFLILMIKQMWSIVGD 225

Query: 275 KSMSWKTYINHWLARIFGLIIVPFCIFLLCFKIHFDLLSHSGTGDANMPSLFQARLVGSD 334
             +S    + H   R+  +I VPF + L  + +   LL+  G G  N  SL         
Sbjct: 226 VDVSMWKILKHTFWRVLMIICVPFGLMLSSYFVF--LLNSRGAG-MNHSSLVSPYFKTWF 282

Query: 335 VGQG---PRDIALGSSVVSIKNQALGGSLLHSHIQTYPDGSNQQQVTCYGY-KDANNEWF 390
           + QG   P  +  GS+++    ++LGG  LHSH  TY  GS +QQVT   +  DA+NEW 
Sbjct: 283 LPQGLPQPDAVYYGSNLLIRHAESLGG-YLHSHNYTYESGSLEQQVTLVDFSNDADNEWI 341

Query: 391 FNRERGLPSWSENETDIEYLKP---GTSYRLVHKSTGRNLHTHPVAAPVSKTQW--EVSG 445
              +      +EN    + L+P   G   +L H+++G+ L      APVS+  +  EVS 
Sbjct: 342 IEAQ------NENLKLDKTLQPVRNGDFVKLRHRTSGKLLRASSAKAPVSEQDYDHEVSC 395

Query: 446 YGD-NVVGDNKDNWVIEIMDQRGDEDPEK-LHTLTTSFRIKNLEMGCYLAQTGNSLPEWG 503
            GD +  GD+ + W I    +RG+   E  L   T  F ++N    C L      LP+WG
Sbjct: 396 TGDHDYTGDSDETWRIRF--ERGNTPNEGILCPFTMYFSLENKGHDCKLLSHDLRLPDWG 453

Query: 504 FRQQEVVCMKN 514
           F QQEV+C+ +
Sbjct: 454 FGQQEVLCVDS 464

>YDR307W (YDR307W) [1135] chr4 (1075857..1077845) Protein containing
           three MIR (protein mannosyltransferase, IP3R and RyR)
           domains, which may have a ligand transferase function,
           has weak similarity to mannosyltransferase (dolichyl
           phosphate-D-mannose:protein O-D-mannosyltransferase, S.
           cerevisiae Pmt1p) [1989 bp, 662 aa]
          Length = 662

 Score = 85.5 bits (210), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 95/377 (25%), Positives = 165/377 (43%), Gaps = 38/377 (10%)

Query: 191 NSYSTLGRFILLDSM---LLFFTVASFFSFVMFHNQRSKPFSRKWWKWLLITGISLGCTI 247
            ++   G  I  DS+   L    + SF S  +     +K  +  W+  ++   ISLG  I
Sbjct: 144 ETFRNEGTIISFDSLEWCLFSVVIYSFISISI-----AKLGTTNWFANVITLSISLGLAI 198

Query: 248 SVKMVGLFIITMVGIYTVIDLWTFLADKSMSWKTYINHWLARIFGLIIVPFCIFLLCFKI 307
           S K +G+     V +  V      ++D  ++    I   +  +  ++I+P  IF++ +  
Sbjct: 199 SSKFIGIVTWAFVILSFVRQFDRLISDVKVTTIQIIKFVILCLLFVLIIPGSIFIISYS- 257

Query: 308 HFDLLSHSGTGDAN----MPSLFQARLVGSDVGQGPRDIALGSSVVSIKNQALGGSLLHS 363
             +LLS+  T        M + F++ L G  V   P  +  GS++      ++ G  L S
Sbjct: 258 --NLLSNFKTDTPQFSKYMSTYFKSYLRGPQVQ--PSRLYYGSTITLRHLDSMVG-YLAS 312

Query: 364 HIQTYPDGSNQQQVT-CYGYKDANNEWFFNRERGLPSWSE--NETDIEYLKPGTSYRLVH 420
           H  +YP   ++Q V   +    A+NEW         S+SE  +   +  ++ G S +L H
Sbjct: 313 HDISYPSDVDEQLVALSFEEFAADNEWLIEHPTLNLSFSEVYHADQLIPVEFGQSIKLRH 372

Query: 421 KSTGRNLHTHPVAAPVSKTQW--EVSGYGD-NVVGDNKDNWVIEIM------DQRGDEDP 471
           KSTG+ L       P+S+  +  ++S   D N  G   + W + ++      D++ + D 
Sbjct: 373 KSTGKLLRASTAKPPISEQDYDFQISCTKDSNYEGGMDERWDVLLIKDEINNDKKDNADD 432

Query: 472 EKLHTLTTSFRIKNLEMGCYLAQTGNSLPEWGFRQQEVVCMKNPFKRDKRTWWNIETHEN 531
           + +  L +  R  N    C L      LPEWG  +QEV+CM+ P     RT + I++ + 
Sbjct: 433 KYIKPLQSEIRFYNNGQRCGLLGHDLRLPEWGRFEQEVLCMEYPVI--PRTTFLIDSVQ- 489

Query: 532 ERLPPRPEDFQYPKTNF 548
                 P DFQ P   +
Sbjct: 490 -----LPVDFQVPMIEY 501

>KLLA0C14828g complement(1292713..1294602) weakly similar to
           sp|Q06644 Saccharomyces cerevisiae YDR307w, start by
           similarity
          Length = 629

 Score = 77.8 bits (190), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 122/495 (24%), Positives = 186/495 (37%), Gaps = 72/495 (14%)

Query: 223 QRSKPFSRKWWKWLLITGISLGCTISVKMVGLFIITMVGIYTVIDLWTFLADKSMSWKTY 282
           Q SK FS  W+  + +  +SL   IS K +GL     + I ++  LW  + D  +  +  
Sbjct: 175 QASKDFSVDWYMNITLVSMSLIFVISGKFIGLVSWIWLIIVSLKSLWIVVGDLDVKNRQL 234

Query: 283 INHWLARIFGLIIVPFCIFLLCFKIHFDLLSHSGTGDANMPSLFQARLVGSDVGQGPRDI 342
                 R+   +++P       +       + S    A M S FQ   + S     P  I
Sbjct: 235 FAIMFCRLLFFVVIPLMSLWYSYSSLIGGFTTSSNSIAYMSSSFQHYSM-SQHNDIPSSI 293

Query: 343 ALGSSVVSIKNQALGGSLLHSHIQTYPDGSNQQQVTCYGYKDANNEWFFNRERGLPSWSE 402
             GSS+      +LGG L    I  YP  ++          D  N W     +G    +E
Sbjct: 294 IYGSSIRLRHVNSLGGYLSALEI-PYPKSNDTLVTVSDDPDDEANFWIIESNKGRN--TE 350

Query: 403 NETDIEYLKPGTSYRLVHKSTGRNLHTHPVAAPVSKTQWE--VSGYGD-NVVGDNKDNWV 459
                  +K     +L +K TG+ L       P+S  +++  +S  GD +  GD  + W 
Sbjct: 351 QTGSNALVKQTDKVKLRNKKTGQLLRASEEKPPISDKEYDKRISVTGDSDYQGDQDELWK 410

Query: 460 IEIMDQRGDEDPEKLHTLTTSFRIKNLEMGCYLAQTGNSLPEWGFRQQEVVCMKNPFKRD 519
           IEI  Q      E L        +KN    C L      +P WG R+QEV+C+ +P + +
Sbjct: 411 IEI--QGKASFREVLRPFKQFIVLKNPARRCSLLSHEIKIPHWGDRRQEVLCV-DPARVN 467

Query: 520 KRTWW-----NIETHENERLPPRPEDFQYPKTNFLKDFI----HLNLAMMATNNALVPDP 570
           +  ++     + E    E+    PE   YP      +++     LN      N ++ P P
Sbjct: 468 RALFYIDFVSSPEAGVVEKYKWAPE---YPFYKLAFEYVVGQFRLNKRQNIDNTSMSP-P 523

Query: 571 DKFDYLASSAWQWPTLNVGLRLCGWGDDNPKYFLLGTPASTWASSVAVLAFMATVVILLI 630
           D           WP L          D+N +   +    ST   SV V  FM     L  
Sbjct: 524 D--------CLSWPIL---------FDNNNQIGKILWITST--VSVGVYTFMEAYSWL-- 562

Query: 631 RWQRQYVDLRNPSNWNVF-----------LMGGFYPL---LAWGLHYMPFVI-MSRVTYV 675
                        +WN+F           LM     L   L W LH   F   + R   V
Sbjct: 563 -------------SWNIFEDTLLNTTANQLMKREVTLEAFLGWILHLYIFTYSLHRNLSV 609

Query: 676 HHYLPALYFALIILA 690
           + Y+P+L FA+IIL+
Sbjct: 610 NQYMPSLLFAVIILS 624

>Scas_710.0d
          Length = 271

 Score = 57.4 bits (137), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 43/148 (29%), Positives = 66/148 (44%), Gaps = 3/148 (2%)

Query: 589 GLRLCGWGDDNPKYFLLGTPASTWASSVAVLAFMATVVILLIRWQRQYVDLRNPSNWNVF 648
           G+   G  D +   +LLG     W+ +  +  F+   +  LI WQ     L++    N F
Sbjct: 2   GISYWGEHDQHLGIYLLGNAVVWWSVTAFIGIFVVLCLSELIAWQVGKPVLQDKDVIN-F 60

Query: 649 LMGGFYPLLAWGLHYMPFVIMSRVTYVHHYLPALYFALIILAYCFDAGLQKWSRSKCGRI 708
            +   + LL + +H  P  +M R  ++HHYLPA YF ++   +  D       R K  + 
Sbjct: 61  HIQVIHYLLGFAVHIGPSFLMGRQMFLHHYLPAYYFGILAFGHALDITATYVLRRK--KN 118

Query: 709 MRFVLYAGFMALVIGCFWYFSPISFGME 736
             + L A F AL    F   SPI +G E
Sbjct: 119 FAYTLLAVFFALSYYFFKDHSPIIYGTE 146

>YOR220W (YOR220W) [5012] chr15 (755328..756125) Protein of unknown
           function [798 bp, 265 aa]
          Length = 265

 Score = 30.0 bits (66), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 32/72 (44%), Gaps = 8/72 (11%)

Query: 135 DFPSGEIYPDYLDYVKMRLFNASFSALCVPLAYFTAKAIGFSLPTVWLMTVLVLFENSYS 194
           D PSG+    +   ++  LF   F  L   L Y+T        P  +L  ++++F+N   
Sbjct: 15  DIPSGKFTSKWPTQLEKTLFKEQFPNLQSHLQYYT--------PLPFLNRIIIIFDNEDD 66

Query: 195 TLGRFILLDSML 206
           TL  F  L  +L
Sbjct: 67  TLQVFKFLQELL 78

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.325    0.139    0.455 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 25,793,916
Number of extensions: 1168468
Number of successful extensions: 3364
Number of sequences better than 10.0: 42
Number of HSP's gapped: 3225
Number of HSP's successfully gapped: 42
Length of query: 746
Length of database: 16,596,109
Length adjustment: 109
Effective length of query: 637
Effective length of database: 12,822,747
Effective search space: 8168089839
Effective search space used: 8168089839
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 65 (29.6 bits)